Symbol:
TUBB
Name:
tubulin beta class I
RGD ID:
1606428
HGNC Page
HGNC:20778
Description:
Enables MHC class I protein binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within odontoblast differentiation. Located in several cellular components, including cytoplasmic ribonucleoprotein granule; microtubule cytoskeleton; and nuclear envelope lumen. Implicated in complex cortical dysplasia with other brain malformations 6 and congenital symmetric circumferential skin creases 1.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
beta 5-tubulin; beta Ib tubulin; beta-4 tubulin; beta1-tubulin; CDCBM6; class I beta-tubulin; CSCSC1; M40; MGC117247; MGC16435; OK/SW-cl.56; TUBB1; TUBB5; tubulin beta chain; tubulin beta polypeptide; tubulin beta-1 chain; tubulin beta-5 chain; tubulin, beta class I; tubulin, beta polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Tubb5 (tubulin, beta 5 class I) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tubb5 (tubulin, beta 5 class I) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Chinchilla lanigera (long-tailed chinchilla):
Tubb (tubulin beta class I) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
TUBB (tubulin beta class I) NCBI
Ortholog
Canis lupus familiaris (dog):
TUBB (tubulin beta class I) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tubb (tubulin beta class I) NCBI
Ortholog
Sus scrofa (pig):
TUBB (tubulin beta class I) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, Panther, Treefam
Chlorocebus sabaeus (green monkey):
TUBB (tubulin beta class I) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Tubb (tubulin beta class I) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Tubb4a (tubulin, beta 4A class IVA) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb2b (tubulin, beta 2B class IIB) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb3 (tubulin, beta 3 class III) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb6 (tubulin, beta 6 class V) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb4b (tubulin, beta 4B class IVB) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb2a (tubulin, beta 2A class IIA) HGNC
OrthoMCL
Mus musculus (house mouse):
Tubb1 (tubulin, beta 1 class VI) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Sh3bgrl4 (SH3 domain binding glutamate-rich protein like 4) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tubb5 (tubulin, beta 5 class I)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tubb5 (tubulin, beta 5 class I)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tubb5 (tubulin, beta 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
ben-1
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
TUB2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mec-7
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
betaTub56D
Alliance
DIOPT (InParanoid|OMA|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
tbb-1
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
tbb-4
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tubb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
tubb.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
TUBBP1
TUBBP10
TUBBP11
TUBBP2
TUBBP3
TUBBP4
TUBBP5
TUBBP6
TUBBP7
TUBBP8
TUBBP9
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
NCBI Annotation Information:
Note: TUBB1 (Gene ID: 81027) and TUBB (Gene ID: 203068) share the TUBB1 symbol/alias in common. TUBB (GeneID: 203068) also shares the TUBB symbol/alias in common with TUBB2A (Gene ID: 7280). [07 Feb 2019]
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,720,352 - 30,725,422 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,717,435 - 30,725,538 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,688,129 - 30,693,199 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,796,136 - 30,801,178 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 32,286,289 - 32,291,331 (+) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 30,488,105 - 30,493,147 (+) NCBI HuRef CHM1_1 6 30,690,286 - 30,695,330 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:126726298|RGD:127286243|RGD:127327115|RGD:150468267|RGD:150556298|RGD:151350171|RGD:155266852|RGD:155644441|RGD:155795018|RGD:329847827|RGD:401750300|RGD:405870387|RGD:407480783|RGD:40886739|RGD:597714842|RGD:8657817 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:25741868 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:8657816 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:39825153 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:11345382|RGD:151663435|RGD:21071446|RGD:21074882|RGD:38598752|RGD:39456683 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:408386069|RGD:408386070 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:39825153 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:8657818 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:30738969|PMID:35183200 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:126731257 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:23246003|PMID:25741868|PMID:26637975 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:243057342 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:23246003|PMID:25741868|PMID:32085672|PMID:34211110 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:13612822 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:25741868|PMID:29671837|PMID:29706646 TUBB Human complex cortical dysplasia with other brain malformations 6 IAGP RGD:156052411 8554872 ClinVar Annotator: match by term: Complex cortical dysplasia with other brain malformations 6 ClinVar PMID:25741868|PMID:32085672 TUBB Human congenital fibrosis of the extraocular muscles IAGP RGD:405280325 8554872 ClinVar Annotator: match by term: Congenital fibrosis of extraocular muscles ClinVar PMID:25741868|PMID:39033378 TUBB Human congenital symmetric circumferential skin creases 1 IAGP RGD:127327115|RGD:150415589|RGD:150550389|RGD:405870387|RGD:40886739|RGD:8657817 8554872 ClinVar Annotator: match by term: Symmetric circumferential skin creases, congenital, 1 | ClinVar Annotator: match more ... ClinVar PMID:25741868 TUBB Human congenital symmetric circumferential skin creases 1 IAGP RGD:10766704|RGD:10766705|RGD:152982556 8554872 ClinVar Annotator: match by term: Symmetric circumferential skin creases, congenital, 1 ClinVar TUBB Human congenital symmetric circumferential skin creases 1 IAGP RGD:8657818 8554872 ClinVar Annotator: match by term: Symmetric circumferential skin creases, congenital, 1 ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:30738969|PMID:35183200 TUBB Human congenital symmetric circumferential skin creases 1 IAGP RGD:126731257 8554872 ClinVar Annotator: match by term: Symmetric circumferential skin creases, congenital, 1 ClinVar PMID:23246003|PMID:25741868|PMID:26637975 TUBB Human congenital symmetric circumferential skin creases 1 IAGP RGD:13612822 8554872 ClinVar Annotator: match by term: Symmetric circumferential skin creases, congenital, 1 ClinVar PMID:25741868|PMID:29671837|PMID:29706646 TUBB Human epilepsy IAGP RGD:13612822 8554872 ClinVar Annotator: match by term: Seizure ClinVar PMID:25741868|PMID:29671837|PMID:29706646 TUBB Human genetic disease IAGP RGD:155795018|RGD:40886739 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868 TUBB Human genetic disease IAGP RGD:8657816 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:39825153 TUBB Human genetic disease IAGP RGD:150556516|RGD:156040134|RGD:40887291|RGD:40887347|RGD:40887478 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar TUBB Human genetic disease IAGP RGD:8657818 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:30738969|PMID:35183200 TUBB Human hydrocephalus IAGP RGD:127274484 8554872 ClinVar Annotator: match by term: Ventriculomegaly ClinVar PMID:25741868 TUBB Human lissencephaly IAGP RGD:13612822 8554872 ClinVar Annotator: match by term: Lissencephaly ClinVar PMID:25741868|PMID:29671837|PMID:29706646 TUBB Human megacolon IAGP RGD:41407604 8554872 