Advanced Search (OLGA)

Gene: Chrm1 (cholinergic receptor, muscarinic 1) Rattus norvegicus

Analyze

Symbol:

Chrm1

Name:

cholinergic receptor, muscarinic 1

RGD ID:

2342

Description:

Enables G protein-coupled acetylcholine receptor activity. Involved in G protein-coupled acetylcholine receptor signaling pathway; neuromuscular synaptic transmission; and positive regulation of intracellular protein transport. Located in asymmetric synapse; axon terminus; and dendrite. Is active in glutamatergic synapse; postsynaptic density membrane; and presynaptic membrane. Human ortholog(s) of this gene implicated in Lambert-Eaton myasthenic syndrome; asthma; and myasthenia gravis. Orthologous to human CHRM1 (cholinergic receptor muscarinic 1); PARTICIPATES IN acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family; G protein mediated signaling pathway via Galphaq family; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-pilocarpine; (S)-amphetamine; acetylcholine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cholinergic receptor muscarin 1; cholinergic receptor, muscarin 1; M1 muscarinic acetylcholine receptor; muscarinic acetylcholine receptor M1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHRM1 (cholinergic receptor muscarinic 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Chrm1 (cholinergic receptor, muscarinic 1, CNS)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chrm1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHRM1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHRM1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chrm1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHRM1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHRM1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chrm1 (cholinergic receptor muscarinic 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CHRM1 (cholinergic receptor muscarinic 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chrm1 (cholinergic receptor, muscarinic 1, CNS)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chrm1a (cholinergic receptor, muscarinic 1a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gar-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mAChR-A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chrm1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	214,996,180 - 215,012,136 (+)	NCBI		GRCr8
mRatBN7.2	1	205,567,226 - 205,583,001 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	205,567,220 - 205,582,356 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	213,986,616 - 213,987,998 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	221,024,093 - 221,025,475 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	213,716,796 - 213,718,178 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	224,869,087 - 224,885,101 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	224,882,439 - 224,884,205 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	231,806,335 - 231,822,359 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	211,351,738 - 211,353,120 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	211,510,167 - 211,511,550 (+)	NCBI
Celera	1	203,093,639 - 203,095,021 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	asthma		ISO	RGD:731068	5133416		RGD
Chrm1	Rat	Lambert-Eaton myasthenic syndrome		ISO	RGD:731068	5133415		RGD
Chrm1	Rat	Memory Disorders		ISO	RGD:731069	734777		RGD
Chrm1	Rat	myasthenia gravis		ISO	RGD:731068	5133415		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	intellectual disability		ISO	RGD:731068	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Chrm1	Rat	leukocyte adhesion deficiency 3		ISO	RGD:731068	8554872	ClinVar Annotator: match by term: Leukocyte adhesion deficiency 3	ClinVar	PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	brain ischemia		ISO	RGD:731068	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18501976
Chrm1	Rat	epilepsy		ISO	RGD:731068	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18333967
Chrm1	Rat	Memory Disorders		ISO	RGD:731068	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21682298

