Symbol:
Apoa2
Name:
apolipoprotein A2
RGD ID:
2131
Description:
Enables cholesterol transfer activity. Involved in several processes, including animal organ regeneration; response to estrogen; and response to glucocorticoid. Predicted to be part of chylomicron; spherical high-density lipoprotein particle; and very-low-density lipoprotein particle. Predicted to be active in extracellular space. Biomarker of hyperthyroidism. Orthologous to human APOA2 (apolipoprotein A2); PARTICIPATES IN lipoprotein metabolic pathway; eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH (+)-schisandrin B; 1-nitropropane; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Apo-AII; ApoA-II; APOAII; apolipoprotein A-II
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Is Marker For:
Strains:
F344.ACI-Lmx1aqc /Kyo QTLs:
GLUCO223_H
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 86,176,767 - 86,178,819 (+) NCBI GRCr8 mRatBN7.2 13 83,644,460 - 83,646,358 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 83,644,470 - 83,646,355 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 86,150,563 - 86,152,200 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 87,548,803 - 87,550,440 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 84,780,423 - 84,782,059 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 89,596,872 - 89,598,805 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 89,597,138 - 89,598,802 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 94,223,741 - 94,225,670 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 87,114,734 - 87,116,372 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 87,303,617 - 87,305,256 (+) NCBI Celera 13 83,275,901 - 83,277,538 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Apoa2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of APOA2 mRNA] CTD PMID:31150632 Apoa2 Rat (-)-ephedrine multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Ephedrine co-treated with Caffeine] results in decreased expression of APOA2 protein CTD PMID:16324916 Apoa2 Rat 1,1-dichloroethene decreases expression ISO Apoa2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of APOA2 mRNA CTD PMID:26682919 Apoa2 Rat 1-nitropropane increases expression EXP 6480464 1-nitropropane results in increased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Plant Preparations] results in decreased expression of APOA2 mRNA CTD PMID:26945725 Apoa2 Rat 17beta-estradiol decreases expression ISO Apoa2 (Mus musculus) 6480464 Estradiol results in decreased expression of APOA2 mRNA CTD PMID:39298647 Apoa2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of APOA2 mRNA CTD PMID:32145629 Apoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of APOA2 mRNA CTD PMID:21215274 Apoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of APOA2 mRNA CTD PMID:33387578 Apoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Apoa2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to APOA2 gene] CTD PMID:28213091 Apoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Apoa2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of APOA2 mRNA CTD PMID:28213091 Apoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Apoa2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of APOA2 mRNA CTD PMID:21570461 Apoa2 Rat 2,4-diaminotoluene decreases expression EXP 6480464 2 and 4-diaminotoluene results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Apoa2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Apoa2 Rat 2,6-di-tert-butyl-4-methylphenol multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Butylated Hydroxytoluene co-treated with Pentetic Acid] inhibits the reaction [2 more ... CTD PMID:12576517 Apoa2 Rat 2,6-diaminotoluene decreases expression EXP 6480464 2 and 6-diaminotoluene results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 2-nitro-p-phenylenediamine decreases expression EXP 6480464 2-nitro-4-phenylenediamine results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 2-nitropropane decreases expression EXP 6480464 2-nitropropane results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of APOA2 protein CTD PMID:7442475 Apoa2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Apoa2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of APOA2 mRNA CTD PMID:20188158 Apoa2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of APOA2 protein CTD PMID:34915118 Apoa2 Rat 4,4'-sulfonyldiphenol increases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol S results in increased expression of APOA2 