Symbol:
Mepce
Name:
methylphosphate capping enzyme
RGD ID:
1560550
Description:
Predicted to enable 7SK snRNA binding activity and RNA 5'-gamma-phosphate methyltransferase activity. Predicted to be involved in RNA modification; positive regulation of protein localization to Cajal body; and positive regulation of snRNA transcription by RNA polymerase II. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II and positive regulation of G1/S transition of mitotic cell cycle. Predicted to be located in nucleus. Predicted to be part of 7SK snRNP. Orthologous to human MEPCE (methylphosphate capping enzyme); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
7SK snRNA methylphosphate capping enzyme; 7SK snRNA methylphosphate capping enzyme-like; LOC100910540; LOC304361; similar to Hypothetical protein MGC28888
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 24,548,596 - 24,553,315 (+) NCBI GRCr8 mRatBN7.2 12 18,911,796 - 18,916,515 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 18,911,796 - 18,916,514 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,066,920 - 20,071,639 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 20,679,795 - 20,684,514 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 19,744,124 - 19,748,843 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 21,721,246 - 21,725,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 21,981,755 - 21,986,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 21,721,837 - 21,725,435 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 23,742,114 - 23,746,833 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 19,848,913 - 19,853,632 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 20,717,705 - 20,722,424 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Mepce Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 24,548,596 - 24,553,315 (+) NCBI GRCr8 mRatBN7.2 12 18,911,796 - 18,916,515 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 18,911,796 - 18,916,514 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,066,920 - 20,071,639 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 20,679,795 - 20,684,514 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 19,744,124 - 19,748,843 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 21,721,246 - 21,725,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 21,981,755 - 21,986,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 21,721,837 - 21,725,435 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 23,742,114 - 23,746,833 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 19,848,913 - 19,853,632 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 20,717,705 - 20,722,424 (+) NCBI Celera Cytogenetic Map 12 q12 NCBI
MEPCE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 100,428,790 - 100,434,118 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 100,428,322 - 100,434,126 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 100,026,413 - 100,031,741 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 99,865,465 - 99,869,677 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 94,756,212 - 94,761,548 (+) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 94,659,849 - 94,665,185 (+) NCBI HuRef CHM1_1 7 99,957,026 - 99,962,362 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 101,668,175 - 101,674,196 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 99,386,498 - 99,391,834 (+) NCBI
Mepce Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 137,780,168 - 137,785,915 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 137,780,168 - 137,785,917 (-) Ensembl GRCm39 Ensembl GRCm38 5 137,781,906 - 137,786,701 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 137,781,906 - 137,787,655 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 138,223,134 - 138,227,929 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 138,011,709 - 138,015,961 (-) NCBI MGSCv36 mm8 Celera 5 134,768,335 - 134,773,130 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 76.7 NCBI
Mepce Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955573 526,613 - 530,286 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955573 526,083 - 531,222 (-) NCBI ChiLan1.0 ChiLan1.0
MEPCE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 118,342,164 - 118,347,440 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 166,607,596 - 166,612,072 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 92,457,967 - 92,463,102 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 105,859,584 - 105,865,312 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 105,861,205 - 105,864,739 (+) Ensembl panpan1.1 panPan2
