Advanced Search (OLGA)

Gene: Parp1 (poly (ADP-ribose) polymerase 1) Rattus norvegicus

Analyze

Symbol:

Parp1

Name:

poly (ADP-ribose) polymerase 1

RGD ID:

2053

Description:

Enables several functions, including NAD+ poly-ADP-ribosyltransferase activity; R-SMAD binding activity; and enzyme binding activity. Involved in several processes, including cellular response to amyloid-beta; regulation of gene expression; and regulation of intracellular signal transduction. Located in nucleus. Used to study congestive heart failure; middle cerebral artery infarction; and transient cerebral ischemia. Biomarker of several diseases, including borna disease; cerebrovascular disease (multiple); kidney failure; perinatal necrotizing enterocolitis; and ureteral obstruction. Human ortholog(s) of this gene implicated in several diseases, including arthritis; bacterial meningitis; neurodegenerative disease (multiple); stomach carcinoma; and type 2 diabetes mellitus. Orthologous to human PARP1 (poly(ADP-ribose) polymerase 1); PARTICIPATES IN ADP-ribosylation pathway, mono and poly-ribosylation; base excision repair pathway; INTERACTS WITH (+)-pilocarpine; (+)-sesamin; (-)-anisomycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ADP-ribosyltransferase (NAD+; ADP-ribosyltransferase (NAD+); ADP-ribosyltransferase (NAD+, poly (ADP-ribose) polymerase); ADP-ribosyltransferase 1; ADP-ribosyltransferase diphtheria toxin-like 1; Adprt; ADPRT 1; ARTD1; DNA ADP-ribosyltransferase PARP1; MGC93658; NAD(+) ADP-ribosyltransferase 1; Parp-1; poly (ADP-ribose) polymerase family, member 1; poly (ADP-ribose) polymerase); poly [ADP-ribose] polymerase 1; Poly(ADP-ribose) polymerase; poly(ADP-ribose) polymerase PARP-1; poly(ADP-ribose) polymerase, PARP-1; poly[ADP-ribose] synthase 1; poly[ADP-ribose] synthetase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PARP1 (poly(ADP-ribose) polymerase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Parp1 (poly (ADP-ribose) polymerase family, member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Parp1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PARP1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PARP1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Parp1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PARP1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PARP1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Parp1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Parp1 (poly(ADP-ribose) polymerase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PARP1 (poly(ADP-ribose) polymerase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Parp1 (poly (ADP-ribose) polymerase family, member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	parp1 (poly (ADP-ribose) polymerase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	parp-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	parp-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Parp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	parp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	parp1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	94,839,484 - 94,871,295 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	94,839,433 - 94,871,567 (+)	Ensembl				GRCr8
mRatBN7.2	13	92,307,593 - 92,339,406 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,307,586 - 92,339,404 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	94,812,753 - 94,844,565 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	96,212,939 - 96,244,750 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	93,387,644 - 93,419,455 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	98,857,255 - 98,889,444 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	98,857,177 - 98,889,716 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	103,859,760 - 103,891,949 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	96,309,670 - 96,341,486 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	91,853,812 - 91,885,580 (+)	NCBI		Celera
RGSC_v3.1	13	96,498,605 - 96,530,421 (+)	NCBI
Cytogenetic Map	13	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (ISO)

Acute Experimental Pancreatitis (ISO)

acute kidney failure (ISO)

Acute Lung Injury (ISO)

adult respiratory distress syndrome (ISO)

alopecia (ISO)

Alveolar Bone Loss (ISO)

Alzheimer's disease (ISO)

anemia (ISO)

arthritis (ISO)

asthma (ISO)

atherosclerosis (ISO)

autoimmune disease (ISO)

bacterial meningitis (ISO)

Binge Drinking (IEP)

borna disease (IEP)

Brain Injuries (ISO)

brain ischemia (ISO)

Breast Neoplasms (ISO)

cardiomyopathy (ISO)

Carotid Artery Injuries (IEP)

Colorectal Neoplasms (ISO)

congestive heart failure (IMP)

dermatitis (ISO)

Diabetic Nephropathies (ISO)

diabetic neuropathy (ISO)

Experimental Arthritis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Mammary Neoplasms (IDA)

Fibrosis (ISO)

gastrointestinal stromal tumor (ISO)

glomerulonephritis (ISO)

hepatitis (ISO)

hepatocellular carcinoma (ISO)

hereditary renal cell carcinoma (ISO)

Huntington's disease (ISO)

hyperglycemia (ISO)

idiopathic pulmonary fibrosis (ISO)

Inflammation (ISO)

intellectual disability (ISO)

kidney disease (ISO)

kidney failure (IEP)

kyphosis (ISO)

leiomyoma (IEP)

liver cirrhosis (ISO)