mRNA CTD PMID:30951980 Apoa2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol S results in decreased expression of APOA2 mRNA CTD PMID:39298647 Apoa2 Rat 4-acetylaminofluorene decreases expression EXP 6480464 4-acetylaminofluorene results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 4-nitro-1,2-phenylenediamine decreases expression EXP 6480464 1 and 2-diamino-4-nitrobenzene results in decreased expression of APOA2 mRNA CTD PMID:17070881 Apoa2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of APOA2 mRNA CTD PMID:22504374 Apoa2 Rat 9-cis-retinoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 Alitretinoin results in increased expression of APOA2 mRNA CTD PMID:8668150 Apoa2 Rat 9-cis-retinoic acid multiple interactions ISO APOA2 (Homo sapiens) 6480464 RXRA promotes the reaction [Alitretinoin results in increased expression of APOA2 mRNA] CTD PMID:8668150 Apoa2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of APOA2 mRNA CTD PMID:31881176 Apoa2 Rat aflatoxin B1 affects expression ISO APOA2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of APOA2 protein CTD PMID:20106945 Apoa2 Rat aflatoxin B1 decreases methylation ISO APOA2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of APOA2 gene CTD PMID:27153756 Apoa2 Rat aflatoxin B1 decreases expression ISO Apoa2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of APOA2 mRNA CTD PMID:19770486 Apoa2 Rat all-trans-retinoic acid affects expression ISO APOA2 (Homo sapiens) 6480464 Tretinoin affects the expression of APOA2 mRNA CTD PMID:31600526 Apoa2 Rat all-trans-retinoic acid increases secretion ISO APOA2 (Homo sapiens) 6480464 Tretinoin results in increased secretion of APOA2 protein CTD PMID:8668150 Apoa2 Rat all-trans-retinoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 Tretinoin results in increased expression of APOA2 mRNA CTD PMID:8668150 Apoa2 Rat all-trans-retinoic acid multiple interactions ISO APOA2 (Homo sapiens) 6480464 RXRA promotes the reaction [Tretinoin results in increased expression of APOA2 mRNA] CTD PMID:8668150 Apoa2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of APOA2 mRNA CTD PMID:16483693 Apoa2 Rat arsenite(3-) increases expression ISO Apoa2 (Mus musculus) 6480464 arsenite results in increased expression of APOA2 protein CTD PMID:37955338 Apoa2 Rat atenolol decreases expression ISO APOA2 (Homo sapiens) 6480464 Atenolol results in decreased expression of APOA2 protein CTD PMID:2193493 Apoa2 Rat benzalkonium chloride decreases expression ISO Apoa2 (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of APOA2 mRNA CTD PMID:31199489 Apoa2 Rat benzo[a]pyrene affects methylation ISO APOA2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of APOA2 promoter CTD PMID:27901495 Apoa2 Rat benzo[a]pyrene decreases expression ISO APOA2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of APOA2 mRNA CTD PMID:32234424 Apoa2 Rat bexarotene multiple interactions ISO APOA2 (Homo sapiens) 6480464 RXRA promotes the reaction [bexarotene results in increased expression of APOA2 mRNA] CTD PMID:8668150 Apoa2 Rat bexarotene increases expression ISO APOA2 (Homo sapiens) 6480464 bexarotene results in increased expression of APOA2 mRNA CTD PMID:8668150 Apoa2 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of APOA2 mRNA CTD PMID:16648578 Apoa2 Rat bezafibrate increases expression ISO APOA2 (Homo sapiens) 6480464 Bezafibrate results in increased expression of APOA2 protein CTD PMID:7893284 and PMID:8017468 Apoa2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of APOA2 mRNA CTD PMID:25181051 and PMID:32145629 Apoa2 Rat bisphenol A multiple interactions ISO Apoa2 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of APOA2 protein CTD PMID:35999755 Apoa2 Rat bisphenol A decreases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol A results in decreased expression of APOA2 mRNA CTD PMID:33221593 Apoa2 Rat bisphenol A increases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol A results in increased expression of APOA2 mRNA CTD PMID:30245210 and PMID:34585602 Apoa2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of APOA2 mRNA CTD PMID:30903817 Apoa2 Rat bisphenol A affects expression ISO APOA2 (Homo sapiens) 6480464 bisphenol A affects the expression of APOA2 mRNA CTD PMID:30903817 Apoa2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of APOA2 gene CTD PMID:28505145 Apoa2 Rat bisphenol F increases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol F results in increased expression of APOA2 mRNA CTD PMID:30951980 