Symbol:
Cenpk
Name:
centromere protein K
RGD ID:
1310461
Description:
Predicted to be involved in mitotic sister chromatid segregation. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of inner kinetochore. Orthologous to human CENPK (centromere protein K); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC294712; Solt; SoxLZ/Sox6 leucine zipper binding protein in testis
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 37,094,163 - 37,155,158 (+) NCBI GRCr8 mRatBN7.2 2 35,360,390 - 35,421,372 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 35,360,132 - 35,385,706 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 42,473,469 - 42,498,681 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 40,532,156 - 40,557,370 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 35,388,487 - 35,413,716 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 34,312,766 - 34,373,945 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 34,312,766 - 34,335,776 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 53,441,765 - 53,467,341 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 35,159,157 - 35,182,167 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 35,079,888 - 35,105,102 (+) NCBI Celera 2 31,336,422 - 31,359,436 (+) NCBI Celera Cytogenetic Map 2 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cenpk Rat 1,1-dichloroethene increases expression ISO RGD:1321375 6480464 vinylidene chloride results in increased expression of CENPK mRNA CTD PMID:26682919 Cenpk Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1321375 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cenpk Rat 1,2-dichloroethane decreases expression ISO RGD:1321375 6480464 ethylene dichloride results in decreased expression of CENPK mRNA CTD PMID:28960355 Cenpk Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1321375 6480464 1,2-Dimethylhydrazine results in decreased expression of CENPK mRNA CTD PMID:22206623 Cenpk Rat 17beta-estradiol increases expression ISO RGD:1605966 6480464 Estradiol results in increased expression of CENPK mRNA CTD PMID:18310284|PMID:20106945 Cenpk Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1321375 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cenpk Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1321375 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cenpk Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1321375 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CENPK promoter] CTD PMID:19654925 Cenpk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CENPK mRNA CTD PMID:33387578|PMID:34747641 Cenpk Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CENPK mRNA CTD PMID:32109520 Cenpk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321375 6480464 Tetrachlorodibenzodioxin affects the expression of CENPK mRNA CTD PMID:21570461 Cenpk Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1605966 6480464 Tetrachlorodibenzodioxin results in decreased expression of CENPK mRNA CTD PMID:21802500 Cenpk Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1321375 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cenpk Rat 2-butoxyethanol increases expression ISO RGD:1321375 6480464 n-butoxyethanol results in increased expression of CENPK mRNA CTD PMID:19812364 Cenpk Rat 2-palmitoylglycerol increases expression ISO RGD:1605966 6480464 2-palmitoylglycerol results in increased expression of CENPK mRNA CTD PMID:37199045 Cenpk Rat 3-methylcholanthrene increases expression ISO RGD:1321375 6480464 Methylcholanthrene results in increased expression of CENPK mRNA CTD PMID:20713471 Cenpk Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CENPK mRNA CTD PMID:31881176 Cenpk Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CENPK mRNA CTD PMID:28959563 Cenpk Rat acrylamide decreases expression ISO RGD:1605966 6480464 Acrylamide results in decreased expression of CENPK mRNA CTD PMID:32763439 Cenpk Rat aflatoxin B1 affects expression ISO RGD:1605966 6480464 Aflatoxin B1 affects the expression of CENPK protein CTD PMID:20106945 Cenpk Rat aflatoxin M1 decreases expression ISO RGD:1605966 6480464 Aflatoxin M1 results in decreased expression of CENPK mRNA CTD PMID:30928695 Cenpk Rat all-trans-retinoic acid decreases expression ISO RGD:1605966 6480464 Tretinoin results in decreased expression of CENPK mRNA CTD PMID:33167477 Cenpk Rat aristolochic acid A decreases expression ISO RGD:1605966 6480464 aristolochic acid I results in decreased expression of CENPK mRNA CTD PMID:33212167 Cenpk Rat arsane