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	(+)-pilocarpine	multiple interactions	ISO	RGD:731068	6480464	[Pilocarpine results in increased activity of CHRM1 protein] which results in increased abundance of Calcium; more ...	CTD	PMID:11527950\|PMID:9224827
Chrm1	Rat	(+)-pilocarpine	increases expression	ISO	RGD:731068	6480464	Pilocarpine results in increased expression of CHRM1 protein	CTD	PMID:32234387
Chrm1	Rat	(+)-pilocarpine	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to Pilocarpine	CTD	PMID:9224827
Chrm1	Rat	(+)-pilocarpine	decreases expression	EXP		6480464	Pilocarpine results in decreased expression of CHRM1 protein	CTD	PMID:14559291\|PMID:16137708\|PMID:16563474
Chrm1	Rat	(+)-pilocarpine	multiple interactions	EXP		6480464	Pilocarpine inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]; Pilocarpine promotes the reaction [N-Methylscopolamine binds more ...	CTD	PMID:14559291\|PMID:16137708
Chrm1	Rat	(+)-pilocarpine	increases activity	ISO	RGD:731069	6480464	Pilocarpine results in increased activity of CHRM1 protein	CTD	PMID:15967574
Chrm1	Rat	(+)-pilocarpine	decreases expression	ISO	RGD:731069	6480464	Pilocarpine results in decreased expression of CHRM1 protein	CTD	PMID:15967574
Chrm1	Rat	(+)-pilocarpine	multiple interactions	ISO	RGD:731069	6480464	CHRM1 protein mutant form inhibits the reaction [Pilocarpine results in increased hydrolysis of Phosphatidylinositols]	CTD	PMID:12713643
Chrm1	Rat	(+)-pilocarpine	affects response to substance	ISO	RGD:731069	6480464	CHRM1 protein affects the susceptibility to Pilocarpine	CTD	PMID:12713643
Chrm1	Rat	(+)-pilocarpine	increases activity	ISO	RGD:731068	6480464	Pilocarpine results in increased activity of CHRM1 protein	CTD	PMID:11527950
Chrm1	Rat	(S)-amphetamine	multiple interactions	EXP		6480464	Clozapine inhibits the reaction [Dextroamphetamine results in decreased expression of CHRM1 protein]	CTD	PMID:18806925
Chrm1	Rat	(S)-amphetamine	decreases expression	EXP		6480464	Dextroamphetamine results in decreased expression of CHRM1 protein	CTD	PMID:18806925
Chrm1	Rat	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	increases expression	ISO	RGD:731068	6480464	o,p'-DDT results in increased expression of CHRM1 mRNA; o,p'-DDT results in increased expression of CHRM1 more ...	CTD	PMID:38615785
Chrm1	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:731069	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Chrm1	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:731069	6480464	ethylene dichloride results in decreased expression of CHRM1 mRNA	CTD	PMID:28960355
Chrm1	Rat	1-Oleoyl-2-acetyl-sn-glycerol	multiple interactions	ISO	RGD:731069	6480464	1-oleoyl-2-acetylglycerol promotes the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	17beta-estradiol	decreases expression	ISO	RGD:731069	6480464	Estradiol results in decreased expression of CHRM1 mRNA	CTD	PMID:39298647
Chrm1	Rat	17beta-hydroxy-5alpha-androstan-3-one	multiple interactions	ISO	RGD:731068	6480464	Cycloheximide inhibits the reaction [Dihydrotestosterone results in decreased expression of CHRM1 mRNA]	CTD	PMID:17624924
Chrm1	Rat	17beta-hydroxy-5alpha-androstan-3-one	decreases expression	ISO	RGD:731068	6480464	Dihydrotestosterone results in decreased expression of CHRM1 mRNA	CTD	PMID:17624924
Chrm1	Rat	1D-myo-inositol 1,4,5-trisphosphate	affects abundance	ISO	RGD:731069	6480464	CHRM1 protein affects the abundance of Inositol 1,4,5-Trisphosphate	CTD	PMID:19002953
Chrm1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:731069	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Chrm1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:731069	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Chrm1	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	RGD:731069	6480464	2,3',4,4',5-pentachlorobiphenyl results in increased expression of CHRM1 mRNA	CTD	PMID:31388691
Chrm1	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:731069	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Chrm1	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:731069	6480464	4,4'-diaminodiphenylmethane results in increased expression of CHRM1 mRNA	CTD	PMID:18648102
Chrm1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:731069	6480464	bisphenol S results in decreased expression of CHRM1 mRNA	CTD	PMID:39298647
Chrm1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:731069	6480464	bisphenol S affects the methylation of CHRM1 gene	CTD	PMID:31683443
Chrm1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:731069	6480464	bisphenol S results in decreased methylation of CHRM1 exon	CTD	PMID:33297965
Chrm1	Rat	4-DAMP(1+)	multiple interactions	ISO	RGD:731068	6480464	4-diphenylacetoxy-1,1-dimethylpiperidinium inhibits the reaction [Scopolamine Derivatives binds to CHRM1 protein]	CTD	PMID:11306684
Chrm1	Rat	5-azacytidine	affects expression	ISO	RGD:731069	6480464	Azacitidine affects the expression of CHRM1 mRNA	CTD	PMID:19002953
Chrm1	Rat	acetylcholine	increases activity	ISO	RGD:731068	6480464	Acetylcholine results in increased activity of CHRM1 protein	CTD	PMID:11527950\|PMID:31830555
Chrm1	Rat	acetylcholine	affects binding	ISO	RGD:731068	6480464	Acetylcholine binds to CHRM1 protein; CHRM1 protein binds to Acetylcholine	CTD	PMID:10069518\|PMID:10860942\|PMID:9224827\|PMID:9495826
Chrm1	Rat	acetylcholine	multiple interactions	EXP		6480464	Pregnenolone inhibits the reaction [Acetylcholine binds to CHRM1 protein]; Progesterone inhibits the reaction [Acetylcholine binds more ...	CTD	PMID:14534362\|PMID:15900516
Chrm1	Rat	acetylcholine	increases activity	EXP		6480464	Acetylcholine results in increased activity of CHRM1 protein	CTD	PMID:14534362
Chrm1	Rat	acetylcholine	multiple interactions	ISO	RGD:731068	6480464	[Acetylcholine results in increased activity of CHRM1 protein] which results in increased abundance of Calcium; more ...	CTD	PMID:10069518\|PMID:10101037\|PMID:10860942\|PMID:11527950\|PMID:30102254\|PMID:9224827\|PMID:9495826
Chrm1	Rat	alpha-D-galactose	multiple interactions	ISO	RGD:731069	6480464	catalpol inhibits the reaction [Galactose results in decreased expression of CHRM1 protein]	CTD	PMID:23612000
Chrm1	Rat	alpha-D-galactose	decreases expression	ISO	RGD:731069	6480464	Galactose results in decreased expression of CHRM1 protein	CTD	PMID:23612000
Chrm1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of CHRM1 mRNA	CTD	PMID:16483693
Chrm1	Rat	amphetamine	multiple interactions	EXP		6480464	[muscarinic toxin 7 binds to and results in decreased activity of CHRM1 protein] inhibits the more ...	CTD	PMID:18991861
Chrm1	Rat	arsenite(3-)	increases expression	ISO	RGD:731069	6480464	arsenite results in increased expression of CHRM1 mRNA	CTD	PMID:33053406
Chrm1	Rat	arsenite(3-)	increases methylation	ISO	RGD:731068	6480464	arsenite results in increased methylation of CHRM1 promoter	CTD	PMID:23974009
Chrm1	Rat	atropine	multiple interactions	ISO	RGD:731069	6480464	Atropine binds to and results in decreased activity of CHRM1 protein; Atropine inhibits the reaction more ...	CTD	PMID:18316702
Chrm1	Rat	atropine	decreases activity	ISO	RGD:731068	6480464	Atropine results in decreased activity of CHRM1 protein	CTD	PMID:31830555
Chrm1	Rat	atropine	multiple interactions	ISO	RGD:731068	6480464	Atropine affects the reaction [muscarinic toxin 7 binds to CHRM1 protein]	CTD	PMID:16439611
Chrm1	Rat	Bardoxolone methyl	decreases activity	ISO	RGD:731068	6480464	bardoxolone methyl results in decreased activity of CHRM1 protein	CTD	PMID:28790194
Chrm1	Rat	benzamide	increases expression	ISO	RGD:731069	6480464	benzamide results in increased expression of CHRM1 mRNA; benzamide results in increased expression of CHRM1 more ...	CTD	PMID:18501976
Chrm1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:731069	6480464	Benzo(a)pyrene results in increased expression of CHRM1 mRNA	CTD	PMID:32417428
Chrm1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:731068	6480464	Benzo(a)pyrene affects the methylation of CHRM1 promoter	CTD	PMID:27901495
Chrm1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:731068	6480464	Benzo(a)pyrene results in decreased methylation of CHRM1 5' UTR	CTD	PMID:27901495
Chrm1	Rat	bethanechol	multiple interactions	ISO	RGD:731068	6480464	brucine promotes the reaction [Bethanechol binds to CHRM1 protein]	CTD	PMID:9224827
Chrm1	Rat	bethanechol	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to Bethanechol	CTD	PMID:9224827
Chrm1	Rat	bifenthrin	decreases expression	EXP		6480464	bifenthrin results in decreased expression of CHRM1 mRNA	CTD	PMID:29775722\|PMID:30978409
Chrm1	Rat	biperiden	multiple interactions	EXP		6480464	Biperiden binds to and results in decreased activity of CHRM1 protein	CTD	PMID:21336581
Chrm1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:731069	6480464	Diethylhexyl Phthalate results in decreased expression of CHRM1 mRNA	CTD	PMID:34319233
Chrm1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CHRM1 mRNA	CTD	PMID:30816183
Chrm1	Rat	bisphenol A	decreases expression	ISO	RGD:731069	6480464	bisphenol A results in decreased expression of CHRM1 mRNA	CTD	PMID:32156529
Chrm1	Rat	brucine	multiple interactions	ISO	RGD:731068	6480464	brucine affects the reaction [muscarinic toxin 7 binds to CHRM1 protein]; brucine affects the reaction more ...	CTD	PMID:10069518\|PMID:10101037\|PMID:15294002\|PMID:16439611\|PMID:9224827\|PMID:9495826