MEPCE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 9,234,316 - 9,239,160 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 9,234,356 - 9,239,859 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 10,938,563 - 10,943,659 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 9,168,084 - 9,173,182 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 9,168,095 - 9,172,830 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 9,020,522 - 9,025,618 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 8,998,101 - 9,003,195 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 9,180,481 - 9,185,577 (-) NCBI UU_Cfam_GSD_1.0
Mepce
MEPCE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 8,357,289 - 8,364,661 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 8,356,602 - 8,361,798 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 7,700,143 - 7,704,903 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MEPCE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 12,771,822 - 12,776,345 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 12,771,391 - 12,775,961 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 3,514,965 - 3,520,629 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mepce
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 74 Interacting mature miRNAs: 78 Transcripts: ENSRNOT00000001871, ENSRNOT00000073353 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
BE101310
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 18,914,771 - 18,914,954 (+) MAPPER mRatBN7.2 Rnor_6.0 12 21,724,222 - 21,724,404 NCBI Rnor6.0 Rnor_6.0 12 21,984,731 - 21,984,913 NCBI Rnor6.0 Rnor_5.0 12 24,001,779 - 24,001,961 UniSTS Rnor5.0 Rnor_5.0 12 23,745,090 - 23,745,272 UniSTS Rnor5.0 RGSC_v3.4 12 19,850,474 - 19,850,656 UniSTS RGSC3.4 Celera 12 20,720,681 - 20,720,863 UniSTS RH 3.4 Map 12 264.3 UniSTS Cytogenetic Map 12 q12 UniSTS
WIAF-1510
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 12 23,746,595 - 23,746,749 NCBI Rnor5.0 RGSC_v3.4 12 19,848,997 - 19,849,150 UniSTS RGSC3.4 Cytogenetic Map 12 q12 UniSTS
RH125705
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 18,916,127 - 18,916,398 (+) MAPPER mRatBN7.2 Rnor_6.0 12 21,725,578 - 21,725,848 NCBI Rnor6.0 Rnor_6.0 12 21,986,087 - 21,986,357 NCBI Rnor6.0 Rnor_5.0 12 23,746,446 - 23,746,716 UniSTS Rnor5.0 Rnor_5.0 12 24,003,135 - 24,003,405 UniSTS Rnor5.0 RGSC_v3.4 12 19,849,030 - 19,849,300 UniSTS RGSC3.4 Celera 12 20,722,037 - 20,722,307 UniSTS Cytogenetic Map 12 q12 UniSTS
C78815
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 18,916,125 - 18,916,209 (+) MAPPER mRatBN7.2 Rnor_6.0 12 21,725,576 - 21,725,659 NCBI Rnor6.0 Rnor_6.0 12 21,986,085 - 21,986,168 NCBI Rnor6.0 Rnor_5.0 12 23,746,444 - 23,746,527 UniSTS Rnor5.0 Rnor_5.0 12 24,003,133 - 24,003,216 UniSTS Rnor5.0 RGSC_v3.4 12 19,849,219 - 19,849,302 UniSTS RGSC3.4 Celera 12 20,722,035 - 20,722,118 UniSTS Cytogenetic Map 12 q12 UniSTS
RH142264
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 18,916,282 - 18,916,482 (+) MAPPER mRatBN7.2 Rnor_6.0 12 21,725,733 - 21,725,932 NCBI Rnor6.0 Rnor_6.0 12 21,986,242 - 21,986,441 NCBI Rnor6.0 Rnor_5.0 12 23,746,601 - 23,746,800 UniSTS Rnor5.0 Rnor_5.0 12 24,003,290 - 24,003,489 UniSTS Rnor5.0 RGSC_v3.4 12 19,848,946 - 19,849,145 UniSTS RGSC3.4 Celera 12 20,722,192 - 20,722,391 UniSTS Cytogenetic Map 12 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000001871 ⟹ ENSRNOP00000001871
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 18,911,796 - 18,916,514 (+) Ensembl Rnor_6.0 Ensembl 12 21,981,755 - 21,986,473 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000073353 ⟹ ENSRNOP00000067286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 21,721,837 - 21,725,435 (+) Ensembl
RefSeq Acc Id:
NM_001100678 ⟹ NP_001094148
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,548,596 - 24,553,315 (+) NCBI mRatBN7.2 12 18,911,796 - 18,916,515 (+) NCBI Rnor_6.0 12 21,721,246 - 21,725,965 (+) NCBI Rnor_5.0 12 23,742,114 - 23,746,833 (+) NCBI RGSC_v3.4 12 19,848,913 - 19,853,632 (-) RGD Celera 12 20,717,705 - 20,722,424 (+) RGD
Sequence:
GGGTGTCAAGGAGACCTTTTCACACCAGCTCCCGTTCCCCGCCTACGGTGGGTGGGATCTCACAGCAGAGACAAAGGATATCAGTAGGGCTTGGACTTAGCAGCGAAGGGAAGTCGGGTGTCCGTGTG
hide sequence
RefSeq Acc Id:
NP_001094148 ⟸ NM_001100678
- UniProtKB:
G3V656 (UniProtKB/TrEMBL), A6IZZ6 (UniProtKB/TrEMBL)
- Sequence:
MIEMAAEKEPFLVPAPPPPLKDESGGGGGPEVRSHQEAASGELLDGTERGPGPRAHSAGATASGGGGPQAQTHGEPHGRAAAPADVGEERRGGGGTDLGPPAPPRPRNGYQPHRPPVGGGGKRRNSCN
hide sequence
Ensembl Acc Id:
ENSRNOP00000067286 ⟸ ENSRNOT00000073353
Ensembl Acc Id:
ENSRNOP00000001871 ⟸ ENSRNOT00000001871
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Mepce
methylphosphate capping enzyme
LOC100910540
7SK snRNA methylphosphate capping enzyme-like
Data merged from RGD:6497906
737654 PROVISIONAL
2012-07-05
LOC100910540
7SK snRNA methylphosphate capping enzyme-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-04
Mepce
methylphosphate capping enzyme
LOC304361
similar to Hypothetical protein MGC28888
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC304361
similar to Hypothetical protein MGC28888
Symbol and Name status set to provisional
70820 PROVISIONAL