ClinVar Annotator: match by term: Megacolon ClinVar PMID:21681106 TUBB Human multiple benign circumferential skin creases on limbs IAGP RGD:13612822 8554872 ClinVar Annotator: match by term: CIRCUMFERENTIAL SKIN CREASES, KUNZE TYPE ClinVar PMID:25741868|PMID:29671837|PMID:29706646 TUBB Human multiple benign circumferential skin creases on limbs IAGP RGD:127327115|RGD:150415589|RGD:405870387|RGD:40886739|RGD:8657817 8554872 ClinVar Annotator: match by term: CIRCUMFERENTIAL SKIN CREASES, KUNZE TYPE ClinVar PMID:25741868 TUBB Human multiple benign circumferential skin creases on limbs IAGP RGD:10766704|RGD:10766705|RGD:152982556 8554872 ClinVar Annotator: match by term: CIRCUMFERENTIAL SKIN CREASES, KUNZE TYPE | ClinVar Annotator: match by more ... ClinVar TUBB Human multiple benign circumferential skin creases on limbs IAGP RGD:8657818 8554872 ClinVar Annotator: match by term: CIRCUMFERENTIAL SKIN CREASES, KUNZE TYPE ClinVar PMID:23246003|PMID:24833723|PMID:25741868|PMID:30738969|PMID:35183200 TUBB Human multiple benign circumferential skin creases on limbs IAGP RGD:126731257 8554872 ClinVar Annotator: match by term: CIRCUMFERENTIAL SKIN CREASES, KUNZE TYPE ClinVar PMID:23246003|PMID:25741868|PMID:26637975 TUBB Human Ventriculomegaly IAGP RGD:127274484 8554872 ClinVar Annotator: match by term: Ventriculomegaly ClinVar PMID:25741868
Only show annotations with direct experimental evidence (0 objects hidden)
TUBB Human (-)-demecolcine decreases expression EXP 6480464 Demecolcine results in decreased expression of TUBB mRNA CTD PMID:23649840 TUBB Human (1->4)-beta-D-glucan multiple interactions ISO RGD:1624063 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TUBB5 mRNA CTD PMID:36331819 TUBB Human (S)-colchicine decreases expression ISO RGD:628596 6480464 Colchicine results in decreased expression of TUBB5 mRNA CTD PMID:20624997 TUBB Human (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TUBB mRNA CTD PMID:16949557 TUBB Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:628596 6480464 o,p'-DDT results in increased expression of TUBB5 mRNA CTD PMID:24096037 TUBB Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:1624063 6480464 o,p'-DDT results in increased expression of TUBB5 mRNA CTD PMID:24096037 TUBB Human 1,1-dichloroethene increases expression ISO RGD:1624063 6480464 vinylidene chloride results in increased expression of TUBB mRNA CTD PMID:26682919 TUBB Human 1,2-dimethylhydrazine increases expression ISO RGD:1624063 6480464 1,2-Dimethylhydrazine results in increased expression of TUBB5 mRNA CTD PMID:22206623 TUBB Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1624063 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of TUBB5 mRNA] CTD PMID:22206623 TUBB Human 1-naphthyl isothiocyanate increases expression ISO RGD:628596 6480464 1-Naphthylisothiocyanate results in increased expression of TUBB5 mRNA CTD PMID:30723492 TUBB Human 17alpha-ethynylestradiol increases expression ISO RGD:628596 6480464 Ethinyl Estradiol results in increased expression of TUBB5 mRNA CTD PMID:16174780|PMID:17108234|PMID:24096037 TUBB Human 17alpha-ethynylestradiol increases expression ISO RGD:1624063 6480464 Ethinyl Estradiol results in increased expression of TUBB5 mRNA CTD PMID:16174780|PMID:17942748|PMID:24096037 TUBB Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1624063 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TUBB5 mRNA CTD PMID:17942748 TUBB Human 17alpha-ethynylestradiol affects expression ISO RGD:1624063 6480464 Ethinyl Estradiol affects the expression of TUBB5 mRNA CTD PMID:17555576 TUBB Human 17beta-estradiol decreases expression ISO RGD:628596 6480464 Estradiol results in decreased expression of TUBB5 protein CTD PMID:32145629 TUBB Human 17beta-estradiol decreases expression ISO RGD:1624063 6480464 Estradiol results in decreased expression of TUBB5 mRNA CTD PMID:39298647 TUBB Human 17beta-estradiol affects expression ISO RGD:628596 6480464 Estradiol affects the expression of TUBB5 mRNA CTD PMID:32145629 TUBB Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one decreases expression EXP 6480464 Metribolone results in decreased expression of TUBB protein CTD PMID:17152098 TUBB Human 2,2',4,4',5,5'-hexachlorobiphenyl decreases expression ISO RGD:628596 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in decreased expression of TUBB5 mRNA CTD PMID:20959002 TUBB Human 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1624063 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of TUBB5 mRNA CTD PMID:31388691 TUBB Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1624063 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TUBB5 mRNA; AHR protein inhibits more ... CTD PMID:15034205|PMID:17942748 TUBB Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:628596 6480464 Tetrachlorodibenzodioxin affects the expression of TUBB5 mRNA CTD PMID:34747641 TUBB Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1624063 6480464 Tetrachlorodibenzodioxin affects the expression of TUBB5 mRNA CTD PMID:21570461|PMID:24680724 TUBB Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1624063 6480464 Tetrachlorodibenzodioxin results in increased expression of TUBB5 mRNA CTD PMID:15328365|PMID:17942748|PMID:33956508 TUBB Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1624063 6480464 Tetrachlorodibenzodioxin results in decreased expression of TUBB5 mRNA CTD PMID:15034205 TUBB Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:628596 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of TUBB5 mRNA CTD PMID:32109520 TUBB Human 2,4,6-trinitrotoluene affects expression ISO RGD:628596 6480464 Trinitrotoluene affects the expression of TUBB5 mRNA CTD PMID:21346803 TUBB Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:628596 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of TUBB5 protein CTD PMID:19954255 TUBB Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1624063 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of TUBB5 mRNA CTD PMID:38648751 TUBB Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:628596 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of TUBB5 protein CTD PMID:19954255 TUBB Human 2,4-dinitrotoluene affects expression ISO RGD:628596 6480464 2,4-dinitrotoluene affects the expression of TUBB5 mRNA CTD PMID:21346803 TUBB Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ... CTD PMID:38598786 TUBB Human 2-acetamidofluorene increases expression ISO RGD:628596 6480464 2-Acetylaminofluorene results in increased expression of TUBB5 mRNA CTD PMID:22584684 TUBB Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of TUBB mRNA CTD PMID:30851411 TUBB Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of TUBB mRNA CTD PMID:21179406 TUBB Human 2-nitrofluorene increases expression ISO RGD:628596 6480464 2-nitrofluorene results in increased expression of TUBB5 mRNA CTD PMID:15890375 TUBB Human 3,3',4,4',5-pentachlorobiphenyl affects expression ISO RGD:1624063 6480464 3,4,5,3',4'-pentachlorobiphenyl affects the expression of TUBB5 mRNA CTD PMID:37080397 TUBB Human 3,4-dihydrocoumarin decreases expression ISO RGD:1624063 6480464 3,4-dihydrocoumarin results in decreased expression of TUBB5 mRNA CTD PMID:22016648 TUBB Human 3-chloropropane-1,2-diol increases expression ISO RGD:628596 6480464 alpha-Chlorohydrin results in increased expression of TUBB5 protein CTD PMID:26072098 TUBB Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 TUBB Human 3H-1,2-dithiole-3-thione increases expression ISO RGD:628596 6480464 1,2-dithiol-3-thione results in increased expression of TUBB5 mRNA CTD PMID:19162173 TUBB Human 4,4'-sulfonyldiphenol affects expression ISO RGD:1624063 6480464 bisphenol S affects the expression of TUBB5 mRNA CTD PMID:39298647 TUBB Human 4,4'-sulfonyldiphenol affects methylation ISO RGD:1624063 6480464 bisphenol S affects the methylation of TUBB5 gene CTD PMID:31683443 TUBB Human 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression ISO RGD:628596 