Symbol:
Deptor
Name:
DEP domain containing MTOR-interacting protein
RGD ID:
1561030
Description:
Predicted to enable GTPase regulator activity; phosphatidic acid binding activity; and protein serine/threonine kinase inhibitor activity. Predicted to be involved in several processes, including negative regulation of TOR signaling; negative regulation of cell size; and negative regulation of protein kinase activity. Predicted to be active in lysosomal membrane and plasma membrane. Orthologous to human DEPTOR (DEP domain containing MTOR interacting protein); PARTICIPATES IN mTOR signaling pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DEP domain containing 6; Depdc6; hypothetical protein LOC100359815; LOC100359815; LOC102547145; LOC314979; RGD1561030; similar to DEP domain containing 6; uncharacterized LOC102547145
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 88,404,745 - 88,574,065 (+) NCBI GRCr8 mRatBN7.2 7 86,514,859 - 86,668,817 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 86,514,988 - 86,667,773 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 94,795,161 - 95,000,750 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 94,795,214 - 94,995,809 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 95,520,754 - 95,625,869 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 91,675,825 - 91,742,576 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 83,308,700 - 83,462,454 (+) NCBI Celera Cytogenetic Map 7 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Deptor Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DEPTOR mRNA] CTD PMID:31150632 Deptor Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1620688 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DEPTOR mRNA CTD PMID:36331819 Deptor Rat 1,2-dichloroethane decreases expression ISO RGD:1620688 6480464 ethylene dichloride results in decreased expression of DEPTOR mRNA CTD PMID:28189721|PMID:28960355 Deptor Rat 17alpha-ethynylestradiol affects expression ISO RGD:1344261 6480464 Ethinyl Estradiol affects the expression of DEPTOR mRNA CTD PMID:20170705 Deptor Rat 17alpha-ethynylestradiol decreases expression ISO RGD:1620688 6480464 Ethinyl Estradiol results in decreased expression of DEPTOR mRNA CTD PMID:17942748 Deptor Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1620688 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of DEPTOR mRNA CTD PMID:17942748 Deptor Rat 17alpha-ethynylestradiol affects expression ISO RGD:1620688 6480464 Ethinyl Estradiol affects the expression of DEPTOR mRNA CTD PMID:17555576 Deptor Rat 17alpha-ethynylestradiol increases expression ISO RGD:1344261 6480464 Ethinyl Estradiol results in increased expression of DEPTOR mRNA CTD PMID:18936297 Deptor Rat 17beta-estradiol increases expression ISO RGD:1344261 6480464 Estradiol results in increased expression of DEPTOR mRNA CTD PMID:19167446|PMID:19619570|PMID:23019147|PMID:25321415|PMID:31614463|PMID:33419253|PMID:36828454 Deptor Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DEPTOR mRNA CTD PMID:35192832 Deptor Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of DEPTOR mRNA CTD PMID:32145629 Deptor Rat 17beta-estradiol multiple interactions ISO RGD:1344261 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of DEPTOR mRNA CTD PMID:19619570 Deptor Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO RGD:1344261 6480464 bicalutamide inhibits the reaction [Dihydrotestosterone results in decreased expression of DEPTOR mRNA] CTD PMID:26558456 Deptor Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO RGD:1344261 6480464 Dihydrotestosterone results in decreased expression of DEPTOR mRNA; Dihydrotestosterone results in decreased expression of DEPTOR more ... CTD PMID:26558456 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1344261 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of DEPTOR mRNA; [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic more ... CTD PMID:19619570|PMID:29704546 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DEPTOR mRNA CTD PMID:33387578 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEPTOR mRNA CTD PMID:32109520 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1620688 6480464 Tetrachlorodibenzodioxin affects the expression of DEPTOR mRNA CTD PMID:26377647 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1620688 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of DEPTOR mRNA; [Tetrachlorodibenzodioxin co-treated more ... CTD PMID:16214954|PMID:17942748|PMID:25975270 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1620688 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEPTOR mRNA CTD PMID:19933214|PMID:33956508 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1344261 6480464 Tetrachlorodibenzodioxin results in increased expression of DEPTOR mRNA CTD PMID:20106945 Deptor Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1344261 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEPTOR mRNA CTD PMID:19619570 Deptor Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of DEPTOR mRNA CTD PMID:32109520 Deptor Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1620688 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of DEPTOR mRNA CTD PMID:38648751 