Lung Injury (ISO)

malignant mesothelioma (ISO)

melanoma (ISO)

middle cerebral artery infarction (IDA,IEP,ISO)

multiple myeloma (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (ISO)

Neointima (IMP)

Neoplastic Cell Transformation (ISO)

nephritis (ISO)

neuronal ceroid lipofuscinosis 1 (ISO)

obesity (ISO)

pancreatitis (ISO)

Paralysis (ISO)

Parkinson's disease (ISO)

Parkinsonism (ISO)

perinatal necrotizing enterocolitis (IEP,ISO)

periodontitis (ISO)

periventricular leukomalacia (ISO)

Plaque, Atherosclerotic (ISO)

pneumonia (ISO)

Prostatic Neoplasms (ISO)

pulmonary edema (ISO)

pulmonary fibrosis (ISO)

Reperfusion Injury (IEP,ISO)

Spinal Cord Injuries (IEP,ISO)

Spinal Cord Ischemia (ISO)

Stevens-Johnson syndrome (ISO)

stomach cancer (ISO)

stomach carcinoma (ISO)

systemic lupus erythematosus (ISO)

toxic shock syndrome (ISO)

transient cerebral ischemia (IDA,IEP)

traumatic brain injury (ISO)

type 2 diabetes mellitus (ISO)

ureteral obstruction (IEP)

Vitamin A Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-dexrazoxane (ISO)

(+)-pilocarpine (EXP)

(+)-sesamin (EXP)

(+)-Tetrandrine (ISO)

(-)-anisomycin (EXP)

(-)-bornyl-caffeate (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(-)-gambogic acid (ISO)

(-)-noscapine (ISO)

(-)-selegiline (ISO)

(20R)-protopanaxadiol (ISO)

(20S)-ginsenoside Rg3 (ISO)

(3,4-dihydroxyphenyl)acetic acid (ISO)

(aminomethyl)phosphonic acid (ISO)

(aminooxy)acetic acid (ISO)

(R)-adrenaline (ISO)

(R,R)-tramadol (EXP)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(S)-colchicine (ISO)

(S)-naringenin (ISO)

(S)-nicotine (EXP,ISO)

(S)-ropivacaine (ISO)

1'-acetoxychavicol acetate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1,3-dichloropropan-2-ol (ISO)

1,3-dinitrobenzene (ISO)

1,4-dithiothreitol (ISO)

1,4-naphthoquinone (ISO)

1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone (ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-monopalmitoylglycerol (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone (ISO)

2'-Hydroxy-2,3,5'-trimethoxychalcone (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-D (EXP)

2,5-dimethylcelecoxib (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-amino-2-deoxy-D-galactopyranose (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-arachidonoylglycerol (ISO)

2-bromohexadecanoic acid (ISO)

2-deoxy-D-glucose (ISO)

2-hydroxyethyl methacrylate (ISO)

2-methoxy-17beta-estradiol (ISO)

2-methyl-6-(phenylethynyl)pyridine (ISO)

2-tert-butylhydroquinone (ISO)

2-trans,6-trans,10-trans-geranylgeranyl diphosphate (ISO)

20-hydroxyecdysone (ISO)

25-hydroxycholesterol (ISO)

3',4'-dimethoxyflavone (ISO)

3'-O-(4-Benzoyl)benzoyl ATP (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3'-diindolylmethane (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

3-(1H-indol-3-yl)propanoic acid (ISO)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

3-aminobenzamide (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO)

3-methyladenine (EXP,ISO)

3-methylcholanthrene (EXP)

3-Nitrofluoranthene (ISO)

3-phenylprop-2-enal (ISO)

4'-epidoxorubicin (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(4-chloro-2-methylphenoxy)-N-hydroxybutanamide (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-amino-1,8-naphthalimide (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-methyl-3-[[1-oxo-2-(propylamino)propyl]amino]-2-thiophenecarboxylic acid methyl ester (EXP)

4-Nerolidylcatechol (ISO)

4-phenylbutyric acid (EXP,ISO)

5'-phosphopyridoxal-6-azobenzene-2,4-disulfonic acid (ISO)

5,6-dichloro-1-beta-D-ribofuranosyl-1H-benzimidazole (ISO)

5,7-dihydroxy-4'-methoxyflavone (ISO)

5-aminolevulinic acid (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-(cyclohexylmethoxy)-5-nitrosopyrimidine-2,4-diamine (ISO)

6-aminonicotinamide (ISO)

6-bromoindirubin-3'-oxime (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO)

7,12-dimethyltetraphene (EXP,ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

7-ketocholesterol (EXP)

8-(4-chlorophenylthio)-cAMP (ISO)

9-cis-retinoic acid (ISO)

[6]-Shogaol (ISO)

abexinostat (ISO)

