Symbol:
Hoxd4
Name:
homeo box D4
RGD ID:
1309690
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in anterior/posterior pattern specification; embryonic skeletal system morphogenesis; and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within stem cell differentiation. Predicted to be located in cell junction. Predicted to be active in nucleoplasm. Orthologous to human HOXD4 (homeobox D4); INTERACTS WITH bisphenol A; copper atom; copper(0).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
homeobox protein Hox-D4; LOC288153
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HOXD4 (homeobox D4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Hoxd4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hoxd4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HOXD4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HOXD4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hoxd4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HOXD4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hoxd4 (homeobox D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ENKUR (enkurin, TRPC channel interacting protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
HOXD4 (homeobox D4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hoxd4 (homeobox D4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hoxd4a (homeobox D4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dfd
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
lin-39
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 80,021,886 - 80,041,462 (+) NCBI GRCr8 mRatBN7.2 3 59,614,464 - 59,634,042 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 59,614,464 - 59,631,528 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 63,001,717 - 63,018,774 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 71,585,362 - 71,602,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 69,350,424 - 69,367,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 61,634,005 - 61,653,581 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 61,634,005 - 61,651,056 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 68,099,689 - 68,119,265 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 57,326,880 - 57,343,942 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 57,233,172 - 57,240,314 (+) NCBI Celera 3 59,135,961 - 59,152,998 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Hoxd4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 80,021,886 - 80,041,462 (+) NCBI GRCr8 mRatBN7.2 3 59,614,464 - 59,634,042 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 59,614,464 - 59,631,528 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 63,001,717 - 63,018,774 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 71,585,362 - 71,602,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 69,350,424 - 69,367,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 61,634,005 - 61,653,581 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 61,634,005 - 61,651,056 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 68,099,689 - 68,119,265 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 57,326,880 - 57,343,942 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 57,233,172 - 57,240,314 (+) NCBI Celera 3 59,135,961 - 59,152,998 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI
HOXD4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 176,151,550 - 176,153,226 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 176,151,550 - 176,153,226 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 177,016,278 - 177,017,954 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 176,724,359 - 176,726,197 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 176,841,619 - 176,843,454 NCBI Celera 2 170,625,292 - 170,627,130 (+) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 168,892,961 - 168,894,799 (+) NCBI HuRef CHM1_1 2 177,021,982 - 177,023,820 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 176,637,994 - 176,641,368 (+) NCBI T2T-CHM13v2.0
Hoxd4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 74,552,322 - 74,559,504 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 74,542,273 - 74,559,504 (+) Ensembl GRCm39 Ensembl GRCm38 2 74,721,978 - 74,729,160 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 74,711,929 - 74,729,160 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 74,560,035 - 74,567,217 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 74,522,817 - 74,529,999 (+) NCBI MGSCv36 mm8 Celera 2 76,392,107 - 76,399,289 (+) NCBI Celera Cytogenetic Map 2 C3 NCBI cM Map 2 44.13 NCBI
Hoxd4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 20,510,364 - 20,526,353 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 20,510,364 - 20,526,564 (-) NCBI ChiLan1.0 ChiLan1.0
HOXD4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 78,803,640 - 78,820,715 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 78,834,014 - 78,838,533 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 63,429,084 - 63,432,972 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 Ensembl 2B 181,140,175 - 181,141,484 (+) Ensembl panpan1.1 panPan2
HOXD4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ROS_Cfam_1.0 36 20,098,858 - 20,105,489 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 20,101,074 - 20,102,318 (+) Ensembl ROS_Cfam_1.0 Ensembl
Hoxd4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 137,083,433 - 137,089,299 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 5,637,600 - 5,640,917 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 5,637,600 - 5,640,335 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HOXD4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 61,719,985 - 61,731,371 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 61,727,026 - 61,728,332 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 137,878,916 - 137,898,282 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hoxd4
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 75 Interacting mature miRNAs: 93 Transcripts: ENSRNOT00000002145 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1582249 Bw77 Body weight QTL 77 3.2 0.0025 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 64655484 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
UniSTS:480790
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 59,629,609 - 59,631,076 (+) MAPPER mRatBN7.2 Rnor_6.0 3 61,649,150 - 61,650,615 NCBI Rnor6.0 Rnor_5.0 3 68,114,834 - 68,116,299 UniSTS Rnor5.0 RGSC_v3.4 3 57,342,025 - 57,343,490 UniSTS RGSC3.4 Celera 3 59,151,081 - 59,152,546 UniSTS Cytogenetic Map 3 q23 UniSTS
Hoxd4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 59,630,061 - 59,630,750 (+) MAPPER mRatBN7.2 Rnor_6.0 3 61,649,602 - 61,650,289 NCBI Rnor6.0 Rnor_5.0 3 68,115,286 - 68,115,973 UniSTS Rnor5.0 Celera 3 59,151,533 - 59,152,220 UniSTS Cytogenetic Map 3 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
34
55
47
47
18
25
18
6
162
82
35
45
57
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002145 ⟹ ENSRNOP00000002145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 59,614,464 - 59,631,528 (+) Ensembl Rnor_6.0 Ensembl 3 61,634,005 - 61,651,056 (+) Ensembl
RefSeq Acc Id:
NM_001105885 ⟹ NP_001099355
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 80,021,886 - 80,038,948 (+) NCBI mRatBN7.2 3 59,614,464 - 59,631,528 (+) NCBI Rnor_6.0 3 61,634,005 - 61,651,067 (+) NCBI Rnor_5.0 3 68,099,689 - 68,119,265 (+) NCBI RGSC_v3.4 3 57,326,880 - 57,343,942 (+) RGD Celera 3 59,135,961 - 59,152,998 (+) RGD
Sequence:
CATTCTGCTTTCCCAGAGCCTCACCCCCTCTTTTTCTAACCTTTGTCTCTGCAGAGGTGGGCTCTAGTCGCCGGCTGCGGGATCGCGTGGTCCGCAGCGGCCTGGGCTCCCGCCGCGACTCCACGGCA
hide sequence
RefSeq Acc Id:
XM_039104415 ⟹ XP_038960343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 80,035,864 - 80,041,462 (+) NCBI mRatBN7.2 3 59,624,560 - 59,634,042 (+) NCBI
RefSeq Acc Id:
NP_001099355 ⟸ NM_001105885
- UniProtKB:
D4ACE1 (UniProtKB/TrEMBL), A6HMD5 (UniProtKB/TrEMBL)
- Sequence:
MAMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPPGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACSQPTGPKQPPPGTALKQP
hide sequence
Ensembl Acc Id:
ENSRNOP00000002145 ⟸ ENSRNOT00000002145
RefSeq Acc Id:
XP_038960343 ⟸ XM_039104415
- Peptide Label:
isoform X1
- UniProtKB:
D4ACE1 (UniProtKB/TrEMBL), A6HMD5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Hoxd4
homeo box D4
Hoxd4_predicted
homeo box D4 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Hoxd4_predicted
homeo box D4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