Deptor Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:1344261 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of DEPTOR mRNA CTD PMID:29947894 Deptor Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1344261 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Deptor Rat 3-methylcholanthrene decreases expression ISO RGD:1620688 6480464 Methylcholanthrene results in decreased expression of DEPTOR mRNA CTD PMID:20713471 Deptor Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1620688 6480464 bisphenol S results in increased expression of DEPTOR mRNA CTD PMID:30951980 Deptor Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1344261 6480464 bisphenol S results in increased expression of DEPTOR mRNA CTD PMID:34831106 Deptor Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1620688 6480464 bisphenol S results in decreased expression of DEPTOR mRNA CTD PMID:39298647 Deptor Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1620688 6480464 Fenretinide results in decreased expression of DEPTOR mRNA CTD PMID:28973697 Deptor Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DEPTOR mRNA CTD PMID:24780913|PMID:25825206 Deptor Rat aflatoxin B1 affects expression ISO RGD:1344261 6480464 Aflatoxin B1 affects the expression of DEPTOR protein CTD PMID:20106945 Deptor Rat aflatoxin B1 increases expression ISO RGD:1344261 6480464 Aflatoxin B1 results in increased expression of DEPTOR mRNA CTD PMID:32234424 Deptor Rat aflatoxin B1 decreases expression ISO RGD:1620688 6480464 Aflatoxin B1 results in decreased expression of DEPTOR mRNA CTD PMID:19770486 Deptor Rat aflatoxin B1 decreases expression ISO RGD:1344261 6480464 Aflatoxin B1 results in decreased expression of DEPTOR mRNA CTD PMID:21632981|PMID:22100608|PMID:27153756 Deptor Rat all-trans-retinoic acid decreases expression ISO RGD:1344261 6480464 Tretinoin results in decreased expression of DEPTOR mRNA CTD PMID:33167477 Deptor Rat amiodarone increases expression ISO RGD:1344261 6480464 Amiodarone results in increased expression of DEPTOR mRNA CTD PMID:19774075 Deptor Rat amphotericin B decreases expression ISO RGD:1344261 6480464 Amphotericin B analog results in decreased expression of DEPTOR mRNA CTD PMID:28534445 Deptor Rat aristolochic acid A decreases expression ISO RGD:1344261 6480464 aristolochic acid I results in decreased expression of DEPTOR mRNA CTD PMID:33212167 Deptor Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of DEPTOR mRNA CTD PMID:36841081 Deptor Rat bafilomycin A1 multiple interactions EXP 6480464 bafilomycin A1 inhibits the reaction [Lidocaine results in decreased expression of [MTOR protein binds to more ... CTD PMID:37914286 Deptor Rat belinostat increases expression ISO RGD:1344261 6480464 belinostat results in increased expression of DEPTOR mRNA CTD PMID:26272509 Deptor Rat belinostat multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat benzo[a]pyrene increases expression ISO RGD:1344261 6480464 Benzo(a)pyrene results in increased expression of DEPTOR mRNA CTD PMID:20106945 Deptor Rat benzo[a]pyrene increases methylation ISO RGD:1620688 6480464 Benzo(a)pyrene results in increased methylation of DEPTOR exon; Benzo(a)pyrene results in increased methylation of DEPTOR more ... CTD PMID:27901495 Deptor Rat benzo[a]pyrene multiple interactions ISO RGD:1620688 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of DEPTOR mRNA] CTD PMID:22228805 Deptor Rat benzo[a]pyrene decreases expression ISO RGD:1620688 6480464 Benzo(a)pyrene results in decreased expression of DEPTOR mRNA CTD PMID:20713471|PMID:22228805 Deptor Rat benzo[e]pyrene increases methylation ISO RGD:1344261 6480464 benzo(e)pyrene results in increased methylation of DEPTOR intron CTD PMID:30157460 Deptor Rat bicalutamide multiple interactions ISO RGD:1344261 6480464 bicalutamide inhibits the reaction [Dihydrotestosterone results in decreased expression of DEPTOR mRNA] CTD PMID:26558456 Deptor Rat bilirubin IXalpha decreases expression ISO RGD:1344261 6480464 Bilirubin results in decreased expression of DEPTOR mRNA CTD PMID:20196124 Deptor Rat bisphenol A affects expression ISO RGD:1344261 6480464 bisphenol A affects the expression of DEPTOR mRNA CTD PMID:20170705 Deptor Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DEPTOR mRNA CTD PMID:32145629 Deptor Rat bisphenol A multiple interactions ISO RGD:1344261 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DEPTOR gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Deptor Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DEPTOR mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Deptor Rat bisphenol A increases expression ISO RGD:1344261 6480464 bisphenol A results in increased expression of DEPTOR mRNA CTD PMID:23019147|PMID:29275510|PMID:33419253|PMID:34831106|PMID:36828454 Deptor Rat bisphenol F multiple interactions ISO RGD:1344261 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Deptor Rat bisphenol F increases expression ISO RGD:1344261 6480464 bisphenol F results in increased expression of DEPTOR mRNA CTD PMID:34831106 Deptor Rat bisphenol F increases expression ISO RGD:1620688 6480464 bisphenol F results in increased expression of DEPTOR mRNA CTD PMID:30951980 