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of TUBB5 mRNA CTD PMID:15890375 TUBB Human 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of TUBB mRNA CTD PMID:16671099 TUBB Human 4-hydroxyphenyl retinamide increases expression ISO RGD:1624063 6480464 Fenretinide results in increased expression of TUBB mRNA CTD PMID:28973697 TUBB Human 5-fluorouracil decreases expression EXP 6480464 Fluorouracil results in decreased expression of TUBB mRNA CTD PMID:17039268 TUBB Human 6-propyl-2-thiouracil decreases expression ISO RGD:628596 6480464 Propylthiouracil results in decreased expression of TUBB5 mRNA CTD PMID:18077114 TUBB Human 6-propyl-2-thiouracil increases expression ISO RGD:628596 6480464 Propylthiouracil results in increased expression of TUBB5 mRNA CTD PMID:24780913|PMID:30047161 TUBB Human acetamide increases expression ISO RGD:628596 6480464 acetamide results in increased expression of TUBB5 mRNA CTD PMID:31881176 TUBB Human acrylamide increases expression ISO RGD:628596 6480464 Acrylamide results in increased expression of TUBB protein; Acrylamide results in increased expression of TUBB5 more ... CTD PMID:29524570|PMID:30096436 TUBB Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TUBB mRNA CTD PMID:32763439 TUBB Human acrylamide multiple interactions ISO RGD:628596 6480464 calpeptin inhibits the reaction [Acrylamide results in increased expression of TUBB protein]; calpeptin inhibits the more ... CTD PMID:29524570|PMID:30096436 TUBB Human aflatoxin B1 increases expression ISO RGD:628596 6480464 Aflatoxin B1 results in increased expression of TUBB5 mRNA CTD PMID:15890375 TUBB Human amitrole increases expression ISO RGD:628596 6480464 Amitrole results in increased expression of TUBB5 mRNA CTD PMID:30047161 TUBB Human ammonium chloride decreases expression ISO RGD:628596 6480464 Ammonium Chloride results in decreased expression of TUBB mRNA CTD PMID:16483693 TUBB Human aniline increases expression ISO RGD:1624063 6480464 aniline results in increased expression of TUBB5 mRNA CTD PMID:22016648 TUBB Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of TUBB mRNA CTD PMID:24449571 TUBB Human apigenin increases expression ISO RGD:1624063 6480464 Apigenin results in increased expression of TUBB5 mRNA CTD PMID:22359648 TUBB Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of TUBB mRNA CTD PMID:33212167 TUBB Human arsane multiple interactions EXP 6480464 [Arsenic binds to TUBB protein] inhibits the reaction [TUBB protein binds to TUBB protein]; Arsenic more ... CTD PMID:17499915 TUBB Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of TUBB gene CTD PMID:25304211 TUBB Human arsane decreases expression EXP 6480464 Arsenic results in decreased expression of TUBB5 protein CTD PMID:19818359 TUBB Human arsenic atom multiple interactions EXP 6480464 [Arsenic binds to TUBB protein] inhibits the reaction [TUBB protein binds to TUBB protein]; Arsenic more ... CTD PMID:17499915 TUBB Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of TUBB gene CTD PMID:25304211 TUBB Human arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of TUBB5 protein CTD PMID:19818359 TUBB Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to TUBB mRNA] CTD PMID:32406909 TUBB Human azathioprine decreases expression EXP 6480464 Azathioprine results in decreased expression of TUBB mRNA CTD PMID:22623647 TUBB Human beauvericin multiple interactions EXP 6480464 [beauvericin co-treated with enniatins] results in increased expression of TUBB protein CTD PMID:32407736 TUBB Human benzatropine increases expression EXP 6480464 Benztropine results in increased expression of TUBB protein CTD PMID:34122009 TUBB Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TUBB mRNA CTD PMID:20064835 TUBB Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TUBB mRNA CTD PMID:32234424 TUBB Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of TUBB 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 TUBB Human benzo[a]pyrene multiple interactions ISO RGD:1624063 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in decreased expression of TUBB5 mRNA] CTD PMID:15034205 TUBB Human benzo[a]pyrene decreases expression ISO RGD:1624063 6480464 Benzo(a)pyrene results in decreased expression of TUBB5 mRNA CTD PMID:15034205 TUBB Human benzo[a]pyrene multiple interactions ISO RGD:628596 6480464 [Benzo(a)pyrene co-treated with 1,2,5,6-dibenzanthracene] affects the expression of TUBB5 mRNA; [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects more ... CTD PMID:18711122 TUBB Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TUBB mRNA CTD PMID:20382639 TUBB Human benzo[b]fluoranthene multiple interactions ISO RGD:628596 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of TUBB5 mRNA CTD PMID:18711122 TUBB Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of TUBB mRNA CTD PMID:38218311 TUBB Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of TUBB mRNA CTD PMID:19737606 TUBB Human biochanin A increases expression EXP 6480464 biochanin A results in increased expression of TUBB mRNA CTD PMID:12111696 TUBB Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1624063 6480464 Diethylhexyl Phthalate results in decreased expression of TUBB5 mRNA CTD PMID:34319233 TUBB Human bis(2-ethylhexyl) phthalate increases expression ISO RGD:1624063 6480464 Diethylhexyl Phthalate results in increased expression of TUBB5 mRNA CTD PMID:33754040 TUBB Human bisphenol A increases expression ISO RGD:628596 6480464 bisphenol A results in increased expression of TUBB mRNA; bisphenol A results in increased expression more ... CTD PMID:18180321|PMID:38750585 TUBB Human bisphenol A affects expression ISO RGD:628596 6480464 bisphenol A affects the expression of TUBB5 mRNA CTD PMID:32145629 TUBB Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TUBB mRNA CTD PMID:30903817 TUBB Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TUBB gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 TUBB Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TUBB mRNA; bisphenol A results in increased expression more ... CTD PMID:25047013|PMID:34186270 TUBB Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of TUBB protein CTD PMID:34186270 TUBB Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of TUBB protein CTD PMID:34186270 TUBB Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of TUBB protein CTD PMID:34186270 TUBB Human buspirone decreases expression ISO RGD:628596 6480464 Buspirone results in decreased expression of TUBB5 mRNA CTD PMID:24136188 TUBB Human cadmium acetate decreases expression EXP 6480464 cadmium acetate results in decreased expression of TUBB mRNA CTD PMID:18155341 TUBB Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TUBB mRNA CTD PMID:38568856 TUBB Human Calpeptin multiple interactions ISO RGD:628596 6480464 calpeptin inhibits the reaction [Acrylamide results in increased expression of TUBB protein]; calpeptin inhibits the more ... CTD PMID:29524570|PMID:30096436 TUBB Human cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of TUBB protein CTD PMID:34122009 TUBB Human carbon nanotube affects expression ISO RGD:1624063 6480464 Nanotubes, Carbon affects the expression of TUBB5 protein CTD PMID:21135415 TUBB Human carbon nanotube increases expression ISO RGD:1624063 6480464 Nanotubes, Carbon analog results in increased expression of TUBB5 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 TUBB Human carbon nanotube decreases expression ISO RGD:1624063 6480464 Nanotubes, Carbon analog results in decreased expression of TUBB5 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 TUBB Human carmustine increases expression EXP 6480464 Carmustine results in increased expression of TUBB mRNA CTD PMID:15980968 TUBB Human chloropicrin decreases expression EXP 6480464 chloropicrin results in decreased expression of TUBB protein CTD PMID:28476498 TUBB Human chloropicrin affects expression EXP 6480464 chloropicrin affects the expression of TUBB mRNA CTD