ABT-737 (ISO)

acadesine (ISO)

acenaphthylene (ISO)

acetaldehyde (ISO)

acetochlor (ISO)

acetylleucyl-leucyl-norleucinal (ISO)

acetylsalicylic acid (ISO)

acifluorfen (ISO)

aclacinomycin A (ISO)

acrolein (EXP,ISO)

acrylamide (ISO)

acrylonitrile (ISO)

actinomycin D (ISO)

Aeroplysinin 1 (ISO)

aflatoxin B1 (ISO)

Aflatoxin G1 (ISO)

aflatoxin M1 (ISO)

AH23848 (ISO)

alantolactone (ISO)

alborixin (ISO)

aldehydo-D-glucosamine (ISO)

aldehydo-D-glucose (EXP,ISO)

alendronic acid (ISO)

alginic acid (ISO)

Alisol B (ISO)

all-trans-acitretin (ISO)

all-trans-retinal (ISO)

all-trans-retinoic acid (ISO)

allethrin (EXP)

alloxan (EXP)

alpha,alpha-trehalose (ISO)

alpha-mangostin (ISO)

alpha-naphthoflavone (ISO)

alpha-pinene (ISO)

alpinumisoflavone (ISO)

alprazolam (ISO)

alvocidib (ISO)

AM-251 (ISO)

amiloride (ISO)

aminoguanidine (ISO)

amiodarone (ISO)

ammonia (EXP)

ammonium acetate (EXP)

ammonium chloride (EXP,ISO)

amosite asbestos (ISO)

amphetamine (EXP)

anandamide (ISO)

andrographolide (ISO)

anethole (ISO)

anthocyanin (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

Antimony trioxide (ISO)

antimycin A (ISO)

Antrocin (ISO)

apigenin (ISO)

apocynin (EXP,ISO)

arachidonic acid (ISO)

arachidonyl-2'-chloroethylamide (ISO)

arecoline (ISO)

aristolochic acid A (EXP,ISO)

arjunolic acid (ISO)

Aroclor 1254 (ISO)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

arsenite(3-) (ISO)

arsenous acid (EXP,ISO)

artesunate (ISO)

ARV-825 (ISO)

asbestos (ISO)

Aspidin (ISO)

astilbin (ISO)

atorvastatin calcium (ISO)

ATP (ISO)

Atranorin (ISO)

atrazine (ISO)

aucubin (ISO)

auranofin (ISO)

aurantiamide acetate (ISO)

aureusidin (ISO)

Auriculasin (ISO)

Azoxymethane (ISO)

bafilomycin A1 (EXP,ISO)

baicalin (ISO)

BAPTA (ISO)

Bardoxolone methyl (ISO)

belinostat (ISO)

bellidifolin (ISO)

benomyl (ISO)

benzalkonium chloride (ISO)

benzamide (EXP,ISO)

benzatropine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

Benzo[a]pyrene-7,8-diol (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

Benzo[k]fluoranthene (ISO)

benzoates (ISO)

Benzoyl peroxide (ISO)

berberine (ISO)

beta-carboline (ISO)

beta-cyclodextrin (ISO)

beta-D-glucosamine (ISO)

beta-Elemonic acid (ISO)

beta-ionone (ISO)

betulin (ISO)

betulinic acid (ISO)

bicalutamide (ISO)

bilirubin IXalpha (ISO)

biochanin A (ISO)

bis(2-chloroethyl) sulfide (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP,ISO)

bortezomib (ISO)

bosutinib (ISO)

brassinin (ISO)

brazilin (ISO)

brefeldin A (ISO)

Brusatol (ISO)

bufalin (ISO)

Bufotalin (ISO)

busulfan (ISO)

butein (ISO)

butylated hydroxyanisole (ISO)

Butylbenzyl phthalate (ISO)

butyric acid (ISO)

C.I. Natural Red 20 (ISO)

cabozantinib (ISO)

cadmium acetate (EXP,ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

cadmium telluride (ISO)

caffeine (EXP,ISO)

calciol (ISO)

calcium atom (ISO)

calcium(0) (ISO)

Calpeptin (EXP,ISO)

camptothecin (EXP,ISO)

canagliflozin (ISO)

cannabidiol (ISO)

cantharidic acid (ISO)

cantharidin (ISO)

capillarisin (ISO)

capsaicin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carboplatin (ISO)

Cardamonin (ISO)

carfilzomib (ISO)

carmustine (ISO)

carnosic acid (EXP,ISO)

carnosine (ISO)

Carnosol (ISO)

carteolol (ISO)

casticin (ISO)