multiple interactions ISO RGD:1605966 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CENPK more ... CTD PMID:39836092 Cenpk Rat arsenic atom multiple interactions ISO RGD:1605966 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CENPK more ... CTD PMID:39836092 Cenpk Rat azathioprine decreases expression ISO RGD:1605966 6480464 Azathioprine results in decreased expression of CENPK mRNA CTD PMID:22623647 Cenpk Rat azoxystrobin decreases expression ISO RGD:1605966 6480464 azoxystrobin results in decreased expression of CENPK mRNA CTD PMID:33512557 Cenpk Rat benzo[a]pyrene decreases expression ISO RGD:1321375 6480464 Benzo(a)pyrene results in decreased expression of CENPK mRNA CTD PMID:17942131|PMID:22228805 Cenpk Rat benzo[a]pyrene increases expression ISO RGD:1605966 6480464 Benzo(a)pyrene results in increased expression of CENPK mRNA CTD PMID:32234424 Cenpk Rat benzo[a]pyrene decreases expression ISO RGD:1605966 6480464 Benzo(a)pyrene results in decreased expression of CENPK mRNA CTD PMID:21802500 Cenpk Rat benzo[b]fluoranthene increases expression ISO RGD:1321375 6480464 benzo(b)fluoranthene results in increased expression of CENPK mRNA CTD PMID:26377693 Cenpk Rat beta-lapachone decreases expression ISO RGD:1605966 6480464 beta-lapachone results in decreased expression of CENPK mRNA CTD PMID:38218311 Cenpk Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CENPK mRNA CTD PMID:25181051 Cenpk Rat bisphenol A decreases expression ISO RGD:1605966 6480464 bisphenol A results in decreased expression of CENPK mRNA CTD PMID:29275510 Cenpk Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of CENPK mRNA CTD PMID:32479839 Cenpk Rat cadmium atom decreases expression ISO RGD:1605966 6480464 Cadmium results in decreased expression of CENPK mRNA CTD PMID:24376830 Cenpk Rat calcitriol decreases expression ISO RGD:1605966 6480464 Calcitriol results in decreased expression of CENPK mRNA CTD PMID:21592394 Cenpk Rat calcitriol multiple interactions ISO RGD:1605966 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CENPK mRNA CTD PMID:21592394 Cenpk Rat carbon nanotube increases expression ISO RGD:1321375 6480464 Nanotubes, Carbon analog results in increased expression of CENPK mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Cenpk Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of CENPK mRNA CTD PMID:18500788 Cenpk Rat chlorpyrifos decreases expression ISO RGD:1321375 6480464 Chlorpyrifos results in decreased expression of CENPK mRNA CTD PMID:32715474|PMID:37019170 Cenpk Rat cisplatin increases expression ISO RGD:1605966 6480464 Cisplatin results in increased expression of CENPK mRNA CTD PMID:27594783 Cenpk Rat cisplatin decreases expression ISO RGD:1605966 6480464 Cisplatin results in decreased expression of CENPK mRNA CTD PMID:27392435 Cenpk Rat copper atom multiple interactions ISO RGD:1605966 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CENPK mRNA CTD PMID:20971185 Cenpk Rat copper(0) multiple interactions ISO RGD:1605966 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CENPK mRNA CTD PMID:20971185 Cenpk Rat copper(II) sulfate decreases expression ISO RGD:1605966 6480464 Copper Sulfate results in decreased expression of CENPK mRNA CTD PMID:19549813 Cenpk Rat cyclosporin A decreases expression ISO RGD:1321375 6480464 Cyclosporine results in decreased expression of CENPK mRNA CTD PMID:17942131 Cenpk Rat cyclosporin A decreases expression ISO RGD:1605966 6480464 Cyclosporine results in decreased expression of CENPK mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108 Cenpk Rat deguelin decreases expression ISO RGD:1605966 6480464 deguelin results in decreased expression of CENPK mRNA CTD PMID:33512557 Cenpk Rat dibenz[a,h]anthracene increases expression ISO RGD:1321375 6480464 1,2,5,6-dibenzanthracene results in increased expression of CENPK mRNA CTD PMID:26377693 Cenpk Rat dibutyl phthalate decreases expression ISO RGD:1321375 6480464 Dibutyl Phthalate results in decreased expression of CENPK mRNA CTD PMID:17361019|PMID:21266533 Cenpk Rat dicrotophos decreases expression ISO RGD:1605966 6480464 dicrotophos results in decreased expression of CENPK mRNA CTD PMID:28302478 Cenpk Rat dioxygen decreases expression ISO RGD:1605966 6480464 Oxygen deficiency results in decreased expression of CENPK mRNA CTD PMID:26516004 Cenpk Rat disodium selenite decreases expression ISO RGD:1605966 6480464 Sodium Selenite results in decreased expression of CENPK mRNA CTD PMID:18175754 Cenpk Rat doxorubicin decreases