Advanced Search (OLGA)

Gene: Mogat3 (monoacylglycerol O-acyltransferase 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mogat3

Name:

monoacylglycerol O-acyltransferase 3

RGD ID:

1592588

Description:

Predicted to enable 2-acylglycerol O-acyltransferase activity and diacylglycerol O-acyltransferase activity. Predicted to be involved in monoacylglycerol biosynthetic process and triglyceride biosynthetic process. Predicted to be located in perinuclear endoplasmic reticulum membrane. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human MOGAT3 (monoacylglycerol O-acyltransferase 3); INTERACTS WITH 17beta-estradiol; bisphenol A; 2,3,7,8-tetrachlorodibenzodioxine (ortholog).

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

2-acylglycerol O-acyltransferase 3; LOC685560; putative diacylglycerol O-acyltransferase 2-like protein DGAT2L7P; similar to monoacylglycerol O-acyltransferase 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MOGAT3 (monoacylglycerol O-acyltransferase 3)	HGNC	EggNOG
Mus musculus (house mouse):	Gm7284 (predicted gene 7284)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mogat3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MOGAT3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MOGAT3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mogat3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MOGAT3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mogat3 (monoacylglycerol O-acyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MOGAT2 (monoacylglycerol O-acyltransferase 2)	HGNC	Treefam
Homo sapiens (human):	DGAT2L7P (diacylglycerol O-acyltransferase 2 like 7, pseudogene)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	MOGAT3 (monoacylglycerol O-acyltransferase 3)	Alliance	DIOPT (HGNC)
Homo sapiens (human):	DGAT2L7P (diacylglycerol O-acyltransferase 2 like 7, pseudogene)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	mogat3a (monoacylglycerol O-acyltransferase 3a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG1941	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DGA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K07B1.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y53G8B.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	dgat-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	dgtr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1946	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dgat2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mogat2.1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	25,305,390 - 25,307,024 (-)	NCBI		GRCr8
mRatBN7.2	12	19,668,703 - 19,669,420 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,668,788 - 19,670,754 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	12	22,708,622 - 22,710,787 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,708,708 - 22,710,674 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	24,720,558 - 24,723,065 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	20,872,588 - 20,874,639 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	21,444,653 - 21,446,820 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mogat3	Rat	Plasminogen Activator Inhibitor-1 Deficiency		ISO	MOGAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: HYPERFIBRINOLYSIS DUE TO PAI1 DEFICIENCY	ClinVar	PMID:21681106
Mogat3	Rat	pleomorphic xanthoastrocytoma		ISO	MOGAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mogat3	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of MOGAT3 mRNA and Estradiol results in increased expression of MOGAT3 protein	CTD	PMID:32145629
Mogat3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of MOGAT3 mRNA	CTD	PMID:20106945 and PMID:21632981
Mogat3	Rat	benzo[a]pyrene	affects methylation	ISO	MOGAT3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of MOGAT3 promoter	CTD	PMID:27901495
Mogat3	Rat	benzo[a]pyrene	decreases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of MOGAT3 mRNA	CTD	PMID:32234424
Mogat3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MOGAT3 mRNA	CTD	PMID:25181051
Mogat3	Rat	bisphenol A	multiple interactions	ISO	MOGAT3 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of MOGAT3 gene	CTD	PMID:31601247
Mogat3	Rat	bisphenol A	decreases methylation	ISO	MOGAT3 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of MOGAT3 gene	CTD	PMID:31601247
Mogat3	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of MOGAT3 mRNA	CTD	PMID:32145629
Mogat3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MOGAT3 protein	CTD	PMID:32145629
Mogat3	Rat	cyclosporin A	decreases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of MOGAT3 mRNA	CTD	PMID:20106945
Mogat3	Rat	dicrotophos	increases expression	ISO	MOGAT3 (Homo sapiens)	6480464	dicrotophos results in increased expression of MOGAT3 mRNA	CTD	PMID:28302478
Mogat3	Rat	disodium selenite	decreases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of MOGAT3 mRNA	CTD	PMID:18175754
Mogat3	Rat	formaldehyde	increases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Formaldehyde results in increased expression of MOGAT3 mRNA	CTD	PMID:27905399
Mogat3	Rat	fulvestrant	multiple interactions	ISO	MOGAT3 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of MOGAT3 gene	CTD	PMID:31601247
Mogat3	Rat	perfluorononanoic acid	decreases expression	ISO	MOGAT3 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of MOGAT3 mRNA	CTD	PMID:32588087
Mogat3	Rat	resveratrol	multiple interactions	ISO	MOGAT3 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of MOGAT3 mRNA	CTD	PMID:23557933
Mogat3	Rat	sodium arsenite	increases expression	ISO	MOGAT3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of MOGAT3 mRNA	CTD	PMID:25879800
Mogat3	Rat	tris(2-butoxyethyl) phosphate	affects expression	ISO	MOGAT3 (Homo sapiens)	6480464	tris(2-butoxyethyl) phosphate affects the expression of MOGAT3 mRNA	CTD	PMID:29024780
Mogat3	Rat	urethane	decreases expression	ISO	MOGAT3 (Homo sapiens)	6480464	Urethane results in decreased expression of MOGAT3 mRNA	CTD	PMID:28818685
Mogat3	Rat	valproic acid	increases methylation	ISO	MOGAT3 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of MOGAT3 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mogat3	Rat	lipid metabolic process	involved_in	IEA	ARBA:ARBA00028591	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Mogat3	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mogat3	Rat	monoacylglycerol biosynthetic process	involved_in	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:28420705	RGD	PMID:28420705
Mogat3	Rat	triglyceride biosynthetic process	involved_in	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:27184406	RGD	PMID:27184406
Mogat3	Rat	triglyceride biosynthetic process	involved_in	IBA	MGI:1915050 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mogat3	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mogat3	Rat	endoplasmic reticulum membrane	located_in	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:27184406	RGD	PMID:27184406
Mogat3	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mogat3	Rat	endoplasmic reticulum membrane	is_active_in	IBA	MGI:1915050 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mogat3	Rat	endoplasmic reticulum membrane	located_in	IEA	UniRule:UR000121046	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mogat3	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mogat3	Rat	perinuclear endoplasmic reticulum membrane	located_in	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:27184406	RGD	PMID:27184406