CDP-choline (ISO)

celastrol (ISO)

celecoxib (ISO)

cepharanthine (ISO)

cetylpyridinium (ISO)

chalcone (ISO)

chalcones (ISO)

chenodeoxycholic acid (ISO)

chloramphenicol (ISO)

chlordecone (ISO)

chloroacetic acid (ISO)

chloropicrin (ISO)

chloroquine (EXP,ISO)

chlorpyrifos (EXP,ISO)

cholesterol (ISO)

chromium atom (ISO)

chromium(6+) (ISO)

chromone (ISO)

chrysin (EXP,ISO)

ciglitazone (ISO)

cinchocaine (EXP)

Cinobufagin (ISO)

ciprofloxacin (ISO)

cisplatin (EXP,ISO)

citalopram (ISO)

cladribine (ISO)

clobetasol (ISO)

clofarabine (ISO)

clofibric acid (EXP)

clomipramine (ISO)

cobalt atom (ISO)

cobalt dichloride (ISO)

cobimetinib (ISO)

cocaine (EXP,ISO)

colforsin daropate hydrochloride (ISO)

colistin (EXP)

concanamycin A (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cordycepin (EXP,ISO)

coumarin (ISO)

coumarins (ISO)

coumestrol (ISO)

crizotinib (ISO)

crocidolite asbestos (ISO)

crocin-1 (ISO)

Cryptotanshinone (ISO)

crystal violet (ISO)

cucurbitacin E (EXP,ISO)

cucurbitacin I (ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

CX-5461 (ISO)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

cypermethrin (ISO)

cyproconazole (ISO)

cytarabine (ISO)

D-cycloserine (ISO)

D-glucitol (ISO)

D-glucose (EXP,ISO)

D-penicillamine (ISO)

dabrafenib (ISO)

dactolisib (ISO)

daidzein (ISO)

DAPT (EXP)

daunorubicin (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

Decursin (ISO)

deguelin (ISO)

delphinidin (ISO)

demethoxycurcumin (ISO)

demethoxyfumitremorgin C (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

Deoxyshikonin (ISO)

desferrioxamine B (EXP,ISO)

desloratadine (ISO)

Destruxin B (ISO)

dexamethasone (ISO)

dexamethasone phosphate (ISO)

dextran sulfate (ISO)

Diacetoxyscirpenol (ISO)

diallyl disulfide (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (EXP,ISO)

dibenziodolium (EXP,ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dichlorvos (EXP)

diclofenac (ISO)

Dictamnine (ISO)

dicyclanil (ISO)

Didecyldimethylammonium (ISO)

dieldrin (EXP)

diepoxybutane (ISO)

diethyl fumarate (ISO)

diethyl maleate (ISO)

diethyl phthalate (ISO)

dihydrogen (ISO)

dihydroxyacetone (EXP,ISO)

dimethyl maleate (ISO)

dimethyl sulfoxide (ISO)

dimethylarsinous acid (ISO)

dinaciclib (ISO)

dioscin (EXP,ISO)

diosmetin (EXP)

diosmin (ISO)

dioxygen (EXP,ISO)

diprotium (ISO)

diquat (ISO)

disodium selenite (EXP,ISO)

disulfiram (ISO)

divinyl sulfone (ISO)

dizocilpine maleate (EXP)

dopamine (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

Echimidine (ISO)

edaravone (ISO)

elemental selenium (ISO)

ellagic acid (EXP)

ellipticine (ISO)

embelin (ISO)

emetine (ISO)

emodin (ISO)

empagliflozin (EXP)

Enterolactone (ISO)

enzalutamide (ISO)

enzyme inhibitor (ISO)

epalrestat (ISO)

epothilone A (ISO)

epoxomicin (ISO)

erastin (ISO)

erdosteine (EXP,ISO)

erlotinib hydrochloride (ISO)

esculetin (ISO)

etacrynic acid (ISO)

ethanol (EXP,ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (EXP,ISO)

etoposide (EXP,ISO)

eugenol (ISO)

EUK-134 (ISO)

everolimus (ISO)

Evodiamine (ISO)

excitatory amino acid agonist (EXP)

fangchinoline (ISO)

fenvalerate (EXP)

ferric ammonium citrate (ISO)

ferric oxide (ISO)

ferrosoferric oxide (ISO)

fingolimod hydrochloride (ISO)

fisetin (ISO)

flavanone (ISO)

flavanones (ISO)

flavokawain B (ISO)

flavone (ISO)

flavonoids (EXP,ISO)

floxuridine (ISO)

fludioxonil (ISO)

fluoranthene (ISO)

flutamide (EXP)

folic acid (EXP,ISO)

formaldehyde (EXP,ISO)

FR900359 (ISO)

fraxetin (ISO)

frenolicin B (ISO)

friedelin (ISO)

fructose (ISO)

fucoxanthin (ISO)

fulvestrant (ISO)

fumonisin B1 (EXP,ISO)

furazolidone (ISO)

galangin (ISO)

gallic acid (ISO)

gamma-linolenic acid (ISO)