expression ISO RGD:1605966 6480464 Doxorubicin results in decreased expression of CENPK mRNA CTD PMID:30031762 Cenpk Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CENPK mRNA CTD PMID:29391264 Cenpk Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CENPK mRNA CTD PMID:24793618 Cenpk Rat folic acid multiple interactions ISO RGD:1605966 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of CENPK mRNA CTD PMID:24657277 Cenpk Rat folic acid decreases expression ISO RGD:1321375 6480464 Folic Acid results in decreased expression of CENPK mRNA CTD PMID:25629700 Cenpk Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CENPK mRNA CTD PMID:33387578 Cenpk Rat GSK-J4 decreases expression ISO RGD:1605966 6480464 GSK-J4 results in decreased expression of CENPK mRNA CTD PMID:29301935 Cenpk Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of CENPK mRNA CTD PMID:22129741 Cenpk Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of CENPK mRNA CTD PMID:22641619 Cenpk Rat lucanthone decreases expression ISO RGD:1605966 6480464 Lucanthone results in decreased expression of CENPK mRNA CTD PMID:21148553 Cenpk Rat methotrexate decreases expression ISO RGD:1605966 6480464 Methotrexate results in decreased expression of CENPK mRNA CTD PMID:24657277 Cenpk Rat methotrexate multiple interactions ISO RGD:1605966 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of CENPK mRNA CTD PMID:24657277 Cenpk Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of CENPK mRNA CTD PMID:22129741 Cenpk Rat N-Nitrosopyrrolidine decreases expression ISO RGD:1605966 6480464 N-Nitrosopyrrolidine results in decreased expression of CENPK mRNA CTD PMID:32234424 Cenpk Rat nickel atom increases expression ISO RGD:1605966 6480464 Nickel results in increased expression of CENPK mRNA CTD PMID:25583101 Cenpk Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CENPK mRNA CTD PMID:26720608 Cenpk Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of CENPK mRNA CTD PMID:25729387 Cenpk Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CENPK mRNA CTD PMID:25729387 Cenpk Rat ozone decreases expression ISO RGD:1321375 6480464 Ozone results in decreased expression of CENPK mRNA CTD PMID:24336422 Cenpk Rat ozone multiple interactions ISO RGD:1321375 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:27106289|PMID:34911549 Cenpk Rat paracetamol decreases expression ISO RGD:1321375 6480464 Acetaminophen results in decreased expression of CENPK mRNA CTD PMID:17942131 Cenpk Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CENPK mRNA CTD PMID:33387578 Cenpk Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CENPK mRNA CTD PMID:32479839 Cenpk Rat paracetamol increases expression ISO RGD:1605966 6480464 Acetaminophen results in increased expression of CENPK mRNA CTD PMID:22230336 Cenpk Rat PCB138 multiple interactions ISO RGD:1321375 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Cenpk Rat phenobarbital increases expression ISO RGD:1321375 6480464 Phenobarbital results in increased expression of CENPK mRNA CTD PMID:23091169 Cenpk Rat phytoestrogen increases expression ISO RGD:1605966 6480464 Phytoestrogens results in increased expression of CENPK mRNA CTD PMID:18310284 Cenpk Rat picoxystrobin decreases expression ISO RGD:1605966 6480464 picoxystrobin results in decreased expression of CENPK mRNA CTD PMID:33512557 Cenpk Rat pirinixic acid multiple interactions ISO RGD:1321375 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of CENPK mRNA CTD PMID:20813756 Cenpk Rat pirinixic acid increases expression ISO RGD:1321375 6480464 pirinixic acid results in increased expression of CENPK mRNA CTD PMID:20813756|PMID:23811191 Cenpk Rat potassium chromate decreases expression ISO RGD:1605966 6480464 potassium chromate(VI) results in decreased expression of CENPK mRNA CTD PMID:22714537 Cenpk Rat propanal decreases expression ISO RGD:1605966 6480464 propionaldehyde results in decreased expression of CENPK mRNA CTD PMID:26079696 Cenpk Rat quercetin decreases expression ISO RGD:1605966 6480464 Quercetin results in decreased expression of CENPK mRNA CTD PMID:21632981 Cenpk Rat quinolin-8-ol decreases expression ISO RGD:1605966 6480464 Oxyquinoline results in decreased expression of CENPK mRNA CTD PMID:21632981 Cenpk Rat rotenone decreases expression ISO RGD:1605966 6480464 Rotenone results in decreased expression of CENPK mRNA CTD PMID:33512557 Cenpk Rat silicon dioxide increases expression ISO RGD:1321375 6480464 Silicon Dioxide results in increased expression of CENPK mRNA