Deptor Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of DEPTOR mRNA CTD PMID:24136188 Deptor Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of DEPTOR mRNA CTD PMID:33453195 Deptor Rat cadmium dichloride decreases expression ISO RGD:1344261 6480464 Cadmium Chloride results in decreased expression of DEPTOR mRNA CTD PMID:38382870 Deptor Rat cannabidiol affects expression EXP 6480464 Cannabidiol affects the expression of DEPTOR mRNA CTD PMID:38182033 Deptor Rat cannabidiol multiple interactions ISO RGD:1344261 6480464 [PSEN1 protein affects the susceptibility to Cannabidiol] which affects the expression of DEPTOR mRNA CTD PMID:33096116 Deptor Rat carbon nanotube decreases expression ISO RGD:1620688 6480464 Nanotubes, Carbon analog results in decreased expression of DEPTOR mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Deptor Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of DEPTOR mRNA CTD PMID:23125180 Deptor Rat choline multiple interactions ISO RGD:1620688 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Deptor Rat cisplatin affects response to substance ISO RGD:1344261 6480464 DEPTOR protein affects the susceptibility to Cisplatin CTD PMID:16217747 Deptor Rat cisplatin decreases expression ISO RGD:1344261 6480464 Cisplatin results in decreased expression of DEPTOR mRNA CTD PMID:27594783 Deptor Rat copper atom decreases expression ISO RGD:1620688 6480464 Copper results in decreased expression of DEPTOR mRNA CTD PMID:17205981 Deptor Rat copper(0) decreases expression ISO RGD:1620688 6480464 Copper results in decreased expression of DEPTOR mRNA CTD PMID:17205981 Deptor Rat coumestrol multiple interactions ISO RGD:1344261 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of DEPTOR mRNA; [Coumestrol co-treated with Resveratrol] more ... CTD PMID:19167446 Deptor Rat coumestrol increases expression ISO RGD:1344261 6480464 Coumestrol results in increased expression of DEPTOR mRNA CTD PMID:19167446 Deptor Rat crocidolite asbestos decreases expression ISO RGD:1344261 6480464 Asbestos, Crocidolite results in decreased expression of DEPTOR mRNA CTD PMID:25351596 Deptor Rat cyclosporin A decreases expression ISO RGD:1344261 6480464 Cyclosporine results in decreased expression of DEPTOR mRNA CTD PMID:20106945|PMID:25562108 Deptor Rat cytarabine decreases expression ISO RGD:1344261 6480464 Cytarabine results in decreased expression of DEPTOR mRNA CTD PMID:21198554 Deptor Rat deoxynivalenol decreases expression ISO RGD:1344261 6480464 deoxynivalenol results in decreased expression of DEPTOR mRNA CTD PMID:31863870 Deptor Rat dexamethasone increases expression ISO RGD:1620688 6480464 Dexamethasone results in increased expression of DEPTOR mRNA CTD PMID:22733784 Deptor Rat dexamethasone multiple interactions ISO RGD:1344261 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Deptor Rat dexamethasone increases expression ISO RGD:1344261 6480464 Dexamethasone results in increased expression of DEPTOR mRNA CTD PMID:25047013 Deptor Rat Dibutyl phosphate affects expression ISO RGD:1344261 6480464 di-n-butylphosphoric acid affects the expression of DEPTOR mRNA CTD PMID:37042841 Deptor Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DEPTOR mRNA CTD PMID:21266533 Deptor Rat diethylstilbestrol increases expression ISO RGD:1344261 6480464 Diethylstilbestrol results in increased expression of DEPTOR mRNA CTD PMID:19371625 Deptor Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of DEPTOR mRNA CTD PMID:35137919 Deptor Rat dorsomorphin multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat dorsomorphin multiple interactions EXP 6480464 dorsomorphin inhibits the reaction [Lidocaine results in decreased expression of [MTOR protein binds to RPTOR more ... CTD PMID:37914286 Deptor Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of DEPTOR mRNA CTD PMID:29391264 Deptor Rat Enterolactone multiple interactions ISO RGD:1344261 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of DEPTOR mRNA CTD PMID:19167446 Deptor Rat entinostat increases expression ISO RGD:1344261 6480464 entinostat results in increased expression of DEPTOR mRNA CTD PMID:26272509 Deptor Rat entinostat multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat epoxiconazole decreases expression ISO RGD:1620688 6480464 epoxiconazole results in decreased expression of DEPTOR mRNA CTD PMID:35436446 Deptor Rat fenthion increases expression ISO RGD:1620688 6480464 Fenthion results in increased expression of DEPTOR mRNA CTD PMID:34813904 Deptor Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of DEPTOR mRNA CTD PMID:24136188|PMID:24793618 Deptor Rat folic acid multiple interactions ISO RGD:1620688 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Deptor Rat folic acid increases expression ISO RGD:1620688 6480464 Folic Acid results in increased expression of DEPTOR mRNA CTD PMID:25629700 Deptor Rat formaldehyde decreases expression ISO RGD:1344261 6480464 Formaldehyde results in decreased expression of DEPTOR mRNA CTD PMID:27664576 Deptor Rat fulvestrant increases methylation ISO RGD:1344261 6480464 Fulvestrant results in increased methylation of DEPTOR gene CTD PMID:31601247 Deptor Rat fulvestrant multiple interactions ISO RGD:1344261 