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mogat3	Rat	2-acylglycerol O-acyltransferase activity	enables	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:27184406	RGD	PMID:27184406
Mogat3	Rat	acyltransferase activity	enables	IEA	UniProtKB-KW:KW-0012	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mogat3	Rat	diacylglycerol O-acyltransferase activity	enables	ISO	MOGAT3 (Homo sapiens)	1624291	PMID:27184406	RGD	PMID:27184406
Mogat3	Rat	diacylglycerol O-acyltransferase activity	enables	IBA	MGI:1915050 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mogat3	Rat	O-acyltransferase activity	enables	IEA	InterPro:IPR007130	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mogat3	Rat	O-acyltransferase activity	enables	IEA	ARBA:ARBA00026809	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Mogat3	Rat	protein binding	enables	ISO	MOGAT3 (Homo sapiens) and UniProtKB:Q86VF5-3	1624291	UniProtKB:G5E9A7 more ...	RGD	PMID:32814053
Mogat3	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

BioCyc Pathways

monoacylglycerol metabolism (yeast)

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:27184406	PMID:28420705

Mogat3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	25,305,390 - 25,307,024 (-)	NCBI		GRCr8
mRatBN7.2	12	19,668,703 - 19,669,420 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,668,788 - 19,670,754 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	12	22,708,622 - 22,710,787 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,708,708 - 22,710,674 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	24,720,558 - 24,723,065 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	20,872,588 - 20,874,639 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	21,444,653 - 21,446,820 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

MOGAT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	101,192,886 - 101,201,036 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	101,195,007 - 101,201,038 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	100,838,288 - 100,844,317 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	100,625,730 - 100,631,022 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	100,432,448 - 100,437,737	NCBI
Celera	7	95,848,167 - 95,853,457 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	95,431,875 - 95,437,162 (-)	NCBI		HuRef
CHM1_1	7	100,769,415 - 100,774,706 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	102,516,352 - 102,524,499 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	100,197,397 - 100,202,689 (-)	NCBI