Apoa2 Rat bisphenol F decreases expression ISO Apoa2 (Mus musculus) 6480464 bisphenol F results in decreased expression of APOA2 mRNA CTD PMID:38685157 Apoa2 Rat buta-1,3-diene decreases expression ISO Apoa2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of APOA2 mRNA CTD PMID:29038090 Apoa2 Rat cadmium atom affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Cadmium CTD PMID:23896426 Apoa2 Rat cadmium atom multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of APOA2 mRNA CTD PMID:36602393 Apoa2 Rat cadmium dichloride multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of APOA2 mRNA CTD PMID:36602393 Apoa2 Rat caffeine multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Ephedrine co-treated with Caffeine] results in decreased expression of APOA2 protein CTD PMID:16324916 Apoa2 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of APOA2 mRNA CTD PMID:25868845 Apoa2 Rat calcium silicate increases expression ISO Apoa2 (Mus musculus) 6480464 calcium silicate results in increased expression of APOA2 mRNA CTD PMID:29279043 Apoa2 Rat carbon nanotube increases expression ISO Apoa2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of APOA2 CTD PMID:21654424 Apoa2 Rat carbon nanotube decreases expression ISO Apoa2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of APOA2 mRNA CTD PMID:25554681 Apoa2 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of APOA2 mRNA CTD PMID:30744511 Apoa2 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of APOA2 mRNA CTD PMID:17602206 Apoa2 Rat Clofop decreases expression EXP 6480464 fenofibric acid results in decreased expression of APOA2 mRNA CTD PMID:7556148 Apoa2 Rat clonidine decreases expression ISO APOA2 (Homo sapiens) 6480464 Clonidine results in decreased expression of APOA2 protein CTD PMID:2193493 Apoa2 Rat clonidine (amino form) decreases expression ISO APOA2 (Homo sapiens) 6480464 Clonidine results in decreased expression of APOA2 protein CTD PMID:2193493 Apoa2 Rat clonidine (imino form) decreases expression ISO APOA2 (Homo sapiens) 6480464 Clonidine results in decreased expression of APOA2 protein CTD PMID:2193493 Apoa2 Rat copper atom affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Copper CTD PMID:23896426 Apoa2 Rat copper(0) affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Copper CTD PMID:23896426 Apoa2 Rat copper(II) sulfate decreases expression ISO APOA2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of APOA2 mRNA CTD PMID:19549813 Apoa2 Rat cyclosporin A decreases expression ISO APOA2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of APOA2 mRNA CTD PMID:20106945 Apoa2 Rat cyproterone acetate affects expression ISO APOA2 (Homo sapiens) 6480464 Cyproterone Acetate affects the expression of APOA2 protein CTD PMID:16323982 Apoa2 Rat dextran sulfate multiple interactions ISO Apoa2 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of APOA2 protein CTD PMID:35999755 Apoa2 Rat diquat increases expression ISO Apoa2 (Mus musculus) 6480464 Diquat results in increased expression of APOA2 protein CTD PMID:36851058 Apoa2 Rat dorsomorphin multiple interactions ISO APOA2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Apoa2 Rat fenofibrate multiple interactions ISO Apoa2 (Mus musculus) 6480464 APOA2 protein alternative form affects the reaction [Fenofibrate results in increased expression of ANKRD1 protein] CTD PMID:39442682 Apoa2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of APOA2 mRNA CTD PMID:24136188 Apoa2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of APOA2 mRNA CTD PMID:24793618 Apoa2 Rat folic acid multiple interactions ISO Apoa2 (Mus musculus) 6480464 [APOE gene mutant form affects the susceptibility to Folic Acid] which results in increased expression of APOA2 protein CTD PMID:17118406 Apoa2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of APOA2 mRNA CTD PMID:15120968 Apoa2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of APOA2 gene CTD PMID:22079235 Apoa2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of APOA2 mRNA CTD PMID:24136188 Apoa2 Rat glyphosate decreases expression ISO Apoa2 (Mus musculus) 6480464 Glyphosate results in decreased expression of APOA2 protein CTD PMID:36173347 Apoa2 Rat graphene oxide increases expression ISO Apoa2 (Mus musculus) 6480464 graphene oxide analog results in increased expression of APOA2 mRNA CTD PMID:33227293 Apoa2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of APOA2 mRNA CTD PMID:29933104 Apoa2 Rat hydrazine decreases expression EXP 6480464 hydrazine