Symbol:
Ervfrd-1
Name:
endogenous retrovirus group FRD member 1, envelope
RGD ID:
1563240
Description:
Predicted to be involved in syncytium formation by plasma membrane fusion. Predicted to act upstream of or within labyrinthine layer development and myoblast fusion. Predicted to be located in membrane. Orthologous to human ERVFRD-1 (endogenous retrovirus group FRD member 1, envelope); INTERACTS WITH 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
endogenous retrovirus group FRD member 1; envelope glycoprotein syncytin-A; Gm52; Syna; syncytin a
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,787,680 - 27,794,732 (+) NCBI GRCr8 mRatBN7.2 12 22,151,211 - 22,158,264 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 22,151,211 - 22,158,264 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 23,294,443 - 23,301,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,905,524 - 23,912,428 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,972,115 - 22,979,027 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 25,161,130 - 25,168,182 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 25,161,130 - 25,168,182 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 27,161,524 - 27,168,576 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 23,220,471 - 23,222,327 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 23,915,041 - 23,922,023 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ervfrd-1 Rat (25R)-cholest-5-ene-3beta,26-diol decreases expression ISO RGD:1606632 6480464 27-hydroxycholesterol results in decreased expression of ERVFRD-1 protein CTD PMID:38180513 Ervfrd-1 Rat (25R)-cholest-5-ene-3beta,26-diol multiple interactions ISO RGD:1606632 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of ERVFRD-1 protein] CTD PMID:38180513 Ervfrd-1 Rat 1,2-dichloroethane increases expression ISO RGD:1615713 6480464 ethylene dichloride results in increased expression of SYNA mRNA CTD PMID:28960355 Ervfrd-1 Rat 17beta-estradiol increases expression ISO RGD:1606632 6480464 Estradiol results in increased expression of ERVFRD-1 mRNA CTD PMID:31278978 Ervfrd-1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1606632 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ERVFRD-1 protein CTD PMID:31675489 Ervfrd-1 Rat 2,4,6-tribromophenol increases expression ISO RGD:1606632 6480464 2,4,6-tribromophenol results in increased expression of ERVFRD-1 mRNA CTD PMID:31675489 Ervfrd-1 Rat 2-hydroxypropanoic acid increases expression ISO RGD:1606632 6480464 Lactic Acid results in increased expression of ERVFRD-1 mRNA CTD PMID:30851411 Ervfrd-1 Rat 26-hydroxycholesterol multiple interactions ISO RGD:1606632 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of ERVFRD-1 protein] CTD PMID:38180513 Ervfrd-1 Rat 26-hydroxycholesterol decreases expression ISO RGD:1606632 6480464 27-hydroxycholesterol results in decreased expression of ERVFRD-1 protein CTD PMID:38180513 Ervfrd-1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1606632 6480464 tetrabromobisphenol A results in increased expression of ERVFRD-1 protein CTD PMID:31675489 Ervfrd-1 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ERVFRD-1 mRNA CTD PMID:23358152 Ervfrd-1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SYNA mRNA CTD PMID:25825206 Ervfrd-1 Rat all-trans-retinoic acid multiple interactions ISO RGD:1615713 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SYNA mRNA CTD PMID:36189433 Ervfrd-1 Rat alpha-naphthoflavone multiple interactions ISO RGD:1606632 6480464 alpha-naphthoflavone inhibits the reaction [Benzo(a)pyrene results in increased expression of ERVFRD-1 mRNA] CTD PMID:24361490 Ervfrd-1 Rat AM-251 multiple interactions ISO RGD:1606632 6480464 AM 251 affects the reaction [Dronabinol results in decreased expression of ERVFRD-1 mRNA] CTD PMID:26070387 Ervfrd-1 Rat anandamide decreases expression ISO RGD:1606632 6480464 anandamide results in decreased expression of ERVFRD-1 mRNA CTD PMID:30610963 Ervfrd-1 Rat benzo[a]pyrene increases expression ISO RGD:1606632 6480464 Benzo(a)pyrene results in increased expression of ERVFRD-1 mRNA CTD PMID:24361490 Ervfrd-1 Rat benzo[a]pyrene multiple interactions ISO RGD:1606632 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Benzo(a)pyrene results in increased expression of ERVFRD-1 mRNA]; AHR more ... CTD PMID:24361490 Ervfrd-1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1606632 