Chrm1	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of CHRM1 mRNA	CTD	PMID:19167457
Chrm1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of CHRM1 promoter	CTD	PMID:22457795
Chrm1	Rat	cadmium dichloride	decreases activity	ISO	RGD:731069	6480464	Cadmium Chloride results in decreased activity of CHRM1 protein	CTD	PMID:27377441
Chrm1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:731069	6480464	[[Cadmium Chloride results in decreased activity of CHRM1 protein] which affects the expression of ACHE more ...	CTD	PMID:26026611\|PMID:27377441
Chrm1	Rat	cadmium dichloride	multiple interactions	EXP		6480464	Quercetin inhibits the reaction [Cadmium Chloride results in decreased expression of CHRM1 mRNA]	CTD	PMID:27389774
Chrm1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of CHRM1 mRNA	CTD	PMID:27389774
Chrm1	Rat	cadmium dichloride	decreases activity	EXP		6480464	Cadmium Chloride results in decreased activity of CHRM1 protein	CTD	PMID:27377441
Chrm1	Rat	calcium atom	multiple interactions	ISO	RGD:731069	6480464	1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	calcium atom	multiple interactions	EXP		6480464	[[[AVP binds to and results in increased activity of AVPR1A protein] which results in increased more ...	CTD	PMID:11553362
Chrm1	Rat	calcium atom	multiple interactions	ISO	RGD:731068	6480464	[Acetylcholine results in increased activity of CHRM1 protein] which results in increased abundance of Calcium; more ...	CTD	PMID:11527950\|PMID:12456425
Chrm1	Rat	calcium(0)	multiple interactions	ISO	RGD:731069	6480464	1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	calcium(0)	multiple interactions	EXP		6480464	[[[AVP binds to and results in increased activity of AVPR1A protein] which results in increased more ...	CTD	PMID:11553362
Chrm1	Rat	calcium(0)	multiple interactions	ISO	RGD:731068	6480464	[Acetylcholine results in increased activity of CHRM1 protein] which results in increased abundance of Calcium; more ...	CTD	PMID:11527950\|PMID:12456425
Chrm1	Rat	canagliflozin	multiple interactions	EXP		6480464	Canagliflozin affects the reaction [Scopolamine results in decreased expression of CHRM1 protein]	CTD	PMID:28837785
Chrm1	Rat	canagliflozin	decreases expression	EXP		6480464	Canagliflozin results in decreased expression of CHRM1 protein	CTD	PMID:28837785
Chrm1	Rat	carbachol	increases activity	ISO	RGD:731069	6480464	Carbachol results in increased activity of CHRM1 protein	CTD	PMID:18316702
Chrm1	Rat	carbachol	multiple interactions	ISO	RGD:731069	6480464	1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	carbachol	increases activity	ISO	RGD:731068	6480464	Carbachol results in increased activity of CHRM1 protein	CTD	PMID:11527950\|PMID:8683117
Chrm1	Rat	carbachol	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to Carbachol	CTD	PMID:9224827
Chrm1	Rat	carbachol	multiple interactions	ISO	RGD:731068	6480464	[Carbachol results in increased activity of CHRM1 protein] which results in increased abundance of Calcium; more ...	CTD	PMID:11527950\|PMID:8683117\|PMID:9224827
Chrm1	Rat	catalpol	multiple interactions	ISO	RGD:731069	6480464	catalpol inhibits the reaction [Galactose results in decreased expression of CHRM1 protein]	CTD	PMID:23612000
Chrm1	Rat	chlorohydrocarbon	decreases expression	EXP		6480464	Hydrocarbons, Chlorinated results in decreased expression of CHRM1 mRNA	CTD	PMID:22872703
Chrm1	Rat	chlorpyrifos	decreases activity	EXP		6480464	Chlorpyrifos results in decreased activity of CHRM1 protein	CTD	PMID:17666426
Chrm1	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of CHRM1 mRNA; Chlorpyrifos results in decreased expression of CHRM1 more ...	CTD	PMID:16675515\|PMID:30035273
Chrm1	Rat	chlorpyrifos	affects expression	EXP		6480464	Chlorpyrifos affects the expression of CHRM1 mRNA	CTD	PMID:18812211
Chrm1	Rat	clozapine	affects binding	ISO	RGD:731068	6480464	Clozapine analog binds to CHRM1 protein; Clozapine binds to CHRM1 protein	CTD	PMID:11997696\|PMID:16983399
Chrm1	Rat	clozapine	increases expression	EXP		6480464	Clozapine results in increased expression of CHRM1 protein	CTD	PMID:18806925
Chrm1	Rat	clozapine	multiple interactions	EXP		6480464	Clozapine inhibits the reaction [Dextroamphetamine results in decreased expression of CHRM1 protein]	CTD	PMID:18806925
Chrm1	Rat	cocaine	increases expression	ISO	RGD:731069	6480464	Cocaine results in increased expression of CHRM1 protein	CTD	PMID:35597300
Chrm1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of CHRM1 mRNA	CTD	PMID:26577399\|PMID:27523638
Chrm1	Rat	cycloheximide	multiple interactions	ISO	RGD:731068	6480464	Cycloheximide inhibits the reaction [Dihydrotestosterone results in decreased expression of CHRM1 mRNA]	CTD	PMID:17624924
Chrm1	Rat	DDE	increases expression	ISO	RGD:731068	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of CHRM1 mRNA; Dichlorodiphenyl Dichloroethylene results in increased expression more ...	CTD	PMID:38615785
Chrm1	Rat	DDT	increases expression	ISO	RGD:731068	6480464	DDT results in increased expression of CHRM1 mRNA; DDT results in increased expression of CHRM1 more ...	CTD	PMID:38615785
Chrm1	Rat	diazinon	affects expression	EXP		6480464	Diazinon affects the expression of CHRM1 mRNA	CTD	PMID:17452286
Chrm1	Rat	diazinon	decreases expression	EXP		6480464	Diazinon results in decreased expression of CHRM1 mRNA	CTD	PMID:18812211
Chrm1	Rat	dichlorvos	decreases expression	EXP		6480464	Dichlorvos results in decreased expression of CHRM1 protein	CTD	PMID:19100812
Chrm1	Rat	dieldrin	decreases expression	EXP		6480464	Dieldrin results in decreased expression of CHRM1 mRNA	CTD	PMID:18812211
Chrm1	Rat	dimethoate	decreases expression	EXP		6480464	Dimethoate results in decreased expression of CHRM1 mRNA; Dimethoate results in decreased expression of CHRM1 more ...	CTD	PMID:14694657\|PMID:15033006
Chrm1	Rat	disulfoton	decreases expression	EXP		6480464	Disulfoton results in decreased expression of CHRM1 mRNA	CTD	PMID:8856746
Chrm1	Rat	flufenamic acid	multiple interactions	ISO	RGD:731069	6480464	Flufenamic Acid inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results more ...	CTD	PMID:18316702
Chrm1	Rat	flunarizine	multiple interactions	ISO	RGD:731069	6480464	Flunarizine inhibits the reaction [Quinuclidinyl Benzilate binds to CHRM1 protein]	CTD	PMID:9533112
Chrm1	Rat	furtrethonium	multiple interactions	ISO	RGD:731068	6480464	brucine promotes the reaction [furtrethonium binds to CHRM1 protein]	CTD	PMID:9224827
Chrm1	Rat	furtrethonium	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to furtrethonium	CTD	PMID:9224827
Chrm1	Rat	gadolinium atom	multiple interactions	ISO	RGD:731069	6480464	Gadolinium inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	galactose	multiple interactions	ISO	RGD:731069	6480464	catalpol inhibits the reaction [Galactose results in decreased expression of CHRM1 protein]	CTD	PMID:23612000
Chrm1	Rat	galactose	decreases expression	ISO	RGD:731069	6480464	Galactose results in decreased expression of CHRM1 protein	CTD	PMID:23612000
Chrm1	Rat	galanthamine	decreases expression	EXP		6480464	Galantamine results in decreased expression of CHRM1 protein	CTD	PMID:28837785
Chrm1	Rat	galanthamine Trifluoroacetic acid	decreases expression	EXP		6480464	Galantamine results in decreased expression of CHRM1 protein	CTD	PMID:28837785
Chrm1	Rat	genistein	increases expression	ISO	RGD:731069	6480464	Genistein results in increased expression of CHRM1 mRNA	CTD	PMID:32186404
Chrm1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CHRM1 mRNA	CTD	PMID:33387578
Chrm1	Rat	glyphosate	affects methylation	EXP		6480464	Glyphosate affects the methylation of CHRM1 gene	CTD	PMID:35440735
Chrm1	Rat	imidacloprid	increases expression	EXP		6480464	imidacloprid results in increased expression of CHRM1 mRNA	CTD	PMID:26568164
Chrm1	Rat	iron(III) nitrilotriacetate	decreases expression	EXP		6480464	ferric nitrilotriacetate results in decreased expression of CHRM1 mRNA	CTD	PMID:19490752
Chrm1	Rat	ketamine	multiple interactions	ISO	RGD:731068	6480464	Ketamine inhibits the reaction [Scopolamine Derivatives binds to CHRM1 protein]	CTD	PMID:12456425
Chrm1	Rat	KT 5720	multiple interactions	ISO	RGD:731068	6480464	KT 5720 affects the reaction [muscarinic toxin 7 binds to CHRM1 protein]; KT 5720 promotes more ...	CTD	PMID:10860942\|PMID:16439611
Chrm1	Rat	KT 5823	multiple interactions	ISO	RGD:731068	6480464	KT 5823 promotes the reaction [N-Methylscopolamine binds to CHRM1 protein]	CTD	PMID:10860942
Chrm1	Rat	lanthanum atom	multiple interactions	ISO	RGD:731069	6480464	Lanthanum inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	methoctramine tetrahydrochloride	multiple interactions	ISO	RGD:731068	6480464	methoctramine inhibits the reaction [Scopolamine Derivatives binds to CHRM1 protein]	CTD	PMID:11306684
Chrm1	Rat	methscopolamine	multiple interactions	ISO	RGD:731068	6480464	brucine analog affects the reaction [N-Methylscopolamine binds to CHRM1 protein]; brucine N-oxide promotes the reaction more ...	CTD	PMID:10069518\|PMID:10845706\|PMID:10860942\|PMID:16439611\|PMID:16709648\|PMID:9495826\|PMID:9846649
Chrm1	Rat	methscopolamine	multiple interactions	EXP		6480464	Pilocarpine inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]; Pilocarpine promotes the reaction [N-Methylscopolamine binds more ...	CTD	PMID:14559291\|PMID:16137708