results in decreased expression of APOA2 mRNA CTD PMID:15370871 Apoa2 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of APOA2 mRNA CTD PMID:36868495 Apoa2 Rat isoprenaline increases expression ISO Apoa2 (Mus musculus) 6480464 Isoproterenol results in increased expression of APOA2 mRNA CTD PMID:21335049 Apoa2 Rat lead(0) affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Lead CTD PMID:23896426 Apoa2 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of APOA2 mRNA CTD PMID:28801915 Apoa2 Rat mercury atom affects expression ISO APOA2 (Homo sapiens) 6480464 Mercury affects the expression of APOA2 protein CTD PMID:22030286 Apoa2 Rat mercury dibromide increases expression ISO APOA2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of APOA2 mRNA CTD PMID:26272509 Apoa2 Rat mercury dibromide multiple interactions ISO APOA2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APOA2 mRNA CTD PMID:27188386 Apoa2 Rat mercury(0) affects expression ISO APOA2 (Homo sapiens) 6480464 Mercury affects the expression of APOA2 protein CTD PMID:22030286 Apoa2 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of APOA2 mRNA CTD PMID:32035215 Apoa2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of APOA2 mRNA CTD PMID:30467583 Apoa2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of APOA2 mRNA CTD PMID:22504374 Apoa2 Rat methylmercury chloride decreases expression ISO APOA2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of APOA2 mRNA CTD PMID:23179753 and PMID:27188386 Apoa2 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of APOA2 mRNA CTD PMID:30744511 Apoa2 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of APOA2 mRNA CTD PMID:28801915 Apoa2 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of APOA2 mRNA CTD PMID:19638242 Apoa2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of APOA2 mRNA CTD PMID:28943392 Apoa2 Rat nickel atom affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Nickel CTD PMID:23896426 Apoa2 Rat nifedipine increases expression ISO APOA2 (Homo sapiens) 6480464 Nifedipine results in increased expression of APOA2 CTD PMID:1928808 Apoa2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of APOA2 mRNA CTD PMID:33484710 Apoa2 Rat obeticholic acid increases expression ISO APOA2 (Homo sapiens) 6480464 obeticholic acid results in increased expression of APOA2 mRNA CTD PMID:27939613 Apoa2 Rat p-chloromercuribenzoic acid multiple interactions ISO APOA2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APOA2 mRNA CTD PMID:27188386 Apoa2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of APOA2 mRNA CTD PMID:15120968 Apoa2 Rat paracetamol decreases expression ISO APOA2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of APOA2 mRNA CTD PMID:29067470 Apoa2 Rat paracetamol increases expression ISO Apoa2 (Mus musculus) 6480464 Acetaminophen results in increased expression of APOA2 mRNA CTD PMID:23358195 Apoa2 Rat pentetic acid multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Butylated Hydroxytoluene co-treated with Pentetic Acid] inhibits the reaction [2 more ... CTD PMID:12576517 Apoa2 Rat perflubutane affects expression ISO APOA2 (Homo sapiens) 6480464 perfluorobutane affects the expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorodecanoic acid affects expression ISO APOA2 (Homo sapiens) 6480464 perfluorodecanoic acid affects the expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorododecanoic acid affects expression ISO APOA2 (Homo sapiens) 6480464 perfluorododecanoic acid affects the expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluoroheptanoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 perfluoro-n-heptanoic acid results in increased expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorohexanesulfonic acid affects expression ISO APOA2 (Homo sapiens) 6480464 perfluorohexanesulfonic acid affects the expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorohexanoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 perfluorohexanoic acid results in increased expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorononanoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of APOA2 mRNA CTD PMID:18692542 Apoa2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO APOA2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of APOA2 mRNA CTD PMID:32588087 Apoa2 Rat perfluorooctane-1-sulfonic acid increases expression ISO APOA2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat perfluorooctanoic acid increases expression ISO