Gm7284
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	137,026,816 - 137,028,306 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	137,026,240 - 137,028,148 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	136,997,962 - 136,999,452 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	136,997,386 - 136,999,294 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	137,475,893 - 137,481,417 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	137,473,104 - 137,478,875 (+)	NCBI		MGSCv36	mm8
Celera	5	134,013,961 - 134,021,617 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.1	NCBI

Mogat3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955456	16,090,859 - 16,094,736 (+)	NCBI	ChiLan1.0	ChiLan1.0

MOGAT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	119,208,724 - 119,214,679 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	167,470,084 - 167,479,290 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	93,337,040 - 93,342,822 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	106,577,727 - 106,582,799 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	106,577,727 - 106,582,799 (-)	Ensembl	panpan1.1		panPan2

MOGAT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	8,675,453 - 8,679,722 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	8,675,504 - 8,679,113 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	10,372,760 - 10,376,481 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	8,494,923 - 8,498,640 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	8,494,958 - 8,500,926 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	8,455,108 - 8,458,822 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	8,425,738 - 8,429,459 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	8,590,338 - 8,594,064 (+)	NCBI		UU_Cfam_GSD_1.0

Mogat3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	132,950,074 - 132,953,614 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	1,082,785 - 1,086,979 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	1,082,916 - 1,085,904 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MOGAT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	11,984,701 - 11,990,713 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	11,985,186 - 11,990,566 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	4,364,512 - 4,370,213 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mogat3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624740	16,084,621 - 16,087,331 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mogat3
11 total Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
12	22709055	22709056	T	C	snv	Buf/N (MCW), WN/N (MCW)	View more Information
12	22709828	22709829	C	T	snv	WN/N (MCW), Buf/N (MCW)	View more Information
12	22710195	22710196	C	T	snv	WN/N (MCW), Buf/N (MCW)	View more Information

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	15025183	20794014	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

RH132750

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	25,305,509 - 25,305,900 (+)	Marker Load Pipeline
mRatBN7.2	12	19,668,822 - 19,669,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	22,708,743 - 22,709,133	NCBI	Rnor6.0
Rnor_5.0	12	24,721,024 - 24,721,414	UniSTS	Rnor5.0
RGSC_v3.4	12	20,874,129 - 20,874,519	UniSTS	RGSC3.4
Celera	12	21,444,775 - 21,445,165	UniSTS
RH 3.4 Map	12	277.5	UniSTS
Cytogenetic Map	12	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	2	14	85	56	56	39	8	39	6	117	32	71	37	51	17


RefSeq Transcripts	XM_001064308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003752601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050456 ⟹ ENSRNOP00000046989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	19,668,788 - 19,670,754 (-)	Ensembl
Rnor_6.0 Ensembl	12	22,708,708 - 22,710,674 (-)	Ensembl

RefSeq Acc Id:

XM_001064308 ⟹ XP_001064308

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,305,390 - 25,307,024 (-)	NCBI
mRatBN7.2	12	19,668,703 - 19,669,420 (-)	NCBI
Rnor_6.0	12	22,708,622 - 22,710,787 (-)	NCBI
Rnor_5.0	12	24,720,558 - 24,723,065 (-)	NCBI
RGSC_v3.4	12	20,872,588 - 20,874,639 (+)	RGD

Sequence:

show sequence

GGGGCAGAGGTGGGGGTGGGCCTGGGCCTCAGGGTCAAAGTCAGAGGATTGAGTTAAGAGGGGGTGTGTGTACTTAGGCTGTGGGTTGCTAGTGTGTGACTCCCCTCTAAAGCATGGAAGTCCCCTCC
AGCCCCCTGCATCGGAGTCTTCAAGTGTTTGCTGTGCTTCAGTGGGTCTTTTCCTTCTTGGGACTTGCCCTGCTGTGCCTGGTGACATTGATTCTAGCCTCCCTAGGCCGAGCTTGGACTCTTGTGGT
CCTCTACCTGCTCTGGCTCTATCAAGACAGACACACACCCAGGATGGGGGGTCGCCGGTCTGCCTGGGTCCGCAACTGGGCAGTCTGGAGGTATTTCCGAGACTACTTTCCCATCAAGCTCGTTAAAA
CGGCCGAGTTGGATCCGTCTCAAAACTACCTTTTCGGTTTTCATCCTCACGGGGTCCTGGTTGTTGGGGCGTTCAGCAACTTCTGTACAGAGGCCACAGGCTTCTCCCACCTCTTTCCGGGTCTCAAG
CCACATTTACTCATGCTGCCATGTTGGTTCCAAGTGCCTCTCTTCCGAGATTACATTATGACCAGTGGTTTAGTCTCTTCTGACAAAGCCAGCACTTCCTATCTCTTGTCCCACCCTGAGGGCGGCCG
GGTGGCCGTTCTGGCTGTGGGAGGTCCCCTGGAGGCTTTGGAGGCAAAGCCTGGAACAGTGAGTTTGCGGCTCCGGAATCAGAAAGGATTCGTTAAATTATCACTGGAACACGGGGCCTCGCTTGTGC
CTGTCTTCTCCTTTGGAGAGAATGACCTCTTCCAGCAGTTTCCCAATCCGCCAGGCTCCTGGGTACGGAGGATGCAGGAGGCACTTCAGAGGATACTGAGTGTGGCCCTGCCTCTCTTCCATGGTCGC
CTGGGTCTCCTGATTCCCTTCCGTGTGCCCATCCATACTGTCGTGGGCGCCCCAATTCCAGTGCAGCGAAGCCCGAGGCCCACCCGGGAACAGGTGAACCGGTTGCACGAGTTATATGTAGAGCGTCT
CACACAGCTGTTCGAGGAACACAAGATGCGCTATGGGGTCCCTGCTGATCAACACCTTGTATTCATCTAGGCACGTCCATATCGCCATGTCCTGGCCTTCCTGAGAGACTGCAGAGATGTGACTGGGG
AGATGATTAAAAGTGGGAGCAGACCAAG

hide sequence


Protein RefSeqs	XP_001064308	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000046989.4

RefSeq Acc Id:

XP_001064308 ⟸ XM_001064308

- Sequence:

show sequence

MEVPSSPLHRSLQVFAVLQWVFSFLGLALLCLVTLILASLGRAWTLVVLYLLWLYQDRHTPRMGGRRSAWVRNWAVWRYFRDYFPIKLVKTAELDPSQNYLFGFHPHGVLVVGAFSNFCTEATGFSHL
FPGLKPHLLMLPCWFQVPLFRDYIMTSGLVSSDKASTSYLLSHPEGGRVAVLAVGGPLEALEAKPGTVSLRLRNQKGFVKLSLEHGASLVPVFSFGENDLFQQFPNPPGSWVRRMQEALQRILSVALP
LFHGRLGLLIPFRVPIHTVVGAPIPVQRSPRPTREQVNRLHELYVERLTQLFEEHKMRYGVPADQHLVFI

hide sequence

Ensembl Acc Id:

ENSRNOP00000046989 ⟸ ENSRNOT00000050456

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LT39-F1-model_v2	AlphaFold	F1LT39	1-326	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-19675	BioCyc
BioCyc Pathway	PWY-7420 [monoacylglycerol metabolism (yeast)]	BioCyc
BioCyc Pathway Image	PWY-7420	BioCyc
Ensembl Genes	ENSRNOG00000029211	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050456.5	UniProtKB/TrEMBL
InterPro	DAGAT	UniProtKB/TrEMBL
KEGG Report	rno:685560	UniProtKB/TrEMBL
NCBI Gene	685560	ENTREZGENE
PANTHER	ACYLTRANSFERASE	UniProtKB/TrEMBL
	DIACYLGLYCEROL O-ACYLTRANSFERASE	UniProtKB/TrEMBL
Pfam	DAGAT	UniProtKB/TrEMBL
PhenoGen	Mogat3	PhenoGen
RatGTEx	ENSRNOG00000029211	RatGTEx
UniProt	F1LT39_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-11-04	Mogat3	monoacylglycerol O-acyltransferase 3	LOC685560	similar to monoacylglycerol O-acyltransferase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC685560	similar to monoacylglycerol O-acyltransferase 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

BioCyc Pathways