Garcinol (ISO)

gardenin B (ISO)

gefitinib (ISO)

geldanamycin (ISO)

gemcitabine (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

Gentiopicrin (ISO)

Geraniin (ISO)

gingerol (ISO)

ginsenoside Re (ISO)

Ginsenoside Rg5 (ISO)

glabridin (ISO)

glucose (EXP,ISO)

glutathione (ISO)

Glutathione ethyl ester (ISO)

glutinol (ISO)

glycerol 2-phosphate (ISO)

glycochenodeoxycholic acid (ISO)

glyphosate (ISO)

Goe 6976 (ISO)

gold atom (ISO)

gold(0) (ISO)

gossypetin (ISO)

gossypin (ISO)

gossypol (ISO)

GSK2656157 (ISO)

GSK690693 (ISO)

GW 3965 (EXP)

GW 4064 (ISO)

GW 501516 (ISO)

harman (ISO)

harmine (ISO)

Heliotrine (ISO)

hellebrigenin (ISO)

hemin (ISO)

heparin (EXP)

herbimycin (ISO)

hesperidin (EXP)

hexadecanoic acid (EXP,ISO)

homoeriodictyol (ISO)

homovanillic acid (ISO)

Honokiol (ISO)

hydralazine (ISO)

hydrogen peroxide (EXP,ISO)

hydroquinone (ISO)

hydroxamic acid (ISO)

hydroxychloroquine (ISO)

icariside II (ISO)

idarubicin (ISO)

idelalisib (ISO)

Ilimaquinone (ISO)

imipramine (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indole-3-butyric acid (ISO)

indole-3-methanol (ISO)

indometacin (ISO)

iodoacetic acid (ISO)

irinotecan (ISO)

iron atom (ISO)

iron(0) (ISO)

isoalantolactone (ISO)

isobavachalcone (ISO)

Isoliensinine (ISO)

isoliquiritigenin (ISO)

isoprenaline (EXP,ISO)

isoquinoline-1,5-diol (EXP,ISO)

isorhamnetin (ISO)

ivermectin (ISO)

jaceosidin (ISO)

JBIR-99 (ISO)

juglone (ISO)

kaempferol (EXP,ISO)

kahweol (ISO)

kainic acid (EXP)

ketoconazole (ISO)

L-1,4-dithiothreitol (ISO)

L-ascorbic acid (EXP,ISO)

L-ascorbic acid 2-phosphate (ISO)

L-gamma-glutamyl-L-cysteine (EXP)

lactucin (ISO)

lactulose (EXP)

lapatinib (ISO)

lead diacetate (EXP,ISO)

lead(0) (ISO)

lenvatinib (ISO)

LGK974 (ISO)

Licochalcone A (ISO)

Licochalcone B (ISO)

licoricidin (ISO)

Liensinine (ISO)

lignan (ISO)

linderalactone (ISO)

linsidomine (ISO)

lipopolysaccharide (EXP,ISO)

lithium atom (ISO)

lithium chloride (EXP,ISO)

lithium hydride (ISO)

lithocholic acid (ISO)

LM-1685 (ISO)

Lobetyolin (ISO)

Longikaurin A (ISO)

losartan (EXP,ISO)

lovastatin (ISO)

Lupiwighteone (ISO)

luteolin (EXP,ISO)

luteolin 7-O-beta-D-glucoside (ISO)

LY294002 (EXP,ISO)

lycopene (EXP)

lysophosphatidylethanolamine (ISO)

Maduramicin (EXP)

malathion (ISO)

malvidin (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

manumycin A (ISO)

Melarsoprol (ISO)

melatonin (EXP,ISO)

melittin (ISO)

menadione (ISO)

menaquinone (ISO)

mercury atom (ISO)

mercury dichloride (ISO)

mercury(0) (ISO)

mesalamine (ISO)

metformin (EXP,ISO)

methamphetamine (EXP,ISO)

methotrexate (EXP,ISO)

methoxsalen (ISO)

methoxyacetic acid (ISO)

methyl beta-cyclodextrin (ISO)

methyl caffeate (ISO)

methyl methanesulfonate (ISO)

methylglyoxal (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

metipranolol (EXP)

metoclopramide (ISO)

mevalonic acid (ISO)

Mezerein (ISO)

microcystin-LR (EXP,ISO)

mifepristone (ISO)

mitomycin C (ISO)

Mitoquinone (ISO)

MitoTEMPO (ISO)

mitoxantrone (ISO)

MK-2206 (ISO)

monensin A (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monocrotophos (ISO)

morin (ISO)

morpholines (ISO)

morusin (ISO)

myo-inositol hexakisphosphate (ISO)

myricetin (ISO)

myriocin (ISO)

myristicin (ISO)

N(gamma)-nitro-L-arginine methyl ester (ISO)

N(omega)-methyl-L-arginine (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N,N-dimethylformamide (EXP)