APOA2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of APOA2 mRNA CTD PMID:23567314 and PMID:37302725 Apoa2 Rat perfluorooctanoic acid increases expression ISO Apoa2 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of APOA2 protein CTD PMID:37422089 Apoa2 Rat perfluorooctanoic acid decreases expression ISO APOA2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of APOA2 protein CTD PMID:26879310 Apoa2 Rat perfluoroundecanoic acid affects expression ISO APOA2 (Homo sapiens) 6480464 perfluoroundecanoic acid affects the expression of APOA2 mRNA CTD PMID:23567314 Apoa2 Rat phenylmercury acetate increases expression ISO APOA2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of APOA2 mRNA CTD PMID:26272509 Apoa2 Rat phenylmercury acetate multiple interactions ISO APOA2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APOA2 mRNA CTD PMID:27188386 Apoa2 Rat pirinixic acid multiple interactions ISO APOA2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of APOA2 mRNA CTD PMID:19710929 Apoa2 Rat pirinixic acid decreases expression ISO Apoa2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of APOA2 mRNA CTD PMID:38810120 Apoa2 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of APOA2 mRNA CTD PMID:19162173 Apoa2 Rat pirinixic acid increases expression ISO Apoa2 (Mus musculus) 6480464 pirinixic acid results in increased expression of APOA2 mRNA CTD PMID:17426115 Apoa2 Rat potassium dichromate affects expression ISO Apoa2 (Mus musculus) 6480464 Potassium Dichromate affects the expression of APOA2 mRNA CTD PMID:23608068 Apoa2 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Apoa2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of APOA2 mRNA CTD PMID:38810120 Apoa2 Rat resveratrol multiple interactions ISO APOA2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of APOA2 mRNA CTD PMID:23557933 Apoa2 Rat SB 431542 multiple interactions ISO APOA2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Apoa2 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of APOA2 mRNA CTD PMID:25055962 Apoa2 Rat sodium arsenite affects expression ISO Apoa2 (Mus musculus) 6480464 sodium arsenite affects the expression of APOA2 mRNA CTD PMID:17450228 Apoa2 Rat sodium arsenite decreases expression ISO Apoa2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of APOA2 mRNA CTD PMID:37682722 Apoa2 Rat sodium arsenite decreases expression ISO APOA2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of APOA2 mRNA CTD PMID:29301061 Apoa2 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of APOA2 mRNA CTD PMID:21515302 Apoa2 Rat tetrachloromethane increases expression ISO APOA2 (Homo sapiens) 6480464 Carbon Tetrachloride results in increased expression of APOA2 mRNA CTD PMID:11566570 Apoa2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of APOA2 mRNA CTD PMID:31150632 Apoa2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of APOA2 mRNA] CTD PMID:31150632 Apoa2 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of APOA2 mRNA CTD PMID:28943392 Apoa2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of APOA2 mRNA CTD PMID:34492290 Apoa2 Rat titanium dioxide affects expression ISO Apoa2 (Mus musculus) 6480464 titanium dioxide affects the expression of APOA2 mRNA CTD PMID:23557971 Apoa2 Rat tremolite asbestos increases expression ISO Apoa2 (Mus musculus) 6480464 tremolite results in increased expression of APOA2 mRNA CTD PMID:29279043 Apoa2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of APOA2 mRNA CTD PMID:33387578 Apoa2 Rat tris(2-butoxyethyl) phosphate affects expression ISO APOA2 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of APOA2 mRNA CTD PMID:29024780 Apoa2 Rat troglitazone increases expression ISO APOA2 (Homo sapiens) 6480464 troglitazone results in increased expression of APOA2 mRNA CTD PMID:25572481 Apoa2 Rat valproic acid decreases expression ISO APOA2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of APOA2 mRNA CTD PMID:23179753 more ... Apoa2 Rat valproic acid increases expression ISO APOA2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of APOA2 mRNA CTD PMID:28001369 Apoa2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of APOA2 mRNA CTD PMID:23034163 Apoa2 Rat zinc atom affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Zinc CTD PMID:23896426 Apoa2 Rat zinc(0) affects binding ISO APOA2 (Homo sapiens) 6480464 APOA2 protein binds to Zinc CTD PMID:23896426