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DEPTOR gene CTD PMID:31601247 Deptor Rat genistein increases expression ISO RGD:1344261 6480464 Genistein results in increased expression of DEPTOR mRNA CTD PMID:23019147|PMID:26865667 Deptor Rat hydroquinone decreases expression ISO RGD:1344261 6480464 hydroquinone results in decreased expression of DEPTOR mRNA CTD PMID:29221148 Deptor Rat indometacin multiple interactions ISO RGD:1344261 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Deptor Rat L-methionine multiple interactions ISO RGD:1620688 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Deptor Rat lead(0) affects expression ISO RGD:1344261 6480464 Lead affects the expression of DEPTOR mRNA CTD PMID:28903495 Deptor Rat lidocaine multiple interactions EXP 6480464 bafilomycin A1 inhibits the reaction [Lidocaine results in decreased expression of [MTOR protein binds to more ... CTD PMID:37914286 Deptor Rat lipopolysaccharide decreases expression ISO RGD:1344261 6480464 Lipopolysaccharides results in decreased expression of DEPTOR mRNA CTD PMID:35811015 Deptor Rat lipopolysaccharide multiple interactions ISO RGD:1344261 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DEPTOR mRNA CTD PMID:35811015 Deptor Rat menadione affects expression ISO RGD:1344261 6480464 Vitamin K 3 affects the expression of DEPTOR mRNA CTD PMID:20044591 Deptor Rat metformin multiple interactions ISO RGD:1344261 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of DEPTOR mRNA CTD PMID:32589349 Deptor Rat metformin decreases expression ISO RGD:1344261 6480464 Metformin results in decreased expression of DEPTOR mRNA CTD PMID:32589349 Deptor Rat methapyrilene increases methylation ISO RGD:1344261 6480464 Methapyrilene results in increased methylation of DEPTOR intron CTD PMID:30157460 Deptor Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of DEPTOR gene CTD PMID:35440735 Deptor Rat methylmercury chloride decreases expression ISO RGD:1344261 6480464 methylmercuric chloride results in decreased expression of DEPTOR mRNA CTD PMID:28001369 Deptor Rat nickel atom decreases expression ISO RGD:1344261 6480464 Nickel results in decreased expression of DEPTOR mRNA CTD PMID:24768652|PMID:25583101 Deptor Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of DEPTOR mRNA CTD PMID:22110744 Deptor Rat okadaic acid decreases expression ISO RGD:1344261 6480464 Okadaic Acid results in decreased expression of DEPTOR mRNA; Okadaic Acid results in decreased expression more ... CTD PMID:38832940 Deptor Rat ozone decreases expression ISO RGD:1344261 6480464 Ozone results in decreased expression of DEPTOR mRNA CTD PMID:28652203 Deptor Rat panobinostat increases expression ISO RGD:1344261 6480464 panobinostat results in increased expression of DEPTOR mRNA CTD PMID:26272509 Deptor Rat panobinostat multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat paracetamol affects expression ISO RGD:1620688 6480464 Acetaminophen affects the expression of DEPTOR mRNA CTD PMID:17562736 Deptor Rat paracetamol decreases expression ISO RGD:1620688 6480464 Acetaminophen results in decreased expression of DEPTOR mRNA CTD PMID:29246445 Deptor Rat paracetamol multiple interactions ISO RGD:1620688 6480464 PANX1 gene mutant form promotes the reaction [Acetaminophen results in decreased expression of DEPTOR mRNA] CTD PMID:29246445 Deptor Rat paraquat decreases expression ISO RGD:1344261 6480464 Paraquat results in decreased expression of DEPTOR mRNA CTD PMID:35182771 Deptor Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1620688 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DEPTOR mRNA CTD PMID:36331819 Deptor Rat phenobarbital affects expression ISO RGD:1620688 6480464 Phenobarbital affects the expression of DEPTOR mRNA CTD PMID:23091169 Deptor Rat pioglitazone multiple interactions ISO RGD:1344261 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of DEPTOR mRNA CTD PMID:32589349 Deptor Rat pirinixic acid multiple interactions ISO RGD:1620688 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Deptor Rat pirinixic acid increases expression ISO RGD:1620688 6480464 pirinixic acid results in increased expression of DEPTOR mRNA CTD PMID:17426115 Deptor Rat pirinixic acid decreases expression ISO RGD:1620688 6480464 pirinixic acid results in decreased expression of DEPTOR mRNA CTD PMID:18445702 Deptor Rat potassium chromate increases expression ISO RGD:1344261 6480464 potassium chromate(VI) results in increased expression of DEPTOR mRNA CTD PMID:22714537 Deptor Rat progesterone decreases expression ISO RGD:1344261 6480464 Progesterone results in decreased expression of DEPTOR mRNA CTD PMID:23541542 Deptor Rat propiconazole decreases expression ISO RGD:1620688 6480464 propiconazole results in decreased expression of DEPTOR mRNA CTD PMID:21278054 Deptor Rat quercetin decreases expression ISO RGD:1344261 6480464 Quercetin results in decreased expression of DEPTOR mRNA CTD PMID:21632981 Deptor Rat resveratrol decreases expression ISO RGD:1344261 6480464 resveratrol results in decreased expression of DEPTOR mRNA CTD PMID:19371625 Deptor Rat resveratrol multiple interactions ISO RGD:1344261 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of