Chrm1	Rat	methscopolamine	affects binding	EXP		6480464	N-Methylscopolamine binds to CHRM1 protein	CTD	PMID:14559291\|PMID:16137708
Chrm1	Rat	methscopolamine	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to N-Methylscopolamine; N-Methylscopolamine binds to CHRM1 protein	CTD	PMID:10069518\|PMID:10845706\|PMID:10860942\|PMID:16439611\|PMID:16709648\|PMID:9224827\|PMID:9495826\|PMID:9846649
Chrm1	Rat	misoprostol	multiple interactions	EXP		6480464	Misoprostol inhibits the reaction [(4-(m-Chlorophenylcarbamoyloxy)-2-butynyl)trimethylammonium Chloride binds to and results in increased activity of CHRM1 more ...	CTD	PMID:2459756
Chrm1	Rat	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of CHRM1 mRNA	CTD	PMID:18812211
Chrm1	Rat	nitric oxide	multiple interactions	EXP		6480464	[(4-(m-Chlorophenylcarbamoyloxy)-2-butynyl)trimethylammonium Chloride binds to CHRM1 protein] which results in increased abundance of Nitric Oxide; [muscarinic more ...	CTD	PMID:18991861
Chrm1	Rat	okadaic acid	affects expression	ISO	RGD:731068	6480464	Okadaic Acid affects the expression of CHRM1 mRNA	CTD	PMID:38832940
Chrm1	Rat	olanzapine	affects binding	ISO	RGD:731068	6480464	olanzapine binds to CHRM1 protein	CTD	PMID:16983399
Chrm1	Rat	oxotremorine M	multiple interactions	ISO	RGD:731068	6480464	brucine promotes the reaction [oxotremorine M binds to CHRM1 protein]	CTD	PMID:9224827
Chrm1	Rat	oxotremorine M	affects binding	ISO	RGD:731068	6480464	CHRM1 protein binds to oxotremorine M	CTD	PMID:9224827
Chrm1	Rat	pancuronium	multiple interactions	ISO	RGD:731068	6480464	Pancuronium inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]	CTD	PMID:9846649
Chrm1	Rat	paraoxon	decreases expression	ISO	RGD:731068	6480464	Paraoxon results in decreased expression of CHRM1 mRNA	CTD	PMID:21787676
Chrm1	Rat	parathion-methyl	decreases activity	EXP		6480464	Methyl Parathion results in decreased activity of CHRM1 protein	CTD	PMID:17666426
Chrm1	Rat	parathion-methyl	decreases expression	EXP		6480464	Methyl Parathion results in decreased expression of CHRM1 protein	CTD	PMID:14746346\|PMID:16645783\|PMID:18650256\|PMID:30035273
Chrm1	Rat	PCB138	multiple interactions	ISO	RGD:731069	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Chrm1	Rat	pentachlorophenol	decreases expression	ISO	RGD:731069	6480464	Pentachlorophenol results in decreased expression of CHRM1 mRNA	CTD	PMID:23892564
Chrm1	Rat	picrotoxin	increases expression	EXP		6480464	Picrotoxin results in increased expression of CHRM1 mRNA	CTD	PMID:15170462
Chrm1	Rat	pioglitazone	multiple interactions	ISO	RGD:731069	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of CHRM1 mRNA	CTD	PMID:27935865
Chrm1	Rat	Pipecuronium	multiple interactions	ISO	RGD:731068	6480464	Pipecuronium inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]	CTD	PMID:9846649
Chrm1	Rat	pirenzepine	multiple interactions	ISO	RGD:731068	6480464	brucine affects the reaction [Pirenzepine analog binds to CHRM1 protein]; Pirenzepine inhibits the reaction [N-Methylscopolamine more ...	CTD	PMID:11306684\|PMID:15294002\|PMID:9846649
Chrm1	Rat	pirenzepine	affects binding	ISO	RGD:731068	6480464	Pirenzepine analog binds to CHRM1 protein	CTD	PMID:15294002
Chrm1	Rat	pirenzepine	multiple interactions	ISO	RGD:731069	6480464	Pirenzepine binds to and results in decreased activity of CHRM1 protein; Pirenzepine inhibits the reaction more ...	CTD	PMID:18316702
Chrm1	Rat	pirenzepine	multiple interactions	EXP		6480464	Pirenzepine binds to and results in decreased activity of CHRM1 protein	CTD	PMID:12646291\|PMID:8032910
Chrm1	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of CHRM1 mRNA	CTD	PMID:19162173
Chrm1	Rat	pregnenolone	multiple interactions	EXP		6480464	Pregnenolone inhibits the reaction [Acetylcholine binds to CHRM1 protein]; Pregnenolone inhibits the reaction [Quinuclidinyl Benzilate more ...	CTD	PMID:15900516
Chrm1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of CHRM1 mRNA	CTD	PMID:19162173
Chrm1	Rat	progesterone	multiple interactions	EXP		6480464	Progesterone inhibits the reaction [Acetylcholine binds to CHRM1 protein]; Progesterone inhibits the reaction [Quinuclidinyl Benzilate more ...	CTD	PMID:15900516
Chrm1	Rat	propofol	multiple interactions	EXP		6480464	Propofol inhibits the reaction [Acetylcholine results in increased activity of CHRM1 protein]; Propofol inhibits the more ...	CTD	PMID:14534362
Chrm1	Rat	quercetin	multiple interactions	EXP		6480464	Quercetin inhibits the reaction [Cadmium Chloride results in decreased expression of CHRM1 mRNA]	CTD	PMID:27389774
Chrm1	Rat	reserpine	increases expression	EXP		6480464	Reserpine results in increased expression of CHRM1 mRNA	CTD	PMID:1506860
Chrm1	Rat	reserpine	decreases expression	EXP		6480464	Reserpine results in decreased expression of CHRM1 protein	CTD	PMID:1506860
Chrm1	Rat	resveratrol	multiple interactions	EXP		6480464	resveratrol inhibits the reaction [(4-(m-Chlorophenylcarbamoyloxy)-2-butynyl)trimethylammonium Chloride binds to and results in increased activity of CHRM1 more ...	CTD	PMID:19967050
Chrm1	Rat	rocuronium	multiple interactions	ISO	RGD:731068	6480464	rocuronium inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]	CTD	PMID:9846649
Chrm1	Rat	scopolamine	multiple interactions	EXP		6480464	[[[AVP binds to and results in increased activity of AVPR1A protein] which results in increased more ...	CTD	PMID:11553362\|PMID:28837785
Chrm1	Rat	scopolamine	decreases expression	ISO	RGD:731069	6480464	Scopolamine results in decreased expression of CHRM1 protein	CTD	PMID:32001261
Chrm1	Rat	scopolamine	decreases expression	EXP		6480464	Scopolamine results in decreased expression of CHRM1 protein	CTD	PMID:28837785
Chrm1	Rat	scopolamine	increases expression	ISO	RGD:731069	6480464	Scopolamine results in increased expression of CHRM1 mRNA	CTD	PMID:26434561
Chrm1	Rat	scopolamine	multiple interactions	ISO	RGD:731069	6480464	7-fluoro-1,3-diphenylisoquinoline-1-amine inhibits the reaction [Scopolamine results in decreased expression of CHRM1 protein]; Plant Extracts inhibits more ...	CTD	PMID:26434561\|PMID:32001261
Chrm1	Rat	sodium arsenite	affects methylation	ISO	RGD:731068	6480464	sodium arsenite affects the methylation of CHRM1 gene	CTD	PMID:28589171
Chrm1	Rat	sparteine	decreases expression	EXP		6480464	Sparteine results in decreased expression of CHRM1 mRNA; Sparteine results in decreased expression of CHRM1 more ...	CTD	PMID:16843632
Chrm1	Rat	staurosporine	multiple interactions	ISO	RGD:731068	6480464	Staurosporine affects the reaction [KT 5720 promotes the reaction [N-Methylscopolamine binds to CHRM1 protein]]; Staurosporine more ...	CTD	PMID:10860942\|PMID:16439611
Chrm1	Rat	staurosporine	affects binding	ISO	RGD:731068	6480464	Staurosporine binds to CHRM1 protein	CTD	PMID:10860942
Chrm1	Rat	tacrine	multiple interactions	EXP		6480464	Tacrine inhibits the reaction [telenzepine binds to CHRM1 protein]	CTD	PMID:2606156
Chrm1	Rat	tacrine	multiple interactions	ISO	RGD:731068	6480464	Tacrine affects the reaction [muscarinic toxin 7 binds to CHRM1 protein]	CTD	PMID:16439611
Chrm1	Rat	taurolithocholic acid sulfate	affects binding	ISO	RGD:731068	6480464	taurolithocholic acid 3-sulfate binds to CHRM1 protein	CTD	PMID:12464352
Chrm1	Rat	tetrachloromethane	increases expression	ISO	RGD:731069	6480464	Carbon Tetrachloride results in increased expression of CHRM1 protein	CTD	PMID:32234387
Chrm1	Rat	tetrachloromethane	increases expression	ISO	RGD:731068	6480464	Carbon Tetrachloride results in increased expression of CHRM1 protein	CTD	PMID:32234387
Chrm1	Rat	thapsigargin	multiple interactions	ISO	RGD:731069	6480464	Thapsigargin inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	tiotropium bromide	affects binding	ISO	RGD:731068	6480464	Tiotropium Bromide binds to CHRM1 protein	CTD	PMID:21870878
Chrm1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CHRM1 mRNA	CTD	PMID:33387578
Chrm1	Rat	tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate	multiple interactions	ISO	RGD:731069	6480464	Atropine binds to and results in decreased activity of CHRM1 protein; Atropine inhibits the reaction more ...	CTD	PMID:18316702
Chrm1	Rat	tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate	decreases activity	ISO	RGD:731068	6480464	Atropine results in decreased activity of CHRM1 protein	CTD	PMID:31830555
Chrm1	Rat	tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate	multiple interactions	ISO	RGD:731068	6480464	Atropine affects the reaction [muscarinic toxin 7 binds to CHRM1 protein]	CTD	PMID:16439611
Chrm1	Rat	U-73122	multiple interactions	ISO	RGD:731069	6480464	1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [[Carbachol results in increased activity of CHRM1 protein] which results in more ...	CTD	PMID:18316702
Chrm1	Rat	vecuronium bromide	multiple interactions	ISO	RGD:731068	6480464	Vecuronium Bromide inhibits the reaction [N-Methylscopolamine binds to CHRM1 protein]	CTD	PMID:9846649
Chrm1	Rat	xanomeline	increases response to substance	ISO	RGD:731069	6480464	CHRM1 gene results in increased susceptibility to xanomeline; CHRM1 results in increased susceptibility to xanomeline	CTD	PMID:19111716\|PMID:19996296
Chrm1	Rat	xanomeline	multiple interactions	EXP		6480464	xanomeline binds to and results in increased activity of [CHRM1 protein binds to CHRM4 protein]	CTD	PMID:21211109