6480464 Diethylhexyl Phthalate results in increased expression of ERVFRD-1 mRNA CTD PMID:31163220 Ervfrd-1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1615713 6480464 Diethylhexyl Phthalate results in increased expression of SYNA mRNA CTD PMID:34319233 Ervfrd-1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ERVFRD-1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:25181051 Ervfrd-1 Rat bisphenol A decreases expression ISO RGD:1606632 6480464 bisphenol A results in decreased expression of ERVFRD-1 protein CTD PMID:31675489 Ervfrd-1 Rat bisphenol A increases expression ISO RGD:1606632 6480464 bisphenol A results in increased expression of ERVFRD-1 mRNA; bisphenol A results in increased expression more ... CTD PMID:31278978 Ervfrd-1 Rat bisphenol A decreases methylation ISO RGD:1615713 6480464 bisphenol A results in decreased methylation of SYNA promoter CTD PMID:27312807 Ervfrd-1 Rat cadmium atom multiple interactions ISO RGD:1606632 6480464 [Cadmium Chloride results in increased abundance of Cadmium] inhibits the reaction [Colforsin results in increased more ... CTD PMID:35301059|PMID:35908931 Ervfrd-1 Rat cadmium dichloride multiple interactions ISO RGD:1606632 6480464 [Cadmium Chloride results in increased abundance of Cadmium] inhibits the reaction [Colforsin results in increased more ... CTD PMID:35301059|PMID:35908931 Ervfrd-1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SYNA mRNA CTD PMID:20691718 Ervfrd-1 Rat cisplatin affects response to substance ISO RGD:1606632 6480464 ERVFRD-1 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Ervfrd-1 Rat colforsin daropate hydrochloride increases secretion ISO RGD:1606632 6480464 Colforsin results in increased secretion of ERVFRD-1 protein CTD PMID:24361490 Ervfrd-1 Rat colforsin daropate hydrochloride increases expression ISO RGD:1606632 6480464 Colforsin results in increased expression of ERVFRD-1 mRNA; Colforsin results in increased expression of ERVFRD-1 more ... CTD PMID:29679653|PMID:31278978|PMID:33144174|PMID:35908931|PMID:36336211|PMID:37385477|PMID:38296531 Ervfrd-1 Rat colforsin daropate hydrochloride multiple interactions ISO RGD:1606632 6480464 [Cadmium Chloride results in increased abundance of Cadmium] inhibits the reaction [Colforsin results in increased more ... CTD PMID:24361490|PMID:35908931|PMID:37385477 Ervfrd-1 Rat dichloroacetic acid increases expression ISO RGD:1615713 6480464 Dichloroacetic Acid results in increased expression of SYNA mRNA CTD PMID:28962523 Ervfrd-1 Rat diisononyl phthalate decreases expression ISO RGD:1615713 6480464 diisononyl phthalate results in decreased expression of SYNA mRNA CTD PMID:37482143 Ervfrd-1 Rat dimethylarsinic acid multiple interactions ISO RGD:1615713 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Ervfrd-1 Rat ethylparaben decreases expression ISO RGD:1606632 6480464 ethyl-p-hydroxybenzoate results in decreased expression of ERVFRD-1 mRNA CTD PMID:37690743 Ervfrd-1 Rat etoposide affects response to substance ISO RGD:1606632 6480464 ERVFRD-1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Ervfrd-1 Rat fonofos decreases methylation ISO RGD:1606632 6480464 Fonofos results in decreased methylation of ERVFRD-1 promoter CTD PMID:22847954 Ervfrd-1 Rat GW 4064 increases expression ISO RGD:1615713 6480464 GW 4064 results in increased expression of SYNA mRNA CTD PMID:26655953 Ervfrd-1 Rat LY294002 multiple interactions ISO RGD:1606632 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of ERVFRD-1 protein] CTD PMID:38180513 Ervfrd-1 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ERVFRD-1 mRNA CTD PMID:23358152 Ervfrd-1 Rat methylarsonic acid multiple interactions ISO RGD:1615713 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Ervfrd-1 Rat mitomycin C affects response to substance ISO RGD:1606632 6480464 ERVFRD-1 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Ervfrd-1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1615713 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SYNA mRNA CTD PMID:36189433 Ervfrd-1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO RGD:1606632 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide affects the reaction [Colforsin results in increased expression of ERVFRD-1 mRNA] CTD PMID:35908931 Ervfrd-1 Rat parathion decreases methylation ISO RGD:1606632 6480464 Parathion