DEPTOR mRNA CTD PMID:19167446 Deptor Rat resveratrol multiple interactions ISO RGD:1620688 6480464 resveratrol promotes the reaction [MTOR protein binds to DEPTOR protein] CTD PMID:20851890 Deptor Rat resveratrol affects response to substance ISO RGD:1620688 6480464 DEPTOR protein affects the susceptibility to resveratrol CTD PMID:20851890 Deptor Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of DEPTOR mRNA CTD PMID:28374803 Deptor Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1344261 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DEPTOR mRNA CTD PMID:35811015 Deptor Rat SB 431542 multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat silicon dioxide decreases expression ISO RGD:1344261 6480464 Silicon Dioxide analog results in decreased expression of DEPTOR mRNA; Silicon Dioxide results in decreased more ... CTD PMID:25351596|PMID:25895662 Deptor Rat silver atom increases expression ISO RGD:1620688 6480464 Silver results in increased expression of DEPTOR mRNA CTD PMID:27131904 Deptor Rat silver(0) increases expression ISO RGD:1620688 6480464 Silver results in increased expression of DEPTOR mRNA CTD PMID:27131904 Deptor Rat sirolimus multiple interactions ISO RGD:1344261 6480464 Sirolimus inhibits the reaction [TP73 protein results in increased expression of DEPTOR mRNA] CTD PMID:21245298 Deptor Rat sodium arsenate increases expression ISO RGD:1620688 6480464 sodium arsenate results in increased expression of DEPTOR mRNA CTD PMID:21795629 Deptor Rat sodium arsenite decreases expression ISO RGD:1344261 6480464 sodium arsenite results in decreased expression of DEPTOR mRNA CTD PMID:38568856 Deptor Rat sodium arsenite decreases expression ISO RGD:1620688 6480464 sodium arsenite results in decreased expression of DEPTOR mRNA CTD PMID:37682722 Deptor Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of DEPTOR mRNA CTD PMID:22110744 Deptor Rat sotorasib multiple interactions ISO RGD:1344261 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DEPTOR mRNA CTD PMID:36139627 Deptor Rat succimer multiple interactions ISO RGD:1620688 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of DEPTOR mRNA CTD PMID:21641980 Deptor Rat sulforaphane decreases expression ISO RGD:1344261 6480464 sulforaphane results in decreased expression of DEPTOR mRNA CTD PMID:26833863 Deptor Rat tamoxifen affects expression ISO RGD:1620688 6480464 Tamoxifen affects the expression of DEPTOR mRNA CTD PMID:17555576 Deptor Rat tetrachloromethane decreases expression ISO RGD:1620688 6480464 Carbon Tetrachloride results in decreased expression of DEPTOR mRNA CTD PMID:17484886|PMID:27339419|PMID:31919559 Deptor Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DEPTOR mRNA CTD PMID:31150632 Deptor Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DEPTOR mRNA] CTD PMID:31150632 Deptor Rat thapsigargin increases expression ISO RGD:1344261 6480464 Thapsigargin results in increased expression of DEPTOR mRNA CTD PMID:22378314 Deptor Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DEPTOR mRNA CTD PMID:34492290 Deptor Rat titanium dioxide decreases expression ISO RGD:1620688 6480464 titanium dioxide results in decreased expression of DEPTOR mRNA CTD PMID:23557971 Deptor Rat titanium dioxide decreases methylation ISO RGD:1620688 6480464 titanium dioxide results in decreased methylation of DEPTOR gene CTD PMID:35295148 Deptor Rat titanium dioxide affects expression ISO RGD:1620688 6480464 titanium dioxide affects the expression of DEPTOR mRNA CTD PMID:17656681 Deptor Rat trametinib multiple interactions ISO RGD:1344261 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DEPTOR mRNA CTD PMID:36139627 Deptor Rat trichostatin A increases expression ISO RGD:1344261 6480464 trichostatin A results in increased expression of DEPTOR mRNA CTD PMID:24935251 Deptor Rat trimellitic anhydride decreases expression ISO RGD:1620688 6480464 trimellitic anhydride results in decreased expression of DEPTOR mRNA CTD PMID:19042947 Deptor Rat triptonide decreases expression ISO RGD:1620688 6480464 triptonide results in decreased expression of DEPTOR mRNA CTD PMID:33045310 Deptor Rat troglitazone decreases expression ISO RGD:1620688 6480464 troglitazone results in decreased expression of DEPTOR mRNA CTD PMID:28973697 Deptor Rat trovafloxacin decreases expression ISO RGD:1620688 6480464 trovafloxacin results in decreased expression of DEPTOR mRNA CTD PMID:35537566 Deptor Rat tunicamycin increases expression ISO RGD:1344261 6480464 Tunicamycin results in increased expression of DEPTOR mRNA CTD PMID:22378314 Deptor Rat valproic acid increases expression ISO RGD:1344261 6480464 Valproic Acid results in increased expression of DEPTOR mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369 Deptor Rat valproic acid multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Deptor Rat vorinostat multiple interactions ISO RGD:1344261 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Deptor Rat vorinostat increases expression ISO RGD:1344261 6480464 vorinostat results in increased expression of DEPTOR mRNA CTD PMID:26272509 Deptor Rat zearalenone increases expression ISO RGD:1344261 6480464 Zearalenone results in increased expression of DEPTOR mRNA CTD PMID:33419253|PMID:36828454 Deptor Rat zinc atom decreases expression ISO RGD:1344261 6480464 Zinc deficiency results in decreased expression of DEPTOR mRNA CTD PMID:18356318 Deptor Rat zinc(0) decreases expression ISO RGD:1344261 6480464 Zinc deficiency results in decreased expression of DEPTOR mRNA CTD PMID:18356318 Deptor Rat zoledronic acid decreases expression ISO RGD:1344261 6480464 Zoledronic Acid results in decreased expression of DEPTOR mRNA CTD PMID:24714768