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	involved_in	IBA	MGI:88399\|PANTHER:PTN001207082	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	chemical synaptic transmission	involved_in	IBA	MGI:88398\|MGI:94926\|PANTHER:PTN000664111\|RGD:2342\|RGD:2522\|RGD:2830\|RGD:2846\|WB:WBGene00001517	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	cognition	involved_in	IEA	InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	entrainment of circadian clock	involved_in	ISO	RGD:14227533	1624291	PMID:12196552	RGD	PMID:12196552
Chrm1	Rat	G protein-coupled acetylcholine receptor signaling pathway		IDA		724727		RGD
Chrm1	Rat	G protein-coupled acetylcholine receptor signaling pathway	involved_in	ISO	RGD:14227533	1624291	PMID:12196552	RGD	PMID:12196552
Chrm1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276\|InterPro:IPR000995\|InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrm1	Rat	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	involved_in	IBA	PANTHER:PTN000664111\|RGD:2851\|RGD:62044\|UniProtKB:A0A8V0XI02\|UniProtKB:D3Y1H8\|UniProtKB:E1C3Z3	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	neuromuscular synaptic transmission		IDA		724727		RGD
Chrm1	Rat	phototransduction, visible light	involved_in	ISO	RGD:14227533	1624291	PMID:12196552	RGD	PMID:12196552
Chrm1	Rat	positive regulation of intracellular protein transport		IDA		7242040		RGD
Chrm1	Rat	positive regulation of monoatomic ion transport	acts_upstream_of_or_within	ISO	RGD:731068	1624291	UniProtKB:Q9JJH7 PMID:14657398	RGD	PMID:14657398
Chrm1	Rat	positive regulation of monoatomic ion transport	acts_upstream_of_or_within	IEA	UniProtKB:P11229\|ensembl:ENSP00000306490	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	postsynaptic modulation of chemical synaptic transmission	involved_in	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	postsynaptic modulation of chemical synaptic transmission	involved_in	ISO	RGD:731069	1624291	PMID:26472558	RGD	PMID:26472558
Chrm1	Rat	regulation of locomotion	acts_upstream_of_or_within	ISO	RGD:731069	1624291	MGI:2158743 PMID:11752469	RGD	PMID:11752469
Chrm1	Rat	regulation of locomotion	involved_in	IEA	InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	regulation of locomotion	acts_upstream_of_or_within	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	regulation of postsynaptic membrane potential	involved_in	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	regulation of postsynaptic membrane potential	involved_in	ISO	RGD:731069	1624291	PMID:26472558	RGD	PMID:26472558
Chrm1	Rat	saliva secretion	involved_in	IEA	InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	asymmetric synapse		IDA		2303389		RGD
Chrm1	Rat	axon terminus		IDA		2303389		RGD
Chrm1	Rat	cholinergic synapse	is_active_in	ISO	RGD:731069	1624291	PMID:20335477	RGD	PMID:20335477
Chrm1	Rat	cholinergic synapse	is_active_in	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	dendrite	is_active_in	IBA	PANTHER:PTN000664111\|RGD:2342\|RGD:2343\|RGD:2518\|RGD:2522\|RGD:2851\|RGD:61800\|RGD:61801\|RGD:620023\|RGD:62044\|RGD:71034	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	dendrite		IDA		2303389		RGD
Chrm1	Rat	glutamatergic synapse	is_active_in	IDA		2303389	PMID:8182478	SynGO
Chrm1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrm1	Rat	membrane	located_in	IEA	InterPro:IPR000276\|InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000037\|FB:FBgn0087012\|MGI:109246\|MGI:109323\|MGI:88396\|MGI:88398\|MGI:96274\|PANTHER:PTN000664111\|RGD:2342\|RGD:2343\|RGD:2344\|RGD:2518\|RGD:2522\|RGD:2845\|RGD:2848\|RGD:2851\|RGD:61800\|RGD:61801\|RGD:620023\|RGD:71034\|UniProtKB:A0A5F7ZKY2\|UniProtKB:O46635\|UniProtKB:P08172\|UniProtKB:P08908\|UniProtKB:P20309\|UniProtKB:P21917\|UniProtKB:P28221\|UniProtKB:P28222\|UniProtKB:P28223\|UniProtKB:P28335\|UniProtKB:P28566\|UniProtKB:P30546\|UniProtKB:P30939\|UniProtKB:P34969\|UniProtKB:P35367\|UniProtKB:P41595\|UniProtKB:P47898\|UniProtKB:P50406\|UniProtKB:Q13639\|WB:WBGene00001517\|WB:WBGene00001519\|WB:WBGene00004776	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	plasma membrane	located_in	IEA	InterPro:IPR000995\|InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Chrm1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrm1	Rat	postsynaptic density membrane	is_active_in	IDA		2303389	PMID:8182478	SynGO
Chrm1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-KW:KW-0628	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrm1	Rat	postsynaptic membrane	is_active_in	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0219	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Chrm1	Rat	postsynaptic membrane	is_active_in	ISO	RGD:731069	1624291	PMID:20335477	RGD	PMID:20335477
Chrm1	Rat	presynaptic membrane	is_active_in	IDA		2303389	PMID:8182478	SynGO
Chrm1	Rat	Schaffer collateral - CA1 synapse	is_active_in	ISO	RGD:731069	1624291	PMID:26472558	RGD	PMID:26472558
Chrm1	Rat	Schaffer collateral - CA1 synapse	is_active_in	IEA	UniProtKB:P12657\|ensembl:ENSMUSP00000126103	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrm1	Rat	synapse	is_active_in	IBA	MGI:88396\|MGI:88397\|PANTHER:PTN001207082\|RGD:2342\|RGD:2343\|RGD:2344\|RGD:620023\|UniProtKB:A0A5F7ZKY2\|WB:WBGene00001517	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	G protein-coupled acetylcholine receptor activity		IDA		724727		RGD
Chrm1	Rat	G protein-coupled acetylcholine receptor activity	enables	IEA	InterPro:IPR000995\|InterPro:IPR002228	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	G protein-coupled acetylcholine receptor activity	enables	IBA	FB:FBgn0000037\|FB:FBgn0037546\|MGI:88397\|MGI:88398\|MGI:88399\|PANTHER:PTN001207082\|RGD:2342\|RGD:2343\|RGD:620023\|RGD:620027\|UniProtKB:P08172\|WB:WBGene00001517\|WB:WBGene00001518\|WB:WBGene00001519\|ZFIN:ZDB-GENE-030314-1\|ZFIN:ZDB-GENE-090410-4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrm1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrm1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrm1	Rat	protein binding	enables	ISO	RGD:731068	1624291	UniProtKB:Q9BVK8 PMID:21056967	RGD	PMID:21056967