PMID:26352163 TUBB Human chlorpyrifos decreases expression ISO RGD:1624063 6480464 Chlorpyrifos results in decreased expression of TUBB5 mRNA CTD PMID:37019170 TUBB Human choline multiple interactions ISO RGD:628596 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased more ... CTD PMID:19566968 TUBB Human chromium(6+) affects expression ISO RGD:1624063 6480464 chromium hexavalent ion affects the expression of TUBB5 mRNA CTD PMID:28472532 TUBB Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 TUBB Human ciguatoxin CTX1B affects expression ISO RGD:1624063 6480464 Ciguatoxins affects the expression of TUBB5 mRNA CTD PMID:18353800 TUBB Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of TUBB mRNA CTD PMID:19561079 TUBB Human clobetasol increases expression ISO RGD:1624063 6480464 Clobetasol results in increased expression of TUBB5 mRNA CTD PMID:27462272 TUBB Human clofibrate decreases expression ISO RGD:1624063 6480464 Clofibrate results in decreased expression of TUBB5 mRNA CTD PMID:17585979 TUBB Human clozapine increases expression EXP 6480464 Clozapine results in increased expression of TUBB protein CTD PMID:34122009 TUBB Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of TUBB mRNA CTD PMID:19376846 TUBB Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TUBB mRNA CTD PMID:19320972|PMID:19376846 TUBB Human copper atom increases expression ISO RGD:628596 6480464 Copper results in increased expression of TUBB5 mRNA CTD PMID:22465980 TUBB Human copper atom affects binding EXP 6480464 TUBB protein binds to Copper CTD PMID:15359738 TUBB Human copper(0) increases expression ISO RGD:628596 6480464 Copper results in increased expression of TUBB5 mRNA CTD PMID:22465980 TUBB Human copper(0) affects binding EXP 6480464 TUBB protein binds to Copper CTD PMID:15359738 TUBB Human corticosterone decreases expression ISO RGD:628596 6480464 Corticosterone results in decreased expression of TUBB5 mRNA CTD PMID:15755911 TUBB Human coumarin increases phosphorylation EXP 6480464 coumarin results in increased phosphorylation of TUBB protein CTD PMID:35688186 TUBB Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of TUBB mRNA CTD PMID:19167446 TUBB Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TUBB mRNA CTD PMID:19167446 TUBB Human crocidolite asbestos increases expression EXP 6480464 Asbestos, Crocidolite results in increased expression of TUBB protein CTD PMID:29553831 TUBB Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TUBB mRNA CTD PMID:21632981 TUBB Human cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of TUBB mRNA CTD PMID:25562108 TUBB Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of TUBB protein CTD PMID:27494769 TUBB Human DDE increases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TUBB mRNA CTD PMID:38568856 TUBB Human dexamethasone decreases expression ISO RGD:628596 6480464 Dexamethasone results in decreased expression of TUBB5 mRNA CTD PMID:14618091 TUBB Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 TUBB Human dibenz[a,h]anthracene multiple interactions ISO RGD:628596 6480464 [1,2,5,6-dibenzanthracene co-treated with dibenzo(a,l)pyrene] affects the expression of TUBB5 mRNA; [1,2,5,6-dibenzanthracene co-treated with fluoranthene] affects more ... CTD PMID:18711122 TUBB Human dibenzo[a,l]pyrene multiple interactions ISO RGD:628596 6480464 [1,2,5,6-dibenzanthracene co-treated with dibenzo(a,l)pyrene] affects the expression of TUBB5 mRNA; [Benzo(a)pyrene co-treated with dibenzo(a,l)pyrene] affects more ... CTD PMID:18711122 TUBB Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of TUBB mRNA CTD PMID:37042841 TUBB Human dibutyl phthalate decreases expression ISO RGD:1624063 6480464 Dibutyl Phthalate results in decreased expression of TUBB5 mRNA CTD PMID:21266533 TUBB Human dichlorvos increases phosphorylation ISO RGD:628596 6480464 Dichlorvos results in increased phosphorylation of TUBB protein CTD PMID:11282359|PMID:16635102 TUBB Human diethylstilbestrol increases expression ISO RGD:628596 6480464 Diethylstilbestrol results in increased expression of TUBB5 mRNA CTD PMID:15890375 TUBB Human dopamine increases expression ISO RGD:628596 6480464 Dopamine results in increased expression of TUBB5 mRNA CTD PMID:21983523 TUBB Human dopamine decreases expression EXP 6480464 Dopamine results in decreased expression of TUBB protein CTD PMID:24675778 TUBB Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of TUBB mRNA CTD PMID:16579640 TUBB Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of TUBB mRNA CTD PMID:29803840 TUBB Human doxorubicin increases expression ISO RGD:1624063 6480464 Doxorubicin results in increased expression of TUBB5 mRNA CTD PMID:10618415|PMID:22016648 TUBB Human doxorubicin multiple interactions EXP 6480464 [Doxorubicin co-treated with pluronic block copolymer p85] results in increased expression of TUBB mRNA CTD PMID:16579640 TUBB Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of TUBB mRNA CTD PMID:19244175 TUBB Human enniatin multiple interactions EXP 6480464 [beauvericin co-treated with enniatins] results in increased expression of TUBB protein CTD PMID:32407736 TUBB Human enniatin decreases expression ISO RGD:628596 6480464 enniatins results in decreased expression of TUBB5 mRNA CTD PMID:27163883 TUBB Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of TUBB mRNA CTD PMID:19167446 TUBB Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 TUBB Human epoxiconazole decreases expression ISO RGD:1624063 6480464 epoxiconazole results in decreased expression of TUBB5 mRNA CTD PMID:35436446 TUBB Human ethanol increases expression ISO RGD:628596 6480464 Ethanol results in increased expression of TUBB5 mRNA CTD PMID:15353170 TUBB Human ethanol affects splicing ISO RGD:1624063 6480464 Ethanol affects the splicing of TUBB5 mRNA CTD PMID:30319688 TUBB Human fenoldopam increases expression ISO RGD:628596 6480464 Fenoldopam results in increased expression of TUBB5 mRNA CTD PMID:21983523 TUBB Human fenthion decreases expression ISO RGD:1624063 6480464 Fenthion results in decreased expression of TUBB5 mRNA CTD PMID:34813904 TUBB Human fluoranthene multiple interactions ISO RGD:628596 6480464 [1,2,5,6-dibenzanthracene co-treated with fluoranthene] affects the expression of TUBB5 mRNA; [Benzo(a)pyrene co-treated with fluoranthene] affects more ... CTD PMID:18711122 TUBB Human flutamide increases expression ISO RGD:628596 6480464 Flutamide results in increased expression of TUBB5 mRNA CTD PMID:24136188 TUBB Human folic acid multiple interactions ISO RGD:1624063 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of TUBB5 mRNA] CTD PMID:22206623 TUBB Human folic acid multiple interactions ISO RGD:628596 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased more ... CTD PMID:19566968 TUBB Human folic acid increases expression ISO RGD:628596 6480464 Folic Acid deficiency results in increased expression of TUBB5 protein CTD PMID:19566968 TUBB Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TUBB gene CTD PMID:31601247 TUBB Human fumonisin B1 increases expression ISO RGD:1624063 6480464 fumonisin B1 results in increased expression of TUBB5 mRNA CTD PMID:16221962 TUBB Human furan increases expression ISO RGD:628596 6480464 furan results in increased expression of TUBB5 mRNA CTD PMID:15120968 TUBB Human furfural multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TUBB protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 TUBB Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of TUBB mRNA CTD PMID:16705744 TUBB Human gentamycin increases expression ISO RGD:628596 6480464 Gentamicins results in increased expression of TUBB5 mRNA CTD PMID:22061828 TUBB Human gold atom decreases expression ISO RGD:1624063 6480464 Gold analog results in decreased expression of TUBB5 protein CTD PMID:24780912 TUBB Human gold(0) decreases expression ISO RGD:1624063 6480464 Gold analog results in decreased expression of TUBB5 protein CTD PMID:24780912 TUBB Human GSK-J4 