N,N-dimethylsphingosine (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-acetylsphingosine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-D-aspartic acid (EXP)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-methyl-N-nitrosourea (EXP,ISO)

N-methylnicotinate (ISO)

N-Nitrosodi-n-butylamine (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosopiperidine (ISO)

N-tosyl-L-phenylalanyl chloromethyl ketone (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (ISO)

NAD zwitterion (EXP,ISO)

NAD(+) (EXP,ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

naringin (ISO)

navitoclax (ISO)

NCX-4040 (ISO)

nectandrin B (ISO)

neoastilbin (ISO)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nickel sulfate (EXP,ISO)

niclosamide (ISO)

nicotinamide (EXP,ISO)

nicotine (EXP,ISO)

nicotinic acid (EXP,ISO)

Niflumic acid (ISO)

nilotinib (ISO)

nimesulide (EXP,ISO)

niraparib (ISO)

nirogacestat (ISO)

nitrates (ISO)

nitric oxide (ISO)

nitroglycerin (ISO)

nitroprusside (ISO)

Nivalenol (ISO)

NMN zwitterion (ISO)

NMS-873 (ISO)

nobiletin (ISO)

nocodazole (ISO)

Nonidet P-40 (ISO)

Nonylphenol (ISO)

NORCANTHARIDIN (ISO)

notoginsenoside R1 (ISO)

NS-398 (EXP,ISO)

Nutlin-3 (ISO)

O-methyleugenol (ISO)

ochratoxin A (ISO)

okadaic acid (ISO)

olaparib (ISO)

oleandrigenin (ISO)

oleanolic acid (ISO)

oleic acid (ISO)

oligopeptide (ISO)

omeprazole (ISO)

omipalisib (ISO)

organoselenium compound (ISO)

oridonin (ISO)

orlistat (ISO)

oroxylin A (ISO)

osimertinib (ISO)

osthole (ISO)

ouabain (ISO)

oxaliplatin (EXP,ISO)

oxidopamine (EXP,ISO)

ozone (ISO)

paclitaxel (ISO)

Paeonol (ISO)

palbociclib (ISO)

pamidronate (ISO)

Panduratin A (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraoxon (ISO)

paraquat (EXP,ISO)

Parthenin (ISO)

PCB138 (ISO)

PD 0325901 (ISO)

PD173074 (ISO)

Pendulone (ISO)

pentachlorophenol (ISO)

pentetic acid (ISO)

Pentoxifylline (ISO)

pepstatin A (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (ISO)

perifosine (ISO)

peroxynitrous acid (ISO)

pevonedistat (ISO)

PF-3758309 (ISO)

phenanthrene (ISO)

phenanthridone (EXP,ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP,ISO)

phenylarsine oxide (ISO)

phenylephrine (EXP)

phloroglucinol (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphoramide mustard (EXP)

phytosphingosine (ISO)

pifithrin-alpha hydrobromide (EXP,ISO)

piperine (ISO)

pirinixic acid (EXP,ISO)

pitavastatin (ISO)

pitavastatin(1-) (ISO)

Plantamajoside (ISO)

platinum (ISO)

platinum(0) (ISO)

platycodin D (ISO)

plumbagin (ISO)

podophyllotoxin (ISO)

ponatinib (ISO)

potassium chromate (ISO)

potassium dichromate (EXP,ISO)

potassium iodide (EXP)

probenecid (ISO)

prodigiosin (ISO)

propofol (ISO)

prostaglandin D2 (EXP,ISO)

prostaglandin E2 (ISO)

prostaglandin J2 (EXP,ISO)

protein kinase inhibitor (ISO)

protosappanin A (EXP)

Pseudolaric acid B (ISO)

pterostilbene (ISO)

puerarin (EXP,ISO)

pyrene (ISO)

pyrethrins (ISO)

pyridaben (ISO)

pyrimidifen (ISO)

pyrroloquinoline quinone (ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-galactopyranoside (ISO)

quercitrin (EXP)

quinacrine (ISO)

quinolines (ISO)

quizartinib (ISO)

rac-1-monopalmitoylglycerol (ISO)

raloxifene (ISO)

ranitidine (ISO)

Reactive blue 2 (ISO)

reactive oxygen species (ISO)

regorafenib (EXP,ISO)

remdesivir (ISO)

resveratrol (EXP,ISO)

riboflavin (ISO)

ricolinostat (ISO)

rifampicin (ISO)

rimonabant (ISO)

ritonavir (ISO)

rocaglamide (ISO)

romidepsin (ISO)

rosmarinic acid (EXP)

rotenone (EXP,ISO)

rottlerin (EXP,ISO)

rubimaillin (ISO)

rucaparib (ISO)

ruthenium atom (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

S-nitroso-N-acetyl-D-penicillamine (ISO)