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Deptor Rat G protein-coupled receptor signaling pathway involved_in IBA MGI:3040696|PANTHER:PTN001107228|UniProtKB:Q70Z35 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Deptor Rat intracellular signal transduction involved_in IEA InterPro:IPR000591 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Deptor Rat negative regulation of cell size involved_in ISO RGD:1344261 1624291 PMID:19446321 RGD PMID:19446321 Deptor Rat negative regulation of cell size involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat negative regulation of protein kinase activity involved_in ISO RGD:1344261 1624291 PMID:19446321 RGD PMID:19446321 Deptor Rat negative regulation of TOR signaling involved_in ISO RGD:1344261 1624291 PMID:19446321 RGD PMID:19446321 Deptor Rat negative regulation of TOR signaling involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat negative regulation of TOR signaling involved_in IEA InterPro:IPR037335|InterPro:IPR037336 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Deptor Rat negative regulation of TOR signaling involved_in IEA InterPro:IPR037336 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Deptor Rat negative regulation of TORC1 signaling involved_in ISO RGD:1344261 1624291 UniProtKB:Q96G74 PMID:22017875, PMID:22017876, PMID:22017877, PMID:25936805, PMID:33110214, PMID:33865870, PMID:34519268, PMID:34519269, PMID:34634301 RGD PMID:22017875|PMID:22017876|PMID:22017877|PMID:25936805|PMID:33110214|PMID:33865870|PMID:34519268|PMID:34519269|PMID:34634301 Deptor Rat negative regulation of TORC1 signaling involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat negative regulation of TORC1 signaling involved_in IBA PANTHER:PTN004570354|UniProtKB:Q8TB45 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Deptor Rat negative regulation of TORC2 signaling involved_in ISO RGD:1344261 1624291 UniProtKB:Q96G74 PMID:25936805, PMID:33110214, PMID:33865870, PMID:34519268, PMID:34634301 RGD PMID:25936805|PMID:33110214|PMID:33865870|PMID:34519268|PMID:34634301 Deptor Rat negative regulation of TORC2 signaling involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat negative regulation of TORC2 signaling involved_in IBA PANTHER:PTN004570354|UniProtKB:Q8TB45 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Deptor Rat positive regulation of autophagy involved_in ISO RGD:1344261 1624291 PMID:22017875, PMID:22017876, PMID:22017877 RGD PMID:22017875|PMID:22017876|PMID:22017877 Deptor Rat positive regulation of autophagy involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat regulation of extrinsic apoptotic signaling pathway involved_in ISO RGD:1344261 1624291 PMID:19446321 RGD PMID:19446321 Deptor Rat regulation of extrinsic apoptotic signaling pathway involved_in IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Deptor Rat GTPase activator activity enables IBA PANTHER:PTN001107227|UniProtKB:Q70Z35 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Deptor Rat guanyl-nucleotide exchange factor activity enables IBA PANTHER:PTN001107227|UniProtKB:Q70Z35 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Deptor Rat phosphatidic acid binding enables ISO RGD:1344261 1624291 PMID:25936805, PMID:33865870 RGD PMID:25936805|PMID:33865870 Deptor Rat phosphatidic acid binding enables IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat protein binding enables ISO RGD:1344261 1624291 UniProtKB:P42345|UniProtKB:P42346|UniProtKB:Q13077|UniProtKB:Q8TBZ0|UniProtKB:Q9UPX6|UniProtKB:Q9Y2K2|UniProtKB:X5D778 PMID:19446321, PMID:25416956, PMID:30080879, PMID:30232230, PMID:32296183 RGD PMID:19446321|PMID:25416956|PMID:30080879|PMID:30232230|PMID:32296183 Deptor Rat protein kinase inhibitor activity enables ISO RGD:1344261 1624291 PMID:22017875, PMID:22017876, PMID:22017877, PMID:25936805, PMID:34519268, PMID:34519269 RGD PMID:22017875|PMID:22017876|PMID:22017877|PMID:25936805|PMID:34519268|PMID:34519269 Deptor Rat protein kinase inhibitor activity enables IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat protein serine/threonine kinase inhibitor activity enables ISO RGD:1344261 1624291 PMID:22017875, PMID:22017876 RGD PMID:22017875|PMID:22017876 Deptor Rat protein serine/threonine kinase inhibitor activity enables IEA UniProtKB:Q8TB45|ensembl:ENSP00000286234 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Deptor Rat protein serine/threonine kinase inhibitor activity enables IBA PANTHER:PTN001107227|UniProtKB:Q8TB45 1600115 GO_REF:0000033 GO_Central GO_REF:0000033