decreases expression EXP 6480464 GSK-J4 results in decreased expression of TUBB mRNA CTD PMID:29301935 TUBB Human hyaluronic acid multiple interactions ISO RGD:628596 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of TUBB5 protein] CTD PMID:23178681 TUBB Human hydrogen peroxide multiple interactions ISO RGD:628596 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of TUBB5 protein] CTD PMID:23178681 TUBB Human hydrogen peroxide decreases expression ISO RGD:628596 6480464 Hydrogen Peroxide results in decreased expression of TUBB5 protein CTD PMID:23178681 TUBB Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 TUBB Human indometacin increases expression ISO RGD:628596 6480464 Indomethacin results in increased expression of TUBB5 mRNA CTD PMID:36868495 TUBB Human isoflavones decreases expression EXP 6480464 Isoflavones results in decreased expression of TUBB mRNA CTD PMID:17374662 TUBB Human isoprenaline decreases expression ISO RGD:1624063 6480464 Isoproterenol results in decreased expression of TUBB5 mRNA CTD PMID:20003209 TUBB Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of TUBB protein CTD PMID:32959892 TUBB Human L-methionine multiple interactions ISO RGD:628596 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased more ... CTD PMID:19566968 TUBB Human lead(II) chloride increases expression EXP 6480464 lead chloride results in increased expression of TUBB protein CTD PMID:24419708 TUBB Human leflunomide decreases expression ISO RGD:628596 6480464 leflunomide results in decreased expression of TUBB5 mRNA CTD PMID:24136188 TUBB Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of TUBB mRNA CTD PMID:28988120 TUBB Human levofloxacin decreases expression ISO RGD:628596 6480464 Levofloxacin results in decreased expression of TUBB5 mRNA CTD PMID:24136188 TUBB Human lovastatin decreases expression ISO RGD:1624063 6480464 Lovastatin results in decreased expression of TUBB5 mRNA CTD PMID:20493250 TUBB Human maneb multiple interactions ISO RGD:1624063 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TUBB5 mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 TUBB Human melatonin multiple interactions ISO RGD:1624063 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of TUBB5 mRNA] CTD PMID:23963992 TUBB Human methamphetamine increases expression ISO RGD:628596 6480464 Methamphetamine results in increased expression of TUBB5 protein CTD PMID:19826936 TUBB Human methapyrilene increases expression ISO RGD:628596 6480464 Methapyrilene results in increased expression of TUBB5 mRNA CTD PMID:15120968|PMID:15890375|PMID:22584684|PMID:30467583 TUBB Human methidathion decreases expression ISO RGD:1624063 6480464 methidathion results in decreased expression of TUBB5 mRNA CTD PMID:34813904 TUBB Human methimazole increases expression ISO RGD:628596 6480464 Methimazole results in increased expression of TUBB5 mRNA CTD PMID:30047161 TUBB Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of TUBB mRNA CTD PMID:23649840 TUBB Human miconazole increases expression ISO RGD:1624063 6480464 Miconazole results in increased expression of TUBB5 mRNA CTD PMID:27462272 TUBB Human Monobutylphthalate increases expression ISO RGD:1624063 6480464 monobutyl phthalate results in increased expression of TUBB5 protein CTD PMID:20553848 TUBB Human N(4)-hydroxycytidine decreases expression ISO RGD:1624063 6480464 N(4)-hydroxycytidine results in decreased expression of TUBB5 mRNA CTD PMID:37748715 TUBB Human N-acetyl-beta-D-glucosamine decreases expression EXP 6480464 Acetylglucosamine results in decreased expression of TUBB mRNA CTD PMID:18047607 TUBB Human N-acetyl-D-glucosamine decreases expression EXP 6480464 Acetylglucosamine results in decreased expression of TUBB mRNA CTD PMID:18047607 TUBB Human N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of TUBB mRNA CTD PMID:21527772 TUBB Human N-nitrosodiethylamine multiple interactions ISO RGD:628596 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of TUBB5 mRNA CTD PMID:28943392 TUBB Human N-nitrosodiethylamine increases expression ISO RGD:628596 6480464 Diethylnitrosamine results in increased expression of TUBB5 mRNA CTD PMID:19638242 TUBB Human N-nitrosodimethylamine increases expression ISO RGD:628596 6480464 Dimethylnitrosamine results in increased expression of TUBB5 mRNA CTD PMID:15890375 TUBB Human nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TUBB mRNA CTD PMID:16949557 TUBB Human nitrates multiple interactions ISO RGD:1624063 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TUBB5 more ... CTD PMID:35964746 TUBB Human ochratoxin A increases expression ISO RGD:628596 6480464 ochratoxin A results in increased expression of TUBB5 mRNA CTD PMID:23358140 TUBB Human oxaliplatin multiple interactions ISO RGD:628596 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TUBB5 mRNA CTD PMID:25729387 TUBB Human oxycodone decreases expression ISO RGD:628596 6480464 Oxycodone results in decreased expression of TUBB5 mRNA CTD PMID:23439660 TUBB Human ozone multiple interactions ISO RGD:1624063 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 TUBB Human paclitaxel increases response to substance EXP 6480464 TUBB mRNA results in increased susceptibility to Paclitaxel CTD PMID:15239142 TUBB Human palbociclib decreases expression EXP 6480464 palbociclib results in decreased expression of TUBB mRNA CTD PMID:22869556 TUBB Human paracetamol affects expression ISO RGD:1624063 6480464 Acetaminophen affects the expression of TUBB5 mRNA CTD PMID:17562736 TUBB Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TUBB mRNA CTD PMID:29067470 TUBB Human paracetamol multiple interactions ISO RGD:1624063 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of TUBB5 mRNA] CTD PMID:29246445 TUBB Human paracetamol increases expression ISO RGD:1624063 6480464 Acetaminophen results in increased expression of TUBB5 mRNA CTD PMID:29246445 TUBB Human paraquat multiple interactions ISO RGD:1624063 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TUBB5 mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 TUBB Human pentachlorophenol decreases expression ISO RGD:1624063 6480464 Pentachlorophenol results in decreased expression of TUBB5 mRNA CTD PMID:23892564 TUBB Human perfluorooctane-1-sulfonic acid increases expression ISO RGD:1624063 6480464 perfluorooctane sulfonic acid results in increased expression of TUBB5 protein CTD PMID:26178269 TUBB Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1624063 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TUBB5 mRNA CTD PMID:36331819 TUBB Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of TUBB mRNA CTD PMID:36326898 TUBB Human phenobarbital affects expression ISO RGD:1624063 6480464 Phenobarbital affects the expression of TUBB5 mRNA CTD PMID:23091169 TUBB Human pinosylvin decreases expression EXP 6480464 pinosylvin results in decreased expression of TUBB mRNA CTD PMID:23333577 TUBB Human piperonyl butoxide increases expression ISO RGD:628596 6480464 Piperonyl Butoxide results in increased expression of TUBB5 mRNA CTD PMID:15890375|PMID:22484513 TUBB Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 TUBB Human pirinixic acid increases expression ISO RGD:1624063 6480464 pirinixic acid results in increased expression of TUBB5 mRNA CTD PMID:15302862|PMID:16221962|PMID:20813756|PMID:23811191 TUBB Human pirinixic acid decreases expression ISO RGD:1624063 6480464 pirinixic acid results in decreased expression of TUBB5 mRNA CTD PMID:17426115 TUBB Human pirinixic acid multiple interactions ISO RGD:1624063 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of TUBB5 mRNA CTD PMID:20813756 TUBB Human pirinixic acid increases expression ISO RGD:628596 6480464 pirinixic acid results in increased expression of TUBB5 mRNA CTD PMID:15890375|PMID:19162173 TUBB Human pregnenolone 16alpha-carbonitrile increases expression ISO RGD:628596 6480464 Pregnenolone Carbonitrile results in increased expression of TUBB5 mRNA CTD