CTD PMID:29341224 Cenpk Rat sodium arsenite decreases expression ISO RGD:1605966 6480464 sodium arsenite results in decreased expression of CENPK mRNA CTD PMID:22714537|PMID:38568856 Cenpk Rat sodium arsenite decreases expression ISO RGD:1321375 6480464 sodium arsenite results in decreased expression of CENPK mRNA CTD PMID:37682722 Cenpk Rat sodium arsenite multiple interactions ISO RGD:1605966 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CENPK more ... CTD PMID:39836092 Cenpk Rat sodium arsenite increases expression ISO RGD:1605966 6480464 sodium arsenite results in increased expression of CENPK mRNA CTD PMID:29301061 Cenpk Rat SP2509 multiple interactions ISO RGD:1605966 6480464 SP2509 inhibits the reaction [KDM1A protein binds to CENPK promoter] CTD PMID:29581250 Cenpk Rat sunitinib decreases expression ISO RGD:1605966 6480464 Sunitinib results in decreased expression of CENPK mRNA CTD PMID:31533062 Cenpk Rat temozolomide decreases expression ISO RGD:1605966 6480464 Temozolomide results in decreased expression of CENPK mRNA CTD PMID:31758290 Cenpk Rat testosterone multiple interactions ISO RGD:1605966 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CENPK mRNA CTD PMID:21592394 Cenpk Rat testosterone increases expression ISO RGD:1605966 6480464 Testosterone results in increased expression of CENPK mRNA CTD PMID:33359661 Cenpk Rat testosterone decreases expression ISO RGD:1605966 6480464 Testosterone results in decreased expression of CENPK mRNA CTD PMID:21592394 Cenpk Rat tetrachloromethane affects expression ISO RGD:1321375 6480464 Carbon Tetrachloride affects the expression of CENPK mRNA CTD PMID:17484886 Cenpk Rat tetrachloromethane increases expression ISO RGD:1321375 6480464 Carbon Tetrachloride results in increased expression of CENPK mRNA CTD PMID:31919559 Cenpk Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CENPK mRNA CTD PMID:22659510|PMID:23411599|PMID:34492290 Cenpk Rat titanium dioxide increases expression ISO RGD:1321375 6480464 titanium dioxide results in increased expression of CENPK mRNA CTD PMID:23557971 Cenpk Rat titanium dioxide decreases methylation ISO RGD:1321375 6480464 titanium dioxide results in decreased methylation of CENPK promoter alternative form CTD PMID:35295148 Cenpk Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CENPK mRNA CTD PMID:25729387 Cenpk Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CENPK mRNA CTD PMID:25729387 Cenpk Rat Tributyltin oxide decreases expression ISO RGD:1321375 6480464 bis(tri-n-butyltin)oxide results in decreased expression of CENPK mRNA CTD PMID:17942131 Cenpk Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of CENPK gene CTD PMID:27618143 Cenpk Rat trimellitic anhydride increases expression ISO RGD:1321375 6480464 trimellitic anhydride results in increased expression of CENPK mRNA CTD PMID:19042947 Cenpk Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of CENPK mRNA CTD PMID:30589522 Cenpk Rat triphenyl phosphate affects expression ISO RGD:1605966 6480464 triphenyl phosphate affects the expression of CENPK mRNA CTD PMID:37042841 Cenpk Rat trovafloxacin decreases expression ISO RGD:1321375 6480464 trovafloxacin results in decreased expression of CENPK mRNA CTD PMID:35537566 Cenpk Rat tungsten increases expression ISO RGD:1321375 6480464 Tungsten results in increased expression of CENPK mRNA CTD PMID:30912803 Cenpk Rat urethane decreases expression ISO RGD:1605966 6480464 Urethane results in decreased expression of CENPK mRNA CTD PMID:28818685 Cenpk Rat valproic acid increases expression ISO RGD:1605966 6480464 Valproic Acid results in increased expression of CENPK mRNA CTD PMID:29154799
1,1-dichloroethene (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2-butoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3-methylcholanthrene (ISO) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) azathioprine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) calcitriol (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlorpyrifos (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) deguelin (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) flutamide (EXP) folic acid (ISO) gentamycin (EXP) GSK-J4 (ISO) indole-3-methanol (EXP) lead diacetate (EXP) lucanthone (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nitrofen (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) PCB138 (ISO) phenobarbital (ISO) phytoestrogen (ISO) picoxystrobin (ISO) pirinixic acid (ISO) potassium chromate (ISO) propanal (ISO) quercetin (ISO) quinolin-8-ol (ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) SP2509 (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) trovafloxacin (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Cenpk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 37,094,163 - 37,155,158 (+) NCBI GRCr8 mRatBN7.2 2 35,360,390 - 35,421,372 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 35,360,132 - 35,385,706 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 42,473,469 - 42,498,681 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 40,532,156 - 40,557,370 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 35,388,487 - 35,413,716 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 34,312,766 - 34,373,945 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 34,312,766 - 34,335,776 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 53,441,765 - 53,467,341 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 35,159,157 - 35,182,167 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 35,079,888 - 35,105,102 (+) NCBI Celera 2 31,336,422 - 31,359,436 (+) NCBI Celera Cytogenetic Map 2 q13 NCBI
CENPK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 65,495,624 - 65,563,168 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 65,517,766 - 65,563,168 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 64,812,119 - 64,858,995 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 64,849,350 - 64,894,751 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 61,812,111 - 61,857,460 (-) NCBI Celera Cytogenetic Map 5 q12.3 ENTREZGENE HuRef 5 61,769,466 - 61,815,023 (-) NCBI HuRef CHM1_1 5 64,813,279 - 64,858,667 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 66,338,058 - 66,384,928 (-) NCBI T2T-CHM13v2.0
Cenpk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 104,365,474 - 104,386,130 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 104,365,119 - 104,388,900 (+) Ensembl GRCm39 Ensembl GRCm38 13 104,228,611 - 104,249,622 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 104,228,611 - 104,252,392 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 105,019,035 - 105,039,697 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 105,349,337 - 105,369,999 (+) NCBI MGSCv36 mm8 Celera 13 108,621,358 - 108,642,051 (+) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 56.42 NCBI
Cenpk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 3,531,702 - 3,583,914 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 3,531,702 - 3,583,914 (+) NCBI ChiLan1.0 ChiLan1.0
CENPK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 48,358,594 - 48,409,512 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 46,512,221 - 46,561,002 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 48,443,491 - 48,490,999 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 50,097,628 - 50,144,126 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 50,105,743 - 50,142,567 (+) Ensembl panpan1.1 panPan2
CENPK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 51,262,475 - 51,300,016 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 51,263,185 - 51,292,425 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 48,192,162 - 48,256,605 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 51,727,375 - 51,792,095 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 51,753,740 - 51,783,767 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 48,787,621 - 48,852,015 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 49,576,772 - 49,641,151 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 50,468,905 - 50,533,342 (-) NCBI UU_Cfam_GSD_1.0
Cenpk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 194,682,894 - 194,746,935 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 3,624,143 - 3,645,884 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 3,621,758 - 3,645,968 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CENPK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 44,041,490 - 44,080,492 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 44,008,673 - 44,080,565 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 47,320,120 - 47,359,171 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CENPK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 61,712,006 - 61,755,082 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 61,712,043 - 61,747,178 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 10,354,839 - 10,398,069 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cenpk
.