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-ephedrine (ISO) 1,1-dichloroethene (ISO) 1-nitropropane (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 2,6-diaminotoluene (EXP) 2-acetamidofluorene (EXP) 2-nitro-p-phenylenediamine (EXP) 2-nitropropane (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-acetylaminofluorene (EXP) 4-nitro-1,2-phenylenediamine (EXP) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) atenolol (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) bexarotene (EXP,ISO) bezafibrate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (EXP,ISO) calcium silicate (ISO) carbon nanotube (ISO) chlorohydrocarbon (EXP) clofibric acid (EXP) Clofop (EXP) clonidine (ISO) clonidine (amino form) (ISO) clonidine (imino form) (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cyproterone acetate (ISO) dextran sulfate (ISO) diquat (ISO) dorsomorphin (ISO) fenofibrate (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) glafenine (EXP) glyphosate (ISO) graphene oxide (ISO) graphite (EXP) hydrazine (EXP) indometacin (EXP) isoprenaline (ISO) lead(0) (ISO) manganese(II) chloride (EXP) mercury atom (ISO) mercury dibromide (ISO) mercury(0) (ISO) methamphetamine (EXP) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) nifedipine (ISO) nitrofen (EXP) obeticholic acid (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) pentetic acid (ISO) perflubutane (ISO) perfluorodecanoic acid (ISO) perfluorododecanoic acid (ISO) perfluoroheptanoic acid (ISO) perfluorohexanesulfonic acid (ISO) perfluorohexanoic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) perfluoroundecanoic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) resveratrol (ISO) SB 431542 (ISO) simvastatin (EXP) sodium arsenite (ISO) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) tremolite asbestos (ISO) trichloroethene (EXP) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Biochemical and genetic association of plasma apolipoprotein A-II levels with familial combined hyperlipidemia.
Allayee H, etal., Circ Res 2003 Jun 13;92(11):1262-7. Epub 2003 May 8.
2.
The compositional abnormalities of lipoproteins in diabetic renal failure.
Attman PO, etal., Nephrol Dial Transplant. 1998 Nov;13(11):2833-41.
3.
Apolipoprotein A-II is inversely associated with risk of future coronary artery disease.
Birjmohun RS, etal., Circulation. 2007 Oct 30;116(18):2029-35. Epub 2007 Oct 8.
4.
Studies with apolipoprotein A-II transgenic mice indicate a role for HDLs in adiposity and insulin resistance.
Castellani LW, etal., Diabetes. 2001 Mar;50(3):643-51.
5.
Quantification of apolipoprotein AI-containing lipoprotein particles in non-insulin-dependent diabetes mellitus.
Contiero E, etal., Diabetes Res Clin Pract. 1998 Mar;39(3):201-9.
6.
SINGLE NUCLEOTIDE POLYMORPHISMS THAT INFLUENCE LIPID METABOLISM: Interaction with Dietary Factors.
Corella D and Ordovas JM, Annu Rev Nutr. 2005;25:341-90.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Association between apolipoprotein A2 MspI polymorphism and hypertriglyceridemia in Koreans.
Hong SH, etal., Hum Biol. 1998 Feb;70(1):41-6.
10.
Structure and evolution of the apolipoprotein multigene family.
Luo CC, etal., J Mol Biol 1986 Feb 5;187(3):325-40.
11.
Cellular cholesterol efflux. Role of cell membrane kinetic pools and interaction with apolipoproteins AI, AII, and Cs.
Mahlberg FH and Rothblat GH, J Biol Chem. 1992 Mar 5;267(7):4541-50.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Amino acid sequence of rat apolipoprotein A-II deduced from the nucleotide sequence of cloned cDNA.
Nagashima M, etal., J Lipid Res 1986 Jul;27(7):706-12.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Predominance of large low density lipoprotein particles and lower fractional esterification rate of cholesterol in high density lipoprotein in children with insulin-dependent diabetes mellitus.
Ohta T, etal., Eur J Pediatr. 1998 Apr;157(4):276-81.
16.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
17.
Impaired anti-inflammatory function of apolipoprotein A-II concentrations predicts metabolic syndrome and diabetes at 4 years follow-up in elderly Turks.
Onat A, etal., Clin Chem Lab Med. 2009 Oct 12.
18.
Transcriptional and posttranscriptional regulation of apolipoprotein E, A-I, and A-II gene expression in normal rat liver and during several pathophysiologic states.
Panduro A, etal., Biochemistry. 1990 Sep 11;29(36):8430-5.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
GOA pipeline
RGD automated data pipeline
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Comprehensive gene review and curation
RGD comprehensive gene curation
24.