results in decreased methylation of ERVFRD-1 promoter CTD PMID:22847954 Ervfrd-1 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:1615713 6480464 perfluorohexanesulfonic acid results in decreased expression of SYNA mRNA CTD PMID:37995155 Ervfrd-1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1606632 6480464 perfluorooctane sulfonic acid results in decreased expression of ERVFRD-1 mRNA CTD PMID:32790152 Ervfrd-1 Rat perfluorooctanoic acid decreases expression ISO RGD:1606632 6480464 perfluorooctanoic acid results in decreased expression of ERVFRD-1 mRNA CTD PMID:32790152 Ervfrd-1 Rat perfluorooctanoic acid increases expression ISO RGD:1606632 6480464 perfluorooctanoic acid results in increased expression of ERVFRD-1 mRNA CTD PMID:37738295 Ervfrd-1 Rat pifithrin-alpha hydrobromide multiple interactions ISO RGD:1606632 6480464 pifithrin inhibits the reaction [Benzo(a)pyrene results in increased expression of ERVFRD-1 mRNA] CTD PMID:24361490 Ervfrd-1 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of ERVFRD-1 mRNA CTD PMID:23358152 Ervfrd-1 Rat rac-lactic acid increases expression ISO RGD:1606632 6480464 Lactic Acid results in increased expression of ERVFRD-1 mRNA CTD PMID:30851411 Ervfrd-1 Rat resveratrol multiple interactions ISO RGD:1606632 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ERVFRD-1 mRNA CTD PMID:23557933 Ervfrd-1 Rat sodium arsenate multiple interactions ISO RGD:1615713 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Ervfrd-1 Rat sodium arsenite multiple interactions ISO RGD:1615713 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Ervfrd-1 Rat sodium arsenite decreases expression ISO RGD:1615713 6480464 sodium arsenite results in decreased expression of SYNA mRNA CTD PMID:37682722 Ervfrd-1 Rat terbufos decreases methylation ISO RGD:1606632 6480464 terbufos results in decreased methylation of ERVFRD-1 promoter CTD PMID:22847954 Ervfrd-1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ERVFRD-1 mRNA CTD PMID:23411599 Ervfrd-1 Rat titanium dioxide decreases expression ISO RGD:1615713 6480464 titanium dioxide results in decreased expression of SYNA mRNA CTD PMID:35295148 Ervfrd-1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ERVFRD-1 gene CTD PMID:27618143 Ervfrd-1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ERVFRD-1 mRNA CTD PMID:33387578 Ervfrd-1 Rat triptonide increases expression ISO RGD:1615713 6480464 triptonide results in increased expression of SYNA mRNA CTD PMID:33045310 Ervfrd-1 Rat valproic acid multiple interactions ISO RGD:1606632 6480464 Valproic Acid inhibits the reaction [Colforsin results in increased expression of ERVFRD-1 mRNA] CTD PMID:37385477
(25R)-cholest-5-ene-3beta,26-diol (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 26-hydroxycholesterol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,7-dihydropurine-6-thione (EXP) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) AM-251 (ISO) anandamide (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) chlorpyrifos (EXP) cisplatin (ISO) colforsin daropate hydrochloride (ISO) dichloroacetic acid (ISO) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) ethylparaben (ISO) etoposide (ISO) fonofos (ISO) GW 4064 (ISO) LY294002 (ISO) mercaptopurine (EXP) methylarsonic acid (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pifithrin-alpha hydrobromide (ISO) purine-6-thiol (EXP) rac-lactic acid (ISO) resveratrol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) terbufos (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO)
Ervfrd-1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,787,680 - 27,794,732 (+) NCBI GRCr8 mRatBN7.2 12 22,151,211 - 22,158,264 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 22,151,211 - 22,158,264 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 23,294,443 - 23,301,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,905,524 - 23,912,428 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,972,115 - 22,979,027 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 25,161,130 - 25,168,182 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 25,161,130 - 25,168,182 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 27,161,524 - 27,168,576 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 23,220,471 - 23,222,327 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 23,915,041 - 23,922,023 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