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amphotericin B (ISO) aristolochic acid A (ISO) atrazine (EXP) bafilomycin A1 (EXP) belinostat (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bicalutamide (ISO) bilirubin IXalpha (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (EXP,ISO) cannabidiol (EXP,ISO) carbon nanotube (ISO) chloroprene (EXP) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cytarabine (ISO) deoxynivalenol (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) Doramectin (EXP) dorsomorphin (EXP,ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) epoxiconazole (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) genistein (ISO) hydroquinone (ISO) indometacin (ISO) L-methionine (ISO) lead(0) (ISO) lidocaine (EXP) lipopolysaccharide (ISO) menadione (ISO) metformin (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (ISO) nickel atom (ISO) nickel dichloride (EXP) okadaic acid (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pioglitazone (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sotorasib (ISO) succimer (ISO) sulforaphane (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trametinib (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO) zearalenone (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Deptor Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 88,404,745 - 88,574,065 (+) NCBI GRCr8 mRatBN7.2 7 86,514,859 - 86,668,817 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 86,514,988 - 86,667,773 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 94,795,161 - 95,000,750 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 94,795,214 - 94,995,809 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 95,520,754 - 95,625,869 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 91,675,825 - 91,742,576 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 83,308,700 - 83,462,454 (+) NCBI Celera Cytogenetic Map 7 q32 NCBI
DEPTOR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 119,873,722 - 120,050,918 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 119,873,717 - 120,050,918 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 120,885,962 - 121,063,157 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 120,955,146 - 121,131,939 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 120,955,145 - 121,131,937 NCBI Celera 8 117,075,022 - 117,252,280 (+) NCBI Celera Cytogenetic Map 8 q24.12 NCBI HuRef 8 116,206,531 - 116,383,857 (+) NCBI HuRef CHM1_1 8 120,926,730 - 121,103,852 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 121,002,533 - 121,179,716 (+) NCBI T2T-CHM13v2.0
Deptor Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 54,975,824 - 55,122,667 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 54,975,713 - 55,122,667 (+) Ensembl GRCm39 Ensembl GRCm38 15 55,112,317 - 55,259,273 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 55,112,317 - 55,259,271 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 54,944,038 - 55,085,757 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 54,942,566 - 55,084,285 (+) NCBI MGSCv36 mm8 Celera 15 56,652,905 - 56,794,634 (+) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 21.96 NCBI
Deptor Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 25,538,578 - 25,566,772 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 25,538,609 - 25,563,374 (+) NCBI ChiLan1.0 ChiLan1.0
DEPTOR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 137,299,270 - 137,484,402 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 112,811,180 - 112,996,385 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 116,563,935 - 116,743,843 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 119,311,942 - 119,492,127 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 119,311,942 - 119,492,127 (+) Ensembl panpan1.1 panPan2
DEPTOR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 18,859,526 - 18,993,464 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 18,859,634 - 18,988,583 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 18,872,396 - 19,007,464 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 19,188,815 - 19,323,823 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 19,188,882 - 19,320,795 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 18,915,849 - 19,051,161 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 19,015,161 - 19,150,366 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 19,246,027 - 19,381,218 (+) NCBI UU_Cfam_GSD_1.0
Deptor Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 19,272,854 - 19,411,349 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 26,704,021 - 26,837,470 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 26,698,707 - 26,837,470 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DEPTOR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 18,976,743 - 19,180,117 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 18,969,509 - 19,180,131 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 20,001,488 - 20,186,277 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DEPTOR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 114,442,212 - 114,626,411 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 114,442,379 - 114,625,171 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 25,660,666 - 25,847,582 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Deptor
.