Increased high density lipoprotein (HDL), defective hepatic catabolism of ApoA-I and ApoA-II, and decreased ApoA-I mRNA in ob/ob mice. Possible role of leptin in stimulation of HDL turnover.
Silver DL, etal., J Biol Chem. 1999 Feb 12;274(7):4140-6.
25.
Differences in HDL-cholesterol:apoA-I + apoA-II ratio and apoE phenotype with albuminuric status in Type I diabetic patients.
Soedamah-Muthu SS, etal., Diabetologia. 2000 Nov;43(11):1353-9.
26.
Variable effects of different corticosteroids on plasma lipids, apolipoproteins, and hepatic apolipoprotein mRNA levels in rats.
Staels B, etal., Arterioscler Thromb. 1991 May-Jun;11(3):760-9.
27.
Fibrates influence the expression of genes involved in lipoprotein metabolism in a tissue-selective manner in the rat.
Staels B, etal., Arterioscler Thromb. 1992 Mar;12(3):286-94.
28.
Influence of development, estrogens, and food intake on apolipoprotein A-I, A-II, and E mRNA in rat liver and intestine.
Staels B, etal., J Lipid Res. 1989 Aug;30(8):1137-45.
29.
Differential regulation of hepatic apolipoprotein A-I and A-II gene expression by thyroid hormone in rat liver.
Strobl W, etal., Atherosclerosis. 1992 Dec;97(2-3):161-70.
30.
The usefulness of measuring body fat deposition for detecting obesity and atherogenesity in Japanese school children.
Takahashi H, etal., Acta Paediatr Jpn. 1996 Dec;38(6):634-9.
31.
Effect of acute inflammation on rat apolipoprotein mRNA levels.
Tu GF, etal., Inflammation. 1987 Jun;11(2):241-51.
32.
Diagnostic and prognostic significance of mRNA expressions of apolipoprotein A and C family genes in hepatitis B virus-related hepatocellular carcinoma.
Wang X, etal., J Cell Biochem. 2019 Oct;120(10):18246-18265. doi: 10.1002/jcb.29131. Epub 2019 Jun 18.
Apoa2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 86,176,767 - 86,178,819 (+) NCBI GRCr8 mRatBN7.2 13 83,644,460 - 83,646,358 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 83,644,470 - 83,646,355 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 86,150,563 - 86,152,200 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 87,548,803 - 87,550,440 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 84,780,423 - 84,782,059 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 89,596,872 - 89,598,805 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 89,597,138 - 89,598,802 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 94,223,741 - 94,225,670 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 87,114,734 - 87,116,372 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 87,303,617 - 87,305,256 (+) NCBI Celera 13 83,275,901 - 83,277,538 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
APOA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 161,222,292 - 161,223,628 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 161,222,290 - 161,223,631 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 161,192,082 - 161,193,418 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 159,458,707 - 159,460,042 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 158,005,155 - 158,006,491 NCBI Celera 1 134,259,238 - 134,260,561 (-) NCBI Celera Cytogenetic Map 1 q23.3 NCBI HuRef 1 132,549,030 - 132,550,353 (-) NCBI HuRef CHM1_1 1 162,588,335 - 162,589,660 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 160,359,748 - 160,361,078 (-) NCBI T2T-CHM13v2.0
Apoa2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 171,049,133 - 171,053,948 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 171,052,623 - 171,053,948 (+) Ensembl GRCm39 Ensembl GRCm38 1 171,221,564 - 171,226,379 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 171,225,054 - 171,226,379 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 173,155,185 - 173,156,510 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 173,061,764 - 173,063,045 (+) NCBI MGSCv36 mm8 Celera 1 173,673,195 - 173,674,520 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 79.22 NCBI
Apoa2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 12,977,956 - 12,979,753 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 12,977,956 - 12,979,282 (-) NCBI ChiLan1.0 ChiLan1.0