PMID:19162173|PMID:30047161 TUBB Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of TUBB mRNA CTD PMID:18037150 TUBB Human propiconazole increases expression ISO RGD:1624063 6480464 propiconazole results in increased expression of TUBB5 mRNA CTD PMID:21278054 TUBB Human Propiverine affects binding ISO RGD:628596 6480464 propiverine binds to TUBB5 protein CTD PMID:29273565 TUBB Human prostaglandin A1 increases metabolic processing ISO RGD:1624063 6480464 prostaglandin A1 analog results in increased metabolism of TUBB5 protein CTD PMID:19800325 TUBB Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of TUBB mRNA; Quercetin results in decreased expression of TUBB more ... CTD PMID:19207037|PMID:21632981 TUBB Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of TUBB mRNA CTD PMID:30851411 TUBB Human resveratrol increases expression ISO RGD:1624063 6480464 resveratrol results in increased expression of TUBB5 protein CTD PMID:25505154 TUBB Human rotenone multiple interactions ISO RGD:1624063 6480464 TRP53 affects the reaction [Rotenone affects the expression of TUBB5 mRNA] CTD PMID:21893155 TUBB Human rotenone decreases expression ISO RGD:628596 6480464 Rotenone results in decreased expression of TUBB5 mRNA CTD PMID:28374803 TUBB Human rotenone increases oxidation ISO RGD:628596 6480464 Rotenone results in increased oxidation of TUBB5 protein CTD PMID:30951809 TUBB Human rotenone affects expression ISO RGD:1624063 6480464 Rotenone affects the expression of TUBB5 mRNA CTD PMID:21893155 TUBB Human rotenone increases expression ISO RGD:1624063 6480464 Rotenone results in increased expression of TUBB5 mRNA CTD PMID:22016648 TUBB Human Salinomycin decreases expression EXP 6480464 salinomycin results in decreased expression of TUBB mRNA CTD PMID:19682730 TUBB Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of TUBB mRNA CTD PMID:19244175 TUBB Human silicon dioxide affects secretion EXP 6480464 Silicon Dioxide analog affects the secretion of TUBB protein CTD PMID:25895662 TUBB Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TUBB mRNA CTD PMID:28595984|PMID:34032870 TUBB Human sodium arsenite decreases expression ISO RGD:628596 6480464 sodium arsenite results in decreased expression of TUBB5 protein CTD PMID:31874112 TUBB Human sodium arsenite decreases expression ISO RGD:1624063 6480464 sodium arsenite results in decreased expression of TUBB5 mRNA CTD PMID:23022324 TUBB Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TUBB mRNA; sodium arsenite results in decreased expression more ... CTD PMID:21925251|PMID:30528433|PMID:38568856 TUBB Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TUBB protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 TUBB Human sodium fluoride decreases expression ISO RGD:1624063 6480464 Sodium Fluoride results in decreased expression of TUBB5 protein CTD PMID:28918527 TUBB Human sodium fluoride increases expression ISO RGD:1624063 6480464 Sodium Fluoride results in increased expression of TUBB5 protein CTD PMID:27548804 TUBB Human sulfadimethoxine increases expression ISO RGD:628596 6480464 Sulfadimethoxine results in increased expression of TUBB5 mRNA CTD PMID:30047161 TUBB Human sulfasalazine increases expression ISO RGD:1624063 6480464 Sulfasalazine results in increased expression of TUBB5 mRNA CTD PMID:22016648 TUBB Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of TUBB mRNA CTD PMID:31533062 TUBB Human T-2 toxin affects expression ISO RGD:628596 6480464 T-2 Toxin affects the expression of TUBB protein CTD PMID:26141394 TUBB Human tamoxifen affects expression ISO RGD:1624063 6480464 Tamoxifen affects the expression of TUBB5 mRNA CTD PMID:17555576|PMID:20937368 TUBB Human tetrachloromethane increases expression ISO RGD:1624063 6480464 Carbon Tetrachloride results in increased expression of TUBB5 mRNA CTD PMID:27339419|PMID:31919559 TUBB Human thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of TUBB mRNA; Thapsigargin results in decreased expression of TUBB more ... CTD PMID:21692457|PMID:22378314 TUBB Human thioacetamide increases expression ISO RGD:628596 6480464 Thioacetamide results in increased expression of TUBB5 mRNA CTD PMID:23411599 TUBB Human thioacetamide multiple interactions ISO RGD:628596 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of TUBB5 mRNA CTD PMID:28943392 TUBB Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of TUBB mRNA CTD PMID:38568856 TUBB Human titanium dioxide increases phosphorylation EXP 6480464 titanium dioxide results in increased phosphorylation of TUBB protein CTD PMID:21439344 TUBB Human titanium dioxide decreases methylation ISO RGD:1624063 6480464 titanium dioxide results in decreased methylation of TUBB5 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 TUBB Human titanium dioxide increases expression ISO RGD:1624063 6480464 titanium dioxide results in increased expression of TUBB5 mRNA CTD PMID:23557971|PMID:27760801 TUBB Human topotecan multiple interactions ISO RGD:628596 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TUBB5 mRNA CTD PMID:25729387 TUBB Human trans-pinosylvin decreases expression EXP 6480464 pinosylvin results in decreased expression of TUBB mRNA CTD PMID:23333577 TUBB Human triadimefon increases expression ISO RGD:628596 6480464 triadimefon results in increased expression of TUBB5 mRNA CTD PMID:30047161 TUBB Human Tributyltin oxide decreases expression ISO RGD:1624063 6480464 bis(tri-n-butyltin)oxide results in decreased expression of TUBB5 mRNA CTD PMID:18958704 TUBB Human Tributyltin oxide increases phosphorylation ISO RGD:1624063 6480464 bis(tri-n-butyltin)oxide results in increased phosphorylation of TUBB5 protein CTD PMID:22174045 TUBB Human trimellitic anhydride increases expression ISO RGD:1624063 6480464 trimellitic anhydride results in increased expression of TUBB5 mRNA CTD PMID:19042947 TUBB Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of TUBB mRNA CTD PMID:37042841 TUBB Human tris(2-butoxyethyl) phosphate affects expression EXP 6480464 tris(2-butoxyethyl) phosphate affects the expression of TUBB mRNA CTD PMID:29024780 TUBB Human trovafloxacin decreases expression ISO RGD:628596 6480464 trovafloxacin results in decreased expression of TUBB5 mRNA CTD PMID:24136188 TUBB Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of TUBB mRNA CTD PMID:22378314|PMID:29453283 TUBB Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of TUBB mRNA CTD PMID:28818685 TUBB Human valproic acid decreases expression ISO RGD:1624063 6480464 Valproic Acid results in decreased expression of TUBB5 mRNA CTD PMID:20546886 TUBB Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TUBB mRNA CTD PMID:23179753|PMID:29154799 TUBB Human vancomycin decreases expression ISO RGD:1624063 6480464 Vancomycin results in decreased expression of TUBB5 mRNA CTD PMID:18930951 TUBB Human vincaleukoblastine decreases expression ISO RGD:628596 6480464 Vinblastine results in decreased expression of TUBB5 mRNA CTD PMID:20624997 TUBB Human vinclozolin decreases expression ISO RGD:628596 6480464 vinclozolin results in decreased expression of TUBB5 mRNA CTD PMID:23034163 TUBB Human vincristine decreases expression EXP 6480464 Vincristine results in decreased expression of TUBB mRNA CTD PMID:23649840 TUBB Human vincristine decreases expression ISO RGD:628596 6480464 Vincristine results in decreased expression of TUBB5 mRNA CTD PMID:20624997 TUBB Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of TUBB mRNA CTD PMID:19244175 TUBB Human warfarin decreases expression ISO RGD:1624063 6480464 Warfarin results in decreased expression of TUBB5 mRNA CTD PMID:20493250 TUBB Human withaferin A decreases expression EXP 6480464 withaferin A results in decreased expression of TUBB mRNA CTD PMID:24297176 TUBB Human zearalenone decreases expression ISO RGD:1624063 6480464 Zearalenone results in decreased expression of TUBB5 protein CTD PMID:36252740 TUBB Human zoledronic acid decreases expression EXP 6480464 zoledronic acid