Symbol:
Pon1
Name:
paraoxonase 1
RGD ID:
12664635
Description:
ENCODES a protein that exhibits aryldialkylphosphatase activity (ortholog); INVOLVED IN negative regulation of plasma lipoprotein oxidation (ortholog); response to fatty acid (ortholog); response to fluoride (ortholog); PARTICIPATES IN clopidogrel pharmacodynamics pathway; clopidogrel pharmacokinetics pathway; organophosphate response pathway; ASSOCIATED WITH abdominal aortic aneurysm (ortholog); Acute Coronary Syndrome (ortholog); acute lymphoblastic leukemia (ortholog); FOUND IN extracellular space (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
paraoxonase 1, transcript variant X1; paraoxonase 1, transcript variant X2; serum paraoxonase/arylesterase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PON1 (paraoxonase 1) NCBI
Ortholog
Mus musculus (house mouse):
Pon1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Pon1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pon1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PON1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PON1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PON1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PON1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pon1 (paraoxonase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
SpeTri2.0 - Squirrel SpeTri2.0 Assembly
Position:
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 33,883,628 - 33,908,421 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936585 4,954,869 - 4,979,591 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936585 4,954,871 - 4,979,560 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - SMPDB
Pon1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 33,883,628 - 33,908,421 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936585 4,954,869 - 4,979,591 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936585 4,954,871 - 4,979,560 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PON1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 95,297,676 - 95,324,532 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 95,297,676 - 95,324,532 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 94,926,988 - 94,953,844 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 94,764,924 - 94,791,780 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 94,571,638 - 94,598,495 NCBI Celera 7 89,626,366 - 89,652,590 (-) NCBI Celera Cytogenetic Map 7 q21.3 NCBI HuRef 7 89,534,701 - 89,560,922 (-) NCBI HuRef CHM1_1 7 94,857,684 - 94,883,916 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 96,533,832 - 96,560,687 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 94,256,665 - 94,282,884 (-) NCBI
Pon1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 5,168,101 - 5,193,824 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 5,168,090 - 5,193,946 (-) Ensembl GRCm39 Ensembl GRCm38 6 5,168,090 - 5,193,987 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 5,168,090 - 5,193,946 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 5,118,090 - 5,143,946 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 5,118,105 - 5,143,824 (-) NCBI MGSCv36 mm8 Celera 6 5,314,337 - 5,340,485 (-) NCBI Celera Cytogenetic Map 6 A1 NCBI cM Map 6 1.99 NCBI
Pon1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 34,261,312 - 34,292,327 (-) NCBI GRCr8 mRatBN7.2 4 33,294,737 - 33,325,759 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 33,294,722 - 33,321,360 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 38,253,781 - 38,280,327 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 34,179,920 - 34,206,462 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 32,589,698 - 32,616,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 30,249,749 - 30,276,297 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 30,249,742 - 30,276,372 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 30,156,712 - 30,183,204 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 29,936,314 - 29,964,821 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 29,975,057 - 30,003,299 (-) NCBI Celera 4 28,821,674 - 28,848,125 (-) NCBI Celera Cytogenetic Map 4 q21 NCBI
Pon1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 11,893,473 - 11,923,339 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 11,893,473 - 11,923,035 (-) NCBI ChiLan1.0 ChiLan1.0
PON1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 113,137,448 - 113,164,333 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 161,402,051 - 161,428,972 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 87,253,476 - 87,279,650 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 100,841,286 - 100,867,493 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 100,841,286 - 100,867,493 (-) Ensembl panpan1.1 panPan2
PON1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 20,565,620 - 20,600,774 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 20,565,641 - 20,642,985 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 20,124,634 - 20,159,679 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 20,388,041 - 20,423,054 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 20,388,051 - 20,422,924 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 20,532,696 - 20,567,711 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 20,267,821 - 20,302,851 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 20,525,175 - 20,560,208 (-) NCBI UU_Cfam_GSD_1.0
PON1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 74,926,048 - 74,974,723 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 74,943,646 - 74,974,720 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 82,327,318 - 82,339,633 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PON1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 53,713,434 - 53,739,658 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 53,714,012 - 53,739,875 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 50,595,418 - 50,621,447 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pon1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSSTOT00000011902 ⟹ ENSSTOP00000010674
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source SpeTri2.0 Ensembl NW_004936585 4,954,869 - 4,979,591 (+) Ensembl
RefSeq Acc Id:
XM_005331811 ⟹ XP_005331868
Type:
CODING
Position:
Squirrel Assembly Chr Position (strand) Source HiC_Itri_2 NW_024405118 33,883,628 - 33,908,421 (-) NCBI SpeTri2.0 NW_004936585 4,954,871 - 4,979,560 (+) NCBI
Sequence:
GGCAGGTTGGAGTTCCTAGCGGTCCGTGCATCAAAGTCCATCTGTCCGTTAGTCTGTCCAGGGCCATGGCGAAGCTGACGGTGCTGACCCTCATGGGGCTGGGACTGGCGCTCTTCAGAGATCACCGG
hide sequence
RefSeq Acc Id:
XP_005331868 ⟸ XM_005331811
- UniProtKB:
I3MI68 (UniProtKB/TrEMBL)
- Sequence:
MAKLTVLTLMGLGLALFRDHRSSYEERLNAFREVKPVELPNCNLVKGVEAGSEDIEILPNGLAFISSGLKYPGIKSFEPDKPGKILLMDLNEADPAVLELKITGSKSDLSSFNPHGISTFTDEDNAVY
hide sequence
Ensembl Acc Id:
ENSSTOP00000010674 ⟸ ENSSTOT00000011902