APOA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 88,627,887 - 88,629,720 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 88,318,208 - 88,320,039 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 136,634,754 - 136,636,122 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 140,546,591 - 140,547,959 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 140,546,591 - 140,547,959 (-) Ensembl panpan1.1 panPan2
APOA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 21,263,641 - 21,265,887 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 21,262,789 - 21,265,887 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 21,338,500 - 21,340,743 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 21,381,461 - 21,383,727 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 21,380,609 - 21,383,727 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 21,278,560 - 21,279,234 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 21,683,795 - 21,686,027 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 22,092,910 - 22,095,161 (+) NCBI UU_Cfam_GSD_1.0
Apoa2
APOA2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 89,237,511 - 89,240,319 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 89,237,514 - 89,239,126 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 97,094,196 - 97,095,808 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
APOA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 2,757,939 - 2,760,356 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 2,759,237 - 2,760,686 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 1,806,549 - 1,808,724 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Apoa2
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 33 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000004662 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
24
74
91
90
59
25
59
6
185
70
54
39
53
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004662 ⟹ ENSRNOP00000004662
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 83,644,470 - 83,646,355 (+) Ensembl Rnor_6.0 Ensembl 13 89,597,138 - 89,598,802 (+) Ensembl
RefSeq Acc Id:
NM_013112 ⟹ NP_037244
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 86,177,179 - 86,178,816 (+) NCBI mRatBN7.2 13 83,644,718 - 83,646,355 (+) NCBI Rnor_6.0 13 89,597,165 - 89,598,802 (+) NCBI Rnor_5.0 13 94,223,741 - 94,225,670 (+) NCBI RGSC_v3.4 13 87,114,734 - 87,116,372 (+) RGD Celera 13 83,275,901 - 83,277,538 (+) RGD
Sequence:
ATGAAGCTGCTTGCAATGGTTGCACTGCTGGTCACCATCTGTAGCCTAGAAGGAGCTTTGGTTCGGAGACAGGCAGCGGAGACGGATGTGCAGACCCTGTTCAGCCAGTATCTTCAGAGTTTAACTGA
hide sequence
RefSeq Acc Id:
XM_006250238 ⟹ XP_006250300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 86,176,767 - 86,178,819 (+) NCBI mRatBN7.2 13 83,644,460 - 83,646,358 (+) NCBI Rnor_6.0 13 89,596,875 - 89,598,805 (+) NCBI Rnor_5.0 13 94,223,741 - 94,225,670 (+) NCBI
Sequence:
GGGTGGGGTGGGTATGGGGGTGGGAGTGAAGGAGTAGATGTGTATATAGCCCCTACCTCCAGCC
hide sequence
RefSeq Acc Id:
XM_006250239 ⟹ XP_006250301
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 86,176,922 - 86,178,819 (+) NCBI mRatBN7.2 13 83,644,464 - 83,646,358 (+) NCBI Rnor_6.0 13 89,596,872 - 89,598,805 (+) NCBI Rnor_5.0 13 94,223,741 - 94,225,670 (+) NCBI
Sequence:
TGGGGGTGGGGTGGGTATGGGGGTGGGAGTGAAGGAGTAGATGTGTATATAGCCCCTACCTCCAGCCAAGCCGGGAGTAGCGGACGGGAAGGACTGCAACACAGACCCGCAGCACTGTTCCTAGGCCG
hide sequence
RefSeq Acc Id:
NP_037244 ⟸ NM_013112
- Peptide Label:
preproprotein
- UniProtKB:
P04638 (UniProtKB/Swiss-Prot), A6JFV5 (UniProtKB/TrEMBL)
- Sequence:
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK
hide sequence
RefSeq Acc Id:
XP_006250301 ⟸ XM_006250239
- Peptide Label:
isoform X1
- Sequence:
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK
hide sequence
RefSeq Acc Id:
XP_006250300 ⟸ XM_006250238
- Peptide Label:
isoform X1
- Sequence:
MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK
hide sequence
Ensembl Acc Id:
ENSRNOP00000004662 ⟸ ENSRNOT00000004662
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Apoa2
apolipoprotein A2
Apoa2
apolipoprotein A-II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Apoa2
apolipoprotein A-II
Apolipoprotein A-II
Name updated
629478 APPROVED
2002-06-10
Apoa2
Apolipoprotein A-II
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains a lipid binding domain
634654
gene_function
may bind lipids
634654
gene_homology
has high homology with human Apoa2 over the lipid binding domain although the overall homology is only about 50%
634654
gene_product
member of the apolipoprotein gene family
634655