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family		ISO	RGD:731068	8549585		RGD
Chrm1	Rat	G protein mediated signaling pathway via Galphaq family		ISO	RGD:731068	8549585		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrm1	Rat	calcium/calcium-mediated signaling pathway		IEA		6907045		KEGG	rno:04020

Disease Annotations Click to see Annotation Detail View

asthma (ISO)

brain ischemia (ISO)

epilepsy (ISO)

intellectual disability (ISO)

Lambert-Eaton myasthenic syndrome (ISO)

leukocyte adhesion deficiency 3 (ISO)

Memory Disorders (ISO)

myasthenia gravis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP,ISO)

(S)-amphetamine (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1-Oleoyl-2-acetyl-sn-glycerol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

1D-myo-inositol 1,4,5-trisphosphate (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-DAMP(1+) (ISO)

5-azacytidine (ISO)

acetylcholine (EXP,ISO)

alpha-D-galactose (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

arsenite(3-) (ISO)

atropine (ISO)

Bardoxolone methyl (ISO)

benzamide (ISO)

benzo[a]pyrene (ISO)

bethanechol (ISO)

bifenthrin (EXP)

biperiden (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

brucine (ISO)

C60 fullerene (EXP)

cadmium dichloride (EXP,ISO)

calcium atom (EXP,ISO)

calcium(0) (EXP,ISO)

canagliflozin (EXP)

carbachol (ISO)

catalpol (ISO)

chlorohydrocarbon (EXP)

chlorpyrifos (EXP)

clozapine (EXP,ISO)

cocaine (ISO)

Cuprizon (EXP)

cycloheximide (ISO)

DDE (ISO)

DDT (ISO)

diazinon (EXP)

dichlorvos (EXP)

dieldrin (EXP)

dimethoate (EXP)

disulfoton (EXP)

flufenamic acid (ISO)

flunarizine (ISO)

furtrethonium (ISO)

gadolinium atom (ISO)

galactose (ISO)

galanthamine (EXP)

galanthamine Trifluoroacetic acid (EXP)

genistein (ISO)

gentamycin (EXP)

glyphosate (EXP)

imidacloprid (EXP)

iron(III) nitrilotriacetate (EXP)

ketamine (ISO)

KT 5720 (ISO)

KT 5823 (ISO)

lanthanum atom (ISO)

methoctramine tetrahydrochloride (ISO)

methscopolamine (EXP,ISO)

misoprostol (EXP)

nickel atom (EXP)

nitric oxide (EXP)

okadaic acid (ISO)

olanzapine (ISO)

oxotremorine M (ISO)

pancuronium (ISO)

paraoxon (ISO)

parathion-methyl (EXP)

PCB138 (ISO)

pentachlorophenol (ISO)

picrotoxin (EXP)

pioglitazone (ISO)

Pipecuronium (ISO)

pirenzepine (EXP,ISO)

pirinixic acid (EXP)

pregnenolone (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (EXP)

propofol (EXP)

quercetin (EXP)

reserpine (EXP)

resveratrol (EXP)

rocuronium (ISO)

scopolamine (EXP,ISO)

sodium arsenite (ISO)

sparteine (EXP)

staurosporine (ISO)

tacrine (EXP,ISO)

taurolithocholic acid sulfate (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

tiotropium bromide (ISO)

trichloroethene (EXP)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO)

U-73122 (ISO)

vecuronium bromide (ISO)

xanomeline (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway (IBA)

chemical synaptic transmission (IBA)

cognition (IEA)

entrainment of circadian clock (ISO)

G protein-coupled acetylcholine receptor signaling pathway (IDA,ISO)

G protein-coupled receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger (IBA)

neuromuscular synaptic transmission (IDA)

phototransduction, visible light (ISO)

positive regulation of intracellular protein transport (IDA)

positive regulation of monoatomic ion transport (IEA,ISO)

postsynaptic modulation of chemical synaptic transmission (IEA,ISO)

regulation of locomotion (IEA,ISO)

regulation of postsynaptic membrane potential (IEA,ISO)

saliva secretion (IEA)

signal transduction (IEA)

Cellular Component

asymmetric synapse (IDA)

axon terminus (IDA)

cholinergic synapse (IEA,ISO)

dendrite (IBA,IDA)

glutamatergic synapse (IDA)

membrane (IEA)

plasma membrane (IBA,IEA)

postsynaptic density membrane (IDA)

postsynaptic membrane (IEA,ISO)

presynaptic membrane (IDA)