Predicted Target Of
Count of predictions: 257 Count of miRNA genes: 176 Interacting mature miRNAs: 196 Transcripts: ENSRNOT00000060962 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 731179 Mamtr3 Mammary tumor resistance QTL 3 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 32373770 43665178 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
91
90
59
25
59
6
217
96
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000060962 ⟹ ENSRNOP00000057684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 35,360,132 - 35,383,142 (+) Ensembl Rnor_6.0 Ensembl 2 34,312,766 - 34,335,776 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103473 ⟹ ENSRNOP00000081169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 35,361,126 - 35,385,706 (+) Ensembl
RefSeq Acc Id:
NM_001399198 ⟹ NP_001386127
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 37,094,267 - 37,119,488 (+) NCBI mRatBN7.2 2 35,360,485 - 35,385,708 (+) NCBI
RefSeq Acc Id:
NM_001399199 ⟹ NP_001386128
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 37,094,267 - 37,119,488 (+) NCBI mRatBN7.2 2 35,360,485 - 35,385,708 (+) NCBI
RefSeq Acc Id:
XM_006231889 ⟹ XP_006231951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 37,094,448 - 37,119,488 (+) NCBI mRatBN7.2 2 35,360,649 - 35,385,708 (+) NCBI Rnor_6.0 2 34,313,170 - 34,338,342 (+) NCBI Rnor_5.0 2 53,441,765 - 53,467,341 (+) NCBI
Sequence:
GCTCTGACTGGCTAAGCAGGGCTTCCTTACGGTTCTAGTTTTCTGTCAAGGGTAATGGCAGCTCGCGAGTTTGGGGGACCCATCCCCCCAAAATCGGACGCTTACGGCCTGCGAACTGGGTGCCTCGC
hide sequence
RefSeq Acc Id:
XM_008760667 ⟹ XP_008758889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 37,094,163 - 37,155,158 (+) NCBI mRatBN7.2 2 35,360,390 - 35,421,372 (+) NCBI Rnor_6.0 2 34,313,072 - 34,373,945 (+) NCBI
Sequence:
CGCCGATCCAATCAGCAACCAGCGCGCGTAGACAACGGGGCTTGGCAGTGTTGACAGGAACGCT
hide sequence
RefSeq Acc Id:
XM_039101934 ⟹ XP_038957862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 37,098,242 - 37,119,488 (+) NCBI mRatBN7.2 2 35,364,460 - 35,385,708 (+) NCBI
RefSeq Acc Id:
XP_006231951 ⟸ XM_006231889
- Peptide Label:
isoform X1
- UniProtKB:
A6I5F7 (UniProtKB/TrEMBL), A0A8I6G7L9 (UniProtKB/TrEMBL)
- Sequence:
MSENQQHIDPDVIAAKDTEEELIKQCEEMWKDVEECQNKLSLIGPETLTNSNAQLSLLIMQVKCLTAELGQWNKRKPETVPLTEGVLLTLGKEEFQKLRYDLEMVRSIVQSENEKLKEDLAREQQWLD
hide sequence
RefSeq Acc Id:
XP_008758889 ⟸ XM_008760667
- Peptide Label:
isoform X2
- Sequence:
MSENQQHIDPDVIAAKDTEEELIKQCEEMWKDVEECQNKLSLIGPETLTNSNAQLSLLIMQVKC
hide sequence
Ensembl Acc Id:
ENSRNOP00000057684 ⟸ ENSRNOT00000060962
RefSeq Acc Id:
XP_038957862 ⟸ XM_039101934
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000081169 ⟸ ENSRNOT00000103473
RefSeq Acc Id:
NP_001386127 ⟸ NM_001399198
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6G7L9 (UniProtKB/TrEMBL), A6I5F7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386128 ⟸ NM_001399199
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6G7L9 (UniProtKB/TrEMBL)
RGD ID: 13691123 Promoter ID: EPDNEW_R1648 Type: multiple initiation site Name: Cenpk_1 Description: centromere protein K SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 34,313,118 - 34,313,178 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Cenpk
centromere protein K
Solt_predicted
SoxLZ/Sox6 leucine zipper binding protein in testis (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Solt_predicted
SoxLZ/Sox6 leucine zipper binding protein in testis (predicted)
Symbol and Name status set to approved
70820 APPROVED