ERVFRD-1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 11,102,489 - 11,111,725 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 11,102,324 - 11,111,845 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 11,102,722 - 11,111,958 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 11,210,708 - 11,219,945 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 12,331,189 - 12,340,538 (-) NCBI Celera Cytogenetic Map 6 p24.2 NCBI HuRef 6 11,034,168 - 11,043,517 (-) NCBI HuRef CHM1_1 6 11,104,822 - 11,114,171 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 10,970,408 - 10,979,644 (-) NCBI T2T-CHM13v2.0
Syna Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 134,586,108 - 134,605,891 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 134,587,000 - 134,589,025 (-) Ensembl GRCm39 Ensembl GRCm38 5 134,557,254 - 134,577,038 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 134,558,146 - 134,560,171 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 135,034,110 - 135,035,963 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 134,842,867 - 134,844,720 (-) NCBI MGSCv36 mm8 Celera 5 131,565,945 - 131,567,798 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 74.67 NCBI
ERVFRD-1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 25,749,397 - 25,758,717 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 21,739,431 - 21,748,751 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 10,940,832 - 10,950,152 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 11,216,488 - 11,225,808 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 11,217,693 - 11,219,309 (-) Ensembl panpan1.1 panPan2
LOC119881605 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ROS_Cfam_1.0 9 18,735,394 - 18,791,155 (-) NCBI ROS_Cfam_1.0
ERVFRD-1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 61,033,479 - 61,042,781 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 61,039,949 - 61,041,559 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 11,133,315 - 11,142,617 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 127 Count of miRNA genes: 97 Interacting mature miRNAs: 114 Transcripts: ENSRNOT00000074788 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 631521 Pia12 Pristane induced arthritis QTL 12 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 20259417 23672083 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
4
30
33
41
19
18
19
2
81
29
23
23
18
22
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074788 ⟹ ENSRNOP00000067387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 22,151,211 - 22,158,264 (+) Ensembl Rnor_6.0 Ensembl 12 25,161,130 - 25,168,182 (+) Ensembl
RefSeq Acc Id:
NM_001014771 ⟹ NP_001014771
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,787,680 - 27,794,732 (+) NCBI mRatBN7.2 12 22,151,211 - 22,158,264 (+) NCBI Rnor_6.0 12 25,161,130 - 25,168,182 (+) NCBI Rnor_5.0 12 27,161,524 - 27,168,576 (+) NCBI RGSC_v3.4 12 23,220,471 - 23,222,327 (+) RGD Celera 12 23,915,041 - 23,922,023 (+) NCBI
Sequence:
ATGAACCATCATCATCCATGCTGGATGAAGCCTTTCCATCAGAGCTGCGTTGGGATCCCCCATGCCCTGTCGGTCCAGCTTCCATAAGTAGAACCGCGCAACCAGGCGCCTCCCTGACTTTCCCATCA
hide sequence
RefSeq Acc Id:
NP_001014771 ⟸ NM_001014771
- Peptide Label:
precursor
- UniProtKB:
Q5G5D4 (UniProtKB/TrEMBL)
- Sequence:
MVRPWVFCVLLFPCSSAHSDSWMPLVNLTQRLLRDANSSFSSNCWVCLSIQTQRSLAVPAPLRSWTETPMKLRIMYSARTLSGSYPITDLERRLQNFQPLTPHYSFVNPDRRAIAFLQVTSITGILPI
hide sequence
Ensembl Acc Id:
ENSRNOP00000067387 ⟸ ENSRNOT00000074788
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-04-05
Ervfrd-1
endogenous retrovirus group FRD member 1, envelope
Ervfrd-1
endogenous retrovirus group FRD member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-07-21
Ervfrd-1
endogenous retrovirus group FRD member 1
Syna
syncytin a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-10-21
Syna
syncytin a
Gm52
envelope glycoprotein syncytin-A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Gm52
envelope glycoprotein syncytin-A
Gm52_predicted
envelope glycoprotein syncytin-A (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
Gm52_predicted
envelope glycoprotein syncytin-A (predicted)
Gm52
envelope glycoprotein syncytin-A
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
Gm52
envelope glycoprotein syncytin-A
Symbol and Name status set to provisional
70820 PROVISIONAL