results in decreased expression of TUBB mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(-)-demecolcine (EXP) (1->4)-beta-D-glucan (ISO) (S)-colchicine (ISO) (S)-nicotine (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,6-trinitrotoluene (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 2,6-dimethoxyphenol (EXP) 2-acetamidofluorene (ISO) 2-hydroxypropanoic acid (EXP) 2-methylcholine (EXP) 2-nitrofluorene (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-dihydrocoumarin (ISO) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-hydroxyphenyl retinamide (EXP,ISO) 5-fluorouracil (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) amitrole (ISO) ammonium chloride (ISO) aniline (ISO) antirheumatic drug (EXP) apigenin (ISO) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) azathioprine (EXP) beauvericin (EXP) benzatropine (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) beta-lapachone (EXP) beta-naphthoflavone (EXP) biochanin A (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (EXP) buspirone (ISO) cadmium acetate (EXP) cadmium dichloride (EXP) Calpeptin (ISO) cannabidiol (EXP) carbon nanotube (ISO) carmustine (EXP) chloropicrin (EXP) chlorpyrifos (ISO) choline (ISO) chromium(6+) (EXP,ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP) clobetasol (ISO) clofibrate (ISO) clozapine (EXP) cobalt dichloride (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) corticosterone (ISO) coumarin (EXP) coumestrol (EXP) crocidolite asbestos (EXP) cyclosporin A (EXP) cylindrospermopsin (EXP) DDE (EXP) dexamethasone (EXP,ISO) dibenz[a,h]anthracene (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dichlorvos (ISO) diethylstilbestrol (ISO) dopamine (EXP,ISO) doxorubicin (EXP,ISO) elemental selenium (EXP) enniatin (EXP,ISO) Enterolactone (EXP) enzyme inhibitor (EXP) epoxiconazole (ISO) ethanol (ISO) fenoldopam (ISO) fenthion (ISO) fluoranthene (ISO) flutamide (ISO) folic acid (ISO) fulvestrant (EXP) fumonisin B1 (ISO) furan (ISO) furfural (EXP) genistein (EXP) gentamycin (ISO) gold atom (ISO) gold(0) (ISO) GSK-J4 (EXP) hyaluronic acid (ISO) hydrogen peroxide (ISO) indometacin (EXP,ISO) isoflavones (EXP) isoprenaline (ISO) ivermectin (EXP) L-methionine (ISO) lead(II) chloride (EXP) leflunomide (EXP,ISO) levofloxacin (ISO) lovastatin (ISO) maneb (ISO) melatonin (ISO) methamphetamine (ISO) methapyrilene (ISO) methidathion (ISO) methimazole (ISO) methyl methanesulfonate (EXP) miconazole (ISO) Monobutylphthalate (ISO) N(4)-hydroxycytidine (ISO) N-acetyl-beta-D-glucosamine (EXP) N-acetyl-D-glucosamine (EXP) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) nicotine (EXP) nitrates (ISO) ochratoxin A (ISO) oxaliplatin (ISO) oxycodone (ISO) ozone (ISO) paclitaxel (EXP) palbociclib (EXP) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pinosylvin (EXP) piperonyl butoxide (ISO) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) propiconazole (ISO) Propiverine (ISO) prostaglandin A1 (ISO) quercetin (EXP) rac-lactic acid (EXP) resveratrol (ISO) rotenone (ISO) Salinomycin (EXP) selenium atom (EXP) silicon dioxide (EXP) sodium arsenite (EXP,ISO) sodium chloride (EXP) sodium fluoride (ISO) sulfadimethoxine (ISO) sulfasalazine (ISO) sunitinib (EXP) T-2 toxin (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thapsigargin (EXP) thioacetamide (ISO) thiram (EXP) titanium dioxide (EXP,ISO) topotecan (ISO) trans-pinosylvin (EXP) triadimefon (ISO) Tributyltin oxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) tris(2-butoxyethyl) phosphate (EXP) trovafloxacin (ISO) tunicamycin (EXP) urethane (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vincaleukoblastine (ISO) vinclozolin (ISO) vincristine (EXP,ISO) vitamin E (EXP) warfarin (ISO) withaferin A (EXP) zearalenone (ISO) zoledronic acid (EXP)
Cellular Component
azurophil granule lumen (TAS) cell body (IDA) cytoplasm (IBA,IDA,IEA) cytoplasmic ribonucleoprotein granule (IDA) cytoskeleton (IEA,TAS) cytosol (TAS) extracellular exosome (HDA) extracellular region (TAS) intercellular bridge (IDA,IEA) membrane raft (IEA) microtubule (IBA,IDA,IEA,TAS) microtubule cytoskeleton (IDA) mitotic spindle (IDA,IEA) nuclear envelope lumen (IDA) nucleus (HDA,IEA) protein-containing complex (IEA,ISO)
TUBB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,720,352 - 30,725,422 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,717,435 - 30,725,538 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,688,129 - 30,693,199 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,796,136 - 30,801,178 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 32,286,289 - 32,291,331 (+) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 30,488,105 - 30,493,147 (+) NCBI HuRef CHM1_1 6 30,690,286 - 30,695,330 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI T2T-CHM13v2.0
Tubb5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 36,144,812 - 36,149,193 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 36,144,813 - 36,149,198 (-) Ensembl GRCm39 Ensembl GRCm38 17 35,833,920 - 35,838,301 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,833,921 - 35,838,306 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,970,865 - 35,975,246 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 35,442,858 - 35,446,260 (-) NCBI MGSCv36 mm8 Celera 17 39,343,980 - 39,348,363 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.7 NCBI
Tubb5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 2,917,577 - 2,921,726 (+) NCBI GRCr8 mRatBN7.2 20 2,912,779 - 2,916,928 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 2,912,778 - 2,916,940 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 2,964,208 - 2,968,352 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 2,969,189 - 2,973,333 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 2,995,550 - 2,999,694 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 3,422,448 - 3,426,420 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 3,422,461 - 3,426,371 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 5,519,551 - 5,523,476 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,060,224 - 3,090,776 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,060,491 - 3,065,012 (+) NCBI Celera 20 338,700 - 342,843 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
Tubb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955583 704,750 - 718,649 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955583 704,811 - 715,742 (+) NCBI ChiLan1.0 ChiLan1.0
TUBB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 45,280,026 - 45,285,423 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 41,243,801 - 41,248,269 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 30,465,367 - 30,470,451 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 31,333,985 - 31,339,739 (+) NCBI panpan1.1 PanPan1.1 panPan2
TUBB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 512,738 - 517,154 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 650,056 - 654,417 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 655,875 - 660,238 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 655,834 - 693,258 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 513,860 - 518,216 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 582,704 - 587,060 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 651,287 - 655,647 (+) NCBI UU_Cfam_GSD_1.0
Tubb
TUBB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 23,247,736 - 23,252,240 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 23,247,827 - 23,252,240 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 26,969,793 - 26,974,207 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TUBB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 41,728,103 - 41,733,206 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 41,729,143 - 41,733,243 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 30,417,844 - 30,423,077 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tubb
.