Salinomycin (ISO)

salubrinal (ISO)

Salvianolic acid A (EXP)

Sanggenon C (ISO)

sapanisertib (ISO)

sappanchalcone (ISO)

Satratoxin H (EXP)

SB 203580 (ISO)

SB 415286 (ISO)

SB 431542 (ISO)

sclareol (ISO)

scoparone (ISO)

scopoletin (EXP)

scutellarin (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

selenium atom (ISO)

selumetinib (ISO)

semilicoisoflavone B (ISO)

senecionine (ISO)

sepantronium (ISO)

serotonin (ISO)

sesquiterpene (ISO)

Shikonin (ISO)

silibinin (ISO)

silicon dioxide (ISO)

simvastatin (EXP,ISO)

sirolimus (EXP,ISO)

skatole (ISO)

SM-164 (ISO)

SNX-2112 (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP,ISO)

sodium fluoride (EXP,ISO)

Sodium salicylate (ISO)

solasodine (ISO)

Soman (EXP)

sorafenib (ISO)

Squamocin (ISO)

staurosporine (EXP,ISO)

streptozocin (EXP,ISO)

styrene oxide (ISO)

succimer (EXP)

sulfonyldimethane (ISO)

sulforaphane (ISO)

sulindac (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

surfactin (ISO)

surfactin C (ISO)

Swertiamarin (ISO)

T-2 toxin (ISO)

talazoparib (ISO)

tamoxifen (ISO)

tanespimycin (EXP,ISO)

tangeretin (ISO)

Tanshinone I (ISO)

taraxasterol (ISO)

Tartrolon D (ISO)

taurine (EXP)

tauroursodeoxycholic acid (ISO)

Tautomycin (ISO)

temozolomide (ISO)

tenofovir disoproxil fumarate (EXP)

teprenone (ISO)

tert-butyl hydroperoxide (EXP,ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

tetramethylpyrazine (ISO)

tetraphene (ISO)

thalidomide (ISO)

thapsigargin (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

theophylline (ISO)

thiabendazole (ISO)

thiram (ISO)

thymoquinone (ISO)

Tiron (ISO)

titanium dioxide (ISO)

Tomentosin (ISO)

toosendanin (ISO)

topotecan (EXP,ISO)

tramadol (EXP)

trametinib (ISO)

tranexamic acid (ISO)

trans-anethole (ISO)

trans-chalcone (ISO)

triazoles (ISO)

tributylstannane (EXP,ISO)

tricetin (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triciribine (ISO)

trifluoperazine (EXP,ISO)

trifluridine (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

triptonide (ISO)

troglitazone (EXP,ISO)

trovafloxacin (ISO)

tungsten (ISO)

tunicamycin (ISO)

ubiquinones (ISO)

ursodeoxycholic acid (ISO)

ursolic acid (ISO)

usnic acid (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vancomycin (EXP)

veliparib (ISO)

vemurafenib (ISO)

venetoclax (ISO)

venom (ISO)

verapamil (ISO)

Vernodalol (ISO)

verteporfin (ISO)

vincaleukoblastine (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

Voacamine (ISO)

vorinostat (ISO)

warfarin (ISO)

wedelolactone (EXP,ISO)

WIN 55212-2 (ISO)

withaferin A (ISO)

wortmannin (ISO)

WP1066 (ISO)

Wuweizisu C (EXP,ISO)

xanthohumol (ISO)

XAV939 (ISO)

Y-27632 (ISO)

ytterbium (ISO)

zearalenone (EXP,ISO)

zebularine (ISO)

zerumbone (ISO)

zinc atom (EXP,ISO)

zinc dichloride (ISO)

zinc oxide (ISO)

zinc pyrithione (ISO)

zinc sulfate (EXP,ISO)

zinc(0) (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA,ISO)

ATP generation from poly-ADP-D-ribose (IEA,ISO,ISS)

base-excision repair (ISO)

behavioral response to cocaine (ISO)

carbohydrate biosynthetic process (IDA)

cellular response to amyloid-beta (IMP)

cellular response to insulin stimulus (IEA,ISO)

cellular response to nerve growth factor stimulus (IDA)

cellular response to oxidative stress (ISO)

cellular response to oxygen-containing compound (IEA)

cellular response to superoxide (ISO)

cellular response to transforming growth factor beta stimulus (IEP)

cellular response to UV (IEA,ISO)

cellular response to zinc ion (IEP)

decidualization (ISO,ISS)

DNA ADP-ribosylation (IEA,ISO,ISS)

DNA damage response (IDA,IEA,ISO,ISS)

DNA metabolic process (ISO)

DNA repair (IEA,ISO)