Predicted Target Of
Count of predictions: 141 Count of miRNA genes: 103 Interacting mature miRNAs: 113 Transcripts: ENSRNOT00000005722, ENSRNOT00000064270 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D15Mit183
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 86,591,855 - 86,592,031 (+) MAPPER mRatBN7.2 Rnor_6.0 7 94,923,611 - 94,923,786 NCBI Rnor6.0 Rnor_5.0 7 95,548,730 - 95,548,905 UniSTS Rnor5.0 RGSC_v3.4 7 91,670,316 - 91,670,491 UniSTS RGSC3.4 Cytogenetic Map 7 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005722 ⟹ ENSRNOP00000005722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 86,514,988 - 86,663,778 (+) Ensembl Rnor_6.0 Ensembl 7 94,795,214 - 94,995,809 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095532 ⟹ ENSRNOP00000093077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 86,514,992 - 86,667,773 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105476 ⟹ ENSRNOP00000097828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 86,561,637 - 86,663,778 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119008 ⟹ ENSRNOP00000080538
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 86,514,988 - 86,666,888 (+) Ensembl
RefSeq Acc Id:
NM_001427213 ⟹ NP_001414142
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,404,745 - 88,558,561 (+) NCBI
RefSeq Acc Id:
XM_017595234 ⟹ XP_017450723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,404,767 - 88,558,561 (+) NCBI mRatBN7.2 7 86,514,859 - 86,668,817 (+) NCBI Rnor_6.0 7 94,795,161 - 95,000,750 (+) NCBI
Sequence:
TGGACTCGCCGACCTCTTCAGCTTACCCGCAGGGATTCCCTCACCAGCCAATCGCGTCTGAGCCACGGGACCGCCCGGAACAAAGATGGCCGGAGCGGCCTCGGTGAGGGCACACTGATCCAAACGCC
hide sequence
RefSeq Acc Id:
XM_063263556 ⟹ XP_063119626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,404,767 - 88,574,065 (+) NCBI
RefSeq Acc Id:
XM_063263557 ⟹ XP_063119627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,404,767 - 88,574,065 (+) NCBI
RefSeq Acc Id:
XP_017450723 ⟸ XM_017595234
- Peptide Label:
isoform X3
- Sequence:
MEEGSSGGSGGSDSNAGGSGGAQQRELERMAEVLVTGEQLRLMSPETTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHSIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLME
hide sequence
Ensembl Acc Id:
ENSRNOP00000005722 ⟸ ENSRNOT00000005722
Ensembl Acc Id:
ENSRNOP00000097828 ⟸ ENSRNOT00000105476
Ensembl Acc Id:
ENSRNOP00000093077 ⟸ ENSRNOT00000095532
Ensembl Acc Id:
ENSRNOP00000080538 ⟸ ENSRNOT00000119008
RefSeq Acc Id:
NP_001414142 ⟸ NM_001427213
- UniProtKB:
A0A8I5ZQX9 (UniProtKB/TrEMBL), A6HRG9 (UniProtKB/TrEMBL), F1M8Y4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119626 ⟸ XM_063263556
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIZ7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119627 ⟸ XM_063263557
- Peptide Label:
isoform X2
RGD ID: 13695355 Promoter ID: EPDNEW_R5860 Type: multiple initiation site Name: Deptor_1 Description: DEP domain containing MTOR-interacting protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 94,795,310 - 94,795,370 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-29
Deptor
DEP domain containing MTOR-interacting protein
LOC102547145
uncharacterized LOC102547145
Data merged from RGD:7615485
737654 PROVISIONAL
2015-07-29
Deptor
DEP domain containing MTOR-interacting protein
LOC100359815
hypothetical protein LOC100359815
Data merged from RGD:2323326
737654 PROVISIONAL
2013-12-18
LOC102547145
uncharacterized LOC102547145
Symbol and Name status set to provisional
70820 PROVISIONAL
2011-08-02
Deptor
DEP domain containing MTOR-interacting protein
Depdc6
DEP domain containing 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100359815
hypothetical protein LOC100359815
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-16
Depdc6
DEP domain containing 6
RGD1561030
similar to DEP domain containing 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1561030
similar to DEP domain containing 6
RGD1561030_predicted
similar to DEP domain containing 6 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1561030_predicted
similar to DEP domain containing 6 (predicted)
LOC314979
similar to DEP domain containing 6
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC314979
similar to DEP domain containing 6
Symbol and Name status set to provisional
70820 PROVISIONAL