Predicted Target Of
Count of predictions: 2591 Count of miRNA genes: 577 Interacting mature miRNAs: 626 Transcripts: ENST00000327892, ENST00000330914, ENST00000396384, ENST00000396389, ENST00000435534 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1358854 MULTSCL4_H Multiple sclerosis susceptibility QTL 4 (human) Multiple sclerosis susceptibility 6 6911960 32911960 Human 1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597218507 GWAS1314581_H BMI-adjusted waist-hip ratio QTL GWAS1314581 (human) 1e-08 body size trait (VT:0100005) 6 30720650 30720651 Human 597247277 GWAS1343351_H BMI-adjusted waist-hip ratio QTL GWAS1343351 (human) 3e-08 body size trait (VT:0100005) 6 30720650 30720651 Human 1643377 BW325_H Body weight QTL 325 (human) 2.32 0.0005 Body fat amount 6 6911960 32911960 Human 1643569 GLUCO21_H Glucose level QTL 21 (human) 0.021 Glucose level non-insulin-dependent 6 6911960 32911960 Human 1298458 BW9_H Body weight QTL 9 (human) 2.7 0.0002 Body fat amount 6 6911960 32911960 Human 597205505 GWAS1301579_H handedness QTL GWAS1301579 (human) 6e-25 handedness 6 30720650 30720651 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1643399 BMD5_H Bone mineral density QTL 5 (human) 2.32 0.0005 Bone mineral density 6 6911960 32911960 Human
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2434
2788
2247
4963
1723
2347
5
622
1949
464
2269
7292
6462
52
3725
851
1740
1613
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000327892 ⟹ ENSP00000339001
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,720,352 - 30,725,422 (+) Ensembl
Ensembl Acc Id:
ENST00000330914 ⟹ ENSP00000365578
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,721,574 - 30,725,426 (+) Ensembl
Ensembl Acc Id:
ENST00000396384 ⟹ ENSP00000379668
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,721,699 - 30,725,426 (+) Ensembl
Ensembl Acc Id:
ENST00000396389 ⟹ ENSP00000379672
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,721,667 - 30,725,426 (+) Ensembl
Ensembl Acc Id:
ENST00000680530
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,721,618 - 30,725,409 (+) Ensembl
Ensembl Acc Id:
ENST00000681421
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,721,686 - 30,725,408 (+) Ensembl
Ensembl Acc Id:
ENST00000681435 ⟹ ENSP00000506665
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,717,435 - 30,725,538 (+) Ensembl
RefSeq Acc Id:
NM_001293212 ⟹ NP_001280141
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,721,638 - 30,725,422 (+) NCBI CHM1_1 6 30,691,455 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,585,840 - 30,589,624 (+) NCBI
Sequence:
AGACCCCCAGCCTTTTGTGCGCCGCGCGGTGGGGCGGTGCCCAGCTTGGGGGAAGGAGAGCGGCGCTTATCGAAGTGTGGTCGACCTCCATCCGCCCACCGAGCACTTGGGACCCGCTGCACATATCC
hide sequence
RefSeq Acc Id:
NM_001293213 ⟹ NP_001280142
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,720,352 - 30,725,422 (+) NCBI CHM1_1 6 30,690,107 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI
Sequence:
CTCTCAGAACCTTCCTGCCGTCGCGTTTGCACCTCGCTGCTCCAGCCTCTGGGGCGCATTCCAACCTTCCAGCCTGCGACCTGCGGAGAAAAAAAATTACTTATTTTCTTGCCCCATACATACCTTGA
hide sequence
RefSeq Acc Id:
NM_001293214 ⟹ NP_001280143
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,720,352 - 30,725,422 (+) NCBI CHM1_1 6 30,690,107 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI
Sequence:
CTCTCAGAACCTTCCTGCCGTCGCGTTTGCACCTCGCTGCTCCAGCCTCTGGGGCGCATTCCAACCTTCCAGCCTGCGACCTGCGGAGAAAAAAAATTACTTATTTTCTTGCCCCATACATACCTTGA
hide sequence
RefSeq Acc Id:
NM_001293215 ⟹ NP_001280144
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,721,638 - 30,725,422 (+) NCBI CHM1_1 6 30,691,455 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,585,840 - 30,589,624 (+) NCBI
Sequence:
AGACCCCCAGCCTTTTGTGCGCCGCGCGGTGGGGCGGTGCCCAGCTTGGGGGAAGGAGAGCGGCGCTTATCGAAGTGTGGTCGACCTCCATCCGCCCACCGAGCACTTGGGACCCGCTGCACATATCC
hide sequence
RefSeq Acc Id:
NM_001293216 ⟹ NP_001280145
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,721,638 - 30,725,422 (+) NCBI CHM1_1 6 30,691,455 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,585,840 - 30,589,624 (+) NCBI
Sequence:
AGACCCCCAGCCTTTTGTGCGCCGCGCGGTGGGGCGGTGCCCAGCTTGGGGGAAGGAGAGCGGC
hide sequence
RefSeq Acc Id:
NM_178014 ⟹ NP_821133
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,720,352 - 30,725,422 (+) NCBI GRCh37 6 30,688,012 - 30,693,199 (+) NCBI Build 36 6 30,796,136 - 30,801,178 (+) NCBI Archive HuRef 6 30,488,105 - 30,493,147 (+) ENTREZGENE CHM1_1 6 30,690,107 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI
Sequence:
CTCTCAGAACCTTCCTGCCGTCGCGTTTGCACCTCGCTGCTCCAGCCTCTGGGGCGCATTCCAACCTTCCAGCCTGCGACCTGCGGAGAAAAAAAATTACTTATTTTCTTGCCCCATACATACCTTGA
hide sequence
RefSeq Acc Id:
NR_120608
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,720,352 - 30,725,422 (+) NCBI CHM1_1 6 30,690,107 - 30,695,334 (+) NCBI T2T-CHM13v2.0 6 30,584,554 - 30,589,624 (+) NCBI
Sequence:
CTCTCAGAACCTTCCTGCCGTCGCGTTTGCACCTCGCTGCTCCAGCCTCTGGGGCGCATTCCAACCTTCCAGCCTGCGACCTGCGGAGAAAAAAAATTACTTATTTTCTTGCCCCATACATACCTTGA
hide sequence
RefSeq Acc Id:
NP_821133 ⟸ NM_178014
- Peptide Label:
isoform b
- UniProtKB:
Q8WUC1 (UniProtKB/Swiss-Prot), P05218 (UniProtKB/Swiss-Prot), Q9CY33 (UniProtKB/Swiss-Prot), P07437 (UniProtKB/Swiss-Prot), Q5SU16 (UniProtKB/TrEMBL), A0A384NYT8 (UniProtKB/TrEMBL)
- Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCD
hide sequence
RefSeq Acc Id:
NP_001280142 ⟸ NM_001293213
- Peptide Label:
isoform c
- UniProtKB:
B4DMJ5 (UniProtKB/TrEMBL)
- Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAI
hide sequence
RefSeq Acc Id:
NP_001280143 ⟸ NM_001293214
- Peptide Label:
isoform d
- UniProtKB:
B7ZAK1 (UniProtKB/TrEMBL)
- Sequence:
MREIVHIQAGQCGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE
hide sequence
RefSeq Acc Id:
NP_001280141 ⟸ NM_001293212
- Peptide Label:
isoform a
- UniProtKB:
B4DY90 (UniProtKB/TrEMBL)
- Sequence:
MGDVGPRWANWDPSRSGVRDHPGQQSETLPHATFLQKIKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTE
hide sequence
RefSeq Acc Id:
NP_001280144 ⟸ NM_001293215
- Peptide Label:
isoform e
- UniProtKB:
Q5ST81 (UniProtKB/TrEMBL), B7ZAK1 (UniProtKB/TrEMBL)
- Sequence:
MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
hide sequence
RefSeq Acc Id:
NP_001280145 ⟸ NM_001293216
- Peptide Label:
isoform e
- UniProtKB:
Q5ST81 (UniProtKB/TrEMBL), B7ZAK1 (UniProtKB/TrEMBL)
- Sequence:
MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
hide sequence
Ensembl Acc Id:
ENSP00000365578 ⟸ ENST00000330914
Ensembl Acc Id:
ENSP00000339001 ⟸ ENST00000327892
Ensembl Acc Id:
ENSP00000379672 ⟸ ENST00000396389
Ensembl Acc Id:
ENSP00000379668 ⟸ ENST00000396384
Ensembl Acc Id:
ENSP00000506665 ⟸ ENST00000681435
RGD ID: 6872418 Promoter ID: EPDNEW_H9374 Type: initiation region Name: TUBB_1 Description: tubulin beta class I SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 30,720,352 - 30,720,412 EPDNEW
RGD ID: 6804912 Promoter ID: HG_KWN:52855 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000076074, UC003NRK.1 Position: Human Assembly Chr Position (strand) Source Build 36 6 30,795,181 - 30,796,207 (+) MPROMDB
RGD ID: 6804116 Promoter ID: HG_KWN:52856 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000330914, ENST00000396384, ENST00000396389 Position: Human Assembly Chr Position (strand) Source Build 36 6 30,796,791 - 30,797,442 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-22
TUBB
tubulin beta class I
tubulin, beta class I
Symbol and/or name change
5135510 APPROVED
2011-10-18
TUBB
tubulin, beta class I
TUBB
tubulin, beta
Symbol and/or name change
5135510 APPROVED