DNA-templated transcription (IEA)

double-strand break repair (IBA,IEA,ISO,ISS)

establishment of protein localization to chromatin (IEA,ISO,ISS)

immune system process (IEA)

innate immune response (IEA)

mitochondrial DNA metabolic process (ISO)

mitochondrial DNA repair (ISO)

mitochondrion organization (ISO)

negative regulation of adipose tissue development (ISO)

negative regulation of ATP biosynthetic process (IEA,ISO)

negative regulation of cGAS/STING signaling pathway (IEA,ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of innate immune response (IEA,ISO,ISS)

negative regulation of interleukin-17 production (ISO)

negative regulation of telomere maintenance via telomere lengthening (ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

negative regulation of transcription elongation by RNA polymerase II (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (IEA,ISO)

positive regulation of cardiac muscle hypertrophy (IMP)

positive regulation of cellular process (IMP)

positive regulation of DNA-templated transcription, elongation (IEA,ISO)

positive regulation of double-strand break repair via homologous recombination (IEA,ISO,ISS)

positive regulation of intracellular estrogen receptor signaling pathway (IMP)

positive regulation of mitochondrial depolarization (IMP)

positive regulation of myofibroblast differentiation (IMP)

positive regulation of necroptotic process (ISO,ISS)

positive regulation of protein localization to nucleus (IMP)

positive regulation of SMAD protein signal transduction (IMP)

positive regulation of transcription by RNA polymerase II (IEA,IMP,ISO)

protein auto-ADP-ribosylation (IEA,ISO,ISS)

protein autoprocessing (IDA)

protein localization to chromatin (IEA,ISO)

protein poly-ADP-ribosylation (IEA,ISO,ISS)

regulation of base-excision repair (IEA,ISO)

regulation of circadian sleep/wake cycle, non-REM sleep (ISO,ISS)

regulation of growth rate (ISO)

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IMP)

regulation of protein localization (ISO)

regulation of single strand break repair (ISO)

replication fork reversal (IEA,ISO,ISS)

response to aldosterone (IEP)

response to ethanol (IEP)

response to gamma radiation (IEP)

signal transduction involved in regulation of gene expression (IMP)

single strand break repair (IEA,ISO,ISS)

telomere maintenance (ISO)

transforming growth factor beta receptor signaling pathway (IMP)

Cellular Component

chromatin (IEA,ISO,ISS)

chromosome (IEA)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO,ISS)

fibrillar center (IEA,ISO)

mitochondrion (IEA,ISO)

nuclear body (IEA,ISO)

nuclear envelope (IEA,ISO)

nuclear replication fork (IEA,ISO,ISS)

nucleolus (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IDA,IEA,ISO)

protein-containing complex (IEA,ISO)

protein-DNA complex (IEA,ISO)

site of DNA damage (IEA,ISO,ISS)

site of double-strand break (IEA,ISO,ISS)

transcription regulator complex (IEA,ISO)

Molecular Function

catalytic activity (IEA)

chromatin binding (IEA,ISO)

damaged DNA binding (IEA,ISO,ISS)

DNA binding (IEA,ISO)

enzyme activator activity (IEA,ISO)

enzyme binding (IEA,IPI,ISO)

glycosyltransferase activity (IEA)

histone deacetylase binding (IPI)

identical protein binding (IEA,ISO)

metal ion binding (IEA)

NAD binding (IDA,IEA)

NAD DNA ADP-ribosyltransferase activity (IEA,ISO)

NAD+ poly-ADP-ribosyltransferase activity (IBA,IDA,IEA,IMP,ISO)

NAD+-histone H2BE35 glutamate ADP-ribosyltransferase activity (ISO)

NAD+-histone H2BS6 serine ADP-ribosyltransferase activity (IEA,ISO)

NAD+-histone H3S10 serine ADP-ribosyltransferase activity (IEA,ISO)

NAD+-protein mono-ADP-ribosyltransferase activity (IEA,ISO,ISS)

NAD+-protein-aspartate ADP-ribosyltransferase activity (IBA,IEA,ISO,ISS)

NAD+-protein-glutamate ADP-ribosyltransferase activity (IBA,IEA,ISO,ISS)

NAD+-protein-histidine ADP-ribosyltransferase activity (IEA,ISO,ISS)

NAD+-protein-serine ADP-ribosyltransferase activity (IEA,ISO,ISS)

NAD+-protein-tyrosine ADP-ribosyltransferase activity (IEA,ISO,ISS)

non-sequence-specific DNA binding, bending (IEA,ISO)

nuclear estrogen receptor binding (IPI)

nucleosome binding (IEA,ISO,ISS)

nucleotidyltransferase activity (IEA)

pentosyltransferase activity (NAS)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO,ISS)

protein kinase binding (IEA,ISO)

R-SMAD binding (IPI)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

single-strand break-containing DNA binding (IEA,ISO,ISS)

transcription regulator activator activity (IDA)

transferase activity (IEA)

ubiquitin protein ligase binding (IPI