Schaffer collateral - CA1 synapse (IEA,ISO)

synapse (IBA,IEA)

Molecular Function

G protein-coupled acetylcholine receptor activity (IBA,IDA,IEA)

G protein-coupled receptor activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family (ISO)

calcium/calcium-mediated signaling pathway (IEA)

G protein mediated signaling pathway via Galphaq family (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Selective cognitive dysfunction in acetylcholine M1 muscarinic receptor mutant mice.	Anagnostaras SG, etal., Nat Neurosci 2003 Jan;6(1):51-8.
2.	Identification of a family of muscarinic acetylcholine receptor genes.	Bonner TI, etal., Science 1987 Jul 31;237(4814):527-32.
3.	Effects of isolation-rearing on serotonin-1A and M1-muscarinic receptor messenger RNA expression in the hipocampal formation of rats.	Del-Bel EA, etal., Neurosci Lett 2002 Oct 31;332(2):123-6.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Distribution of m1-m4 muscarinic receptor proteins in the rat striatum: light and electron microscopic immunocytochemistry using subtype-specific antibodies.	Hersch SM, etal., J Neurosci. 1994 May;14(5 Pt 2):3351-63.
7.	Localization of the rat M1 muscarinic receptor gene to chromosome 1q43-51.	Klett CP, etal., Mamm Genome 1998 Jun;9(6):476-8.
8.	Polymorphisms in the muscarinic receptor 1 gene confer susceptibility to asthma in Japanese subjects.	Maeda Y, etal., Am J Respir Crit Care Med. 2006 Nov 15;174(10):1119-24. Epub 2006 Aug 24.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Modulation of ACh release by presynaptic muscarinic autoreceptors in the neuromuscular junction of the newborn and adult rat.	Santafe MM, etal., Eur J Neurosci 2003 Jan;17(1):119-27.
15.	Autoantibodies against M1 muscarinic acetylcholine receptor in myasthenic disorders.	Takamori M, etal., Eur J Neurol. 2007 Nov;14(11):1230-5. Epub 2007 Aug 31.
16.	Muscarinic signaling in the brain.	Thiele A Annu Rev Neurosci. 2013 Jul 8;36:271-94. doi: 10.1146/annurev-neuro-062012-170433.
17.	Radiation hybrid mapping of five muscarinic acetylcholine receptor subtype genes in Rattus norvegicus.	Tseng J, etal., Hear Res 2002 Dec;174(1-2):86-92.
18.	The regulation of M1 muscarinic acetylcholine receptor desensitization by synaptic activity in cultured hippocampal neurons.	Willets JM, etal., J Neurochem. 2007 Dec;103(6):2268-80. Epub 2007 Oct 1.
19.	The M3-muscarinic cholinoceptor subtype in rat prostate and its down regulation by aging.	Yazawa H and Honda K, Jpn J Pharmacol. 1993 Apr;61(4):319-24.

Additional References at PubMed

PMID:1317867	PMID:1759615	PMID:2380182	PMID:10333492	PMID:11752469	PMID:12196552	PMID:14657398	PMID:14675151	PMID:15342646	PMID:15350825	PMID:15474371	PMID:15743771
PMID:15994335	PMID:16093396	PMID:16160857	PMID:16541262	PMID:16647280	PMID:16758365	PMID:16820015	PMID:17561934	PMID:17709264	PMID:17719699	PMID:17823120	PMID:17960828
PMID:18247369	PMID:18443764	PMID:18454168	PMID:18480291	PMID:18842902	PMID:18938154	PMID:18991861	PMID:19124535	PMID:19160866	PMID:19309359	PMID:19328480	PMID:19344500
PMID:19416629	PMID:19427366	PMID:19534762	PMID:19554469	PMID:19558456	PMID:19666081	PMID:19730136	PMID:19765405	PMID:19883739	PMID:20335477	PMID:20433901	PMID:20600670
PMID:21054404	PMID:21126518	PMID:21247934	PMID:21913336	PMID:22088219	PMID:22513211	PMID:22803069	PMID:22871113	PMID:23085025	PMID:23184186	PMID:23559406	PMID:23678982
PMID:23988164	PMID:24288746	PMID:24480931	PMID:25008070	PMID:25417050	PMID:25474381	PMID:26472558	PMID:26626425	PMID:27569857	PMID:29030298	PMID:29705702	PMID:31721013
PMID:32798726

Genomics

Comparative Map Data

Chrm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	214,996,180 - 215,012,136 (+)	NCBI		GRCr8
mRatBN7.2	1	205,567,226 - 205,583,001 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	205,567,220 - 205,582,356 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	213,986,616 - 213,987,998 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	221,024,093 - 221,025,475 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	213,716,796 - 213,718,178 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	224,869,087 - 224,885,101 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	224,882,439 - 224,884,205 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	231,806,335 - 231,822,359 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	211,351,738 - 211,353,120 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	211,510,167 - 211,511,550 (+)	NCBI
Celera	1	203,093,639 - 203,095,021 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

CHRM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	62,908,679 - 62,921,878 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	62,908,679 - 62,921,807 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	62,676,151 - 62,688,835 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	62,432,727 - 62,445,588 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	62,432,727 - 62,445,588	NCBI
Celera	11	59,999,724 - 60,012,585 (-)	NCBI		Celera
Cytogenetic Map	11	q12.3	NCBI
HuRef	11	59,005,193 - 59,018,054 (-)	NCBI		HuRef
CHM1_1	11	62,559,164 - 62,572,025 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	62,898,039 - 62,911,241 (-)	NCBI		T2T-CHM13v2.0

Chrm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	8,641,369 - 8,660,970 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	8,641,153 - 8,660,951 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	8,664,005 - 8,683,606 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	8,663,789 - 8,683,587 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	8,738,495 - 8,758,096 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	8,723,372 - 8,748,612 (+)	NCBI		MGSCv36	mm8
Celera	19	8,422,264 - 8,441,868 (+)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	5.44	NCBI

Chrm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955599	349,744 - 356,714 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955599	349,744 - 356,714 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHRM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	64,131,197 - 64,143,870 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	65,176,365 - 65,189,038 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	58,261,476 - 58,274,685 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	61,612,934 - 61,626,767 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	61,614,818 - 61,616,200 (-)	Ensembl	panpan1.1		panPan2

CHRM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	53,783,938 - 53,797,750 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	53,795,326 - 53,796,708 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	52,389,834 - 52,403,632 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	54,835,906 - 54,849,703 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	54,833,743 - 54,849,697 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	53,933,197 - 53,947,176 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	53,507,453 - 53,521,228 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	54,299,342 - 54,313,140 (+)	NCBI		UU_Cfam_GSD_1.0

Chrm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	10,273,646 - 10,286,998 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	387,705 - 400,740 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	387,939 - 400,740 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHRM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	8,858,765 - 8,872,042 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	8,210,975 - 8,225,464 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHRM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	10,978,464 - 10,991,650 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	10,989,207 - 10,990,589 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	108,331,823 - 108,345,191 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chrm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624926	1,326,866 - 1,330,805 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624926	1,326,851 - 1,335,477 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Chrm1
50 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	48
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000024785
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Markers in Region

D1Bda47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	205,581,930 - 205,582,189 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	224,884,031 - 224,884,289	NCBI	Rnor6.0
Rnor_5.0	1	231,821,289 - 231,821,547	UniSTS	Rnor5.0
RGSC_v3.4	1	211,353,141 - 211,353,399	UniSTS	RGSC3.4
Celera	1	203,095,042 - 203,095,300	UniSTS
Cytogenetic Map	1	q43-q51	UniSTS

PMC65026P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	205,580,550 - 205,581,183 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	224,882,651 - 224,883,283	NCBI	Rnor6.0
Rnor_5.0	1	231,819,909 - 231,820,541	UniSTS	Rnor5.0
RGSC_v3.4	1	211,351,761 - 211,352,393	UniSTS	RGSC3.4
Celera	1	203,093,662 - 203,094,294	UniSTS
Cytogenetic Map	1	q43-q51	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	5	9	103	51	50	24	12	24	6	115	41	83	36	48	26

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ006522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M16406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S73971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024785 ⟹ ENSRNOP00000024785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	205,567,220 - 205,582,356 (+)	Ensembl
Rnor_6.0 Ensembl	1	224,882,439 - 224,884,205 (+)	Ensembl

RefSeq Acc Id:

NM_080773 ⟹ NP_542951

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	214,996,359 - 215,012,136 (+)	NCBI
mRatBN7.2	1	205,567,226 - 205,583,001 (+)	NCBI
Rnor_6.0	1	224,882,628 - 224,884,010 (+)	NCBI
Rnor_5.0	1	231,806,335 - 231,822,359 (+)	NCBI
RGSC_v3.4	1	211,351,738 - 211,353,120 (+)	RGD
Celera	1	203,093,639 - 203,095,021 (+)	RGD

Sequence:

show sequence

ATGAACACCTCAGTGCCCCCTGCTGTCAGTCCCAACATCACTGTCTTGGCACCAGGAAAGGGTC
CCTGGCAGGTGGCCTTCATCGGGATCACCACAGGCCTCCTGTCTCTAGCTACAGTGACAGGCAA
CCTACTGGTACTCATCTCCTTCAAGGTCAACACCGAGCTCAAGACAGTCAACAACTACTTCCTG
CTGAGCCTGGCCTGTGCTGACCTCATCATTGGCACCTTCTCCATGAACCTCTATACCACGTACC
TGCTCATGGGCCACTGGGCTCTGGGCACACTGGCCTGTGACCTCTGGCTGGCCCTGGACTATGT
GGCCAGCAACGCCTCTGTCATGAATCTTCTGCTCATCAGCTTTGACCGTTACTTCTCGGTGACC
CGACCCCTGAGCTACCGAGCCAAGCGCACTCCCCGAAGGGCAGCTCTGATGATTGGCCTAGCAT
GGCTGGTTTCCTTCGTTCTCTGGGCCCCAGCCATCCTCTTCTGGCAATACCTAGTTGGGGAGCG
GACAGTGCTGGCTGGGCAGTGCTACATCCAGTTCCTCTCCCAACCCATCATCACTTTTGGCACA
GCCATGGCCGCCTTCTACCTCCCTGTCACGGTCATGTGTACACTGTACTGGCGCATCTACCGGG
AGACAGAAAACCGAGCCCGGGAGCTGGCCGCCCTGCAGGGCTCTGAGACACCAGGCAAAGGTGG
TGGCAGCAGCAGCAGCTCAGAGAGGTCACAGCCAGGGGCTGAAGGCTCACCCGAGTCGCCTCCA
GGCCGCTGCTGCCGCTGTTGCCGGGCACCCAGGCTCCTGCAGGCCTACAGCTGGAAGGAAGAAG
AAGAGGAGGATGAAGGCTCCATGGAGTCCCTCACATCCTCCGAAGGTGAGGAGCCTGGCTCAGA
AGTGGTGATCAAGATGCCCATGGTAGATTCTGAAGCACAGGCACCCACCAAGCAGCCTCCCAAA
AGCTCCCCAAATACAGTCAAGAGGCCCACCAAGAAAGGCCGAGACCGAGGCGGCAAGGGCCAAA
AACCCCGAGGGAAGGAACAGCTGGCCAAGAGAAAGACCTTCTCACTGGTCAAGGAGAAGAAGGC
AGCTCGGACCCTGAGTGCCATCCTGCTGGCCTTCATCCTCACCTGGACACCATATAACATCATG
GTGCTGGTATCTACCTTCTGCAAGGACTGTGTTCCTGAAACCCTGTGGGAGCTGGGCTACTGGC
TATGCTACGTCAACAGCACTGTCAACCCCATGTGCTATGCACTGTGCAACAAAGCCTTCCGGGA
CACGTTCCGCCTGCTGCTGCTCTGCCGCTGGGACAAGAGGCGCTGGCGCAAGATCCCCAAGCGC
CCTGGCTCTGTGCACCGCACCCCCTCCCGCCAATGCTAA

hide sequence

RefSeq Acc Id:

XM_063281373 ⟹ XP_063137443

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	214,996,180 - 215,012,136 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_542951	(Get FASTA)	NCBI Sequence Viewer
	XP_063137443	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40660	(Get FASTA)	NCBI Sequence Viewer
	AAB20705	(Get FASTA)	NCBI Sequence Viewer
	CAA07083	(Get FASTA)	NCBI Sequence Viewer
	EDM12699	(Get FASTA)	NCBI Sequence Viewer
	EDM12700	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024785.2
	ENSRNOP00000111546
	ENSRNOP00000112621
GenBank Protein	P08482	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_542951 ⟸ NM_080773

- UniProtKB:

P08482 (UniProtKB/Swiss-Prot), A6HZR8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFL
LSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVT
RPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGT
AMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPESPP
GRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDSEAQAPTKQPPK
SSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIM
VLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKR
PGSVHRTPSRQC

hide sequence

Ensembl Acc Id:

ENSRNOP00000024785 ⟸ ENSRNOT00000024785

RefSeq Acc Id:	XP_063137443 ⟸ XM_063281373
- Peptide Label:	isoform X1
- UniProtKB:	P08482 (UniProtKB/Swiss-Prot), A6HZR8 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P08482-F1-model_v2	AlphaFold	P08482	1-460	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2342	AgrOrtholog
BioCyc Gene	G2FUF-56523	BioCyc
Ensembl Genes	ENSRNOG00000018385	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000074156	ENTREZGENE
Ensembl Transcript	ENSRNOT00000024785.5	UniProtKB/Swiss-Prot
	ENSRNOT00000136918	ENTREZGENE
	ENSRNOT00000171642	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Musac_Ach_M1_rcpt	UniProtKB/Swiss-Prot
	Musac_Ach_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:25229	UniProtKB/Swiss-Prot
NCBI Gene	25229	ENTREZGENE
PANTHER	5-HYDROXYTRYPTAMINE RECEPTOR	UniProtKB/Swiss-Prot
	MUSCARINIC ACETYLCHOLINE RECEPTOR M1	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	CHRM1	RGD
PhenoGen	Chrm1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	MUSCARINICR	UniProtKB/Swiss-Prot
	MUSCRINICM1R	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018385	RatGTEx
	ENSRNOG00000074156	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6HZR8	ENTREZGENE, UniProtKB/TrEMBL
	ACM1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-11-06	Chrm1	cholinergic receptor, muscarinic 1		Cholinergic receptor, muscarin 1	Name updated	625702	APPROVED
2002-06-10	Chrm1	Cholinergic receptor, muscarin 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	spontaneously hypertensive rat (SHR) demonstrates increased expression in most brain stem areas so may be critical for blood pressure regulation	625683
gene_expression	expressed in brain	625683
gene_mutations_overexpression	no differences found in coding sequence between spontaneously hypertensive SHR and WKY strains	1358988
gene_pathway	mediates the regulation of suprachiasmatic circadian clock via guanylyl cyclase, cGMP-dependent protein kinase pathway	734537
gene_process	plays a role in stress-adaptive cardiovascular reflexes	625683
gene_process	regulates the circadian clock in the hypothalamic suprachiasmatic nucleus by mediating hte cholinergic signals	734538
gene_transcript	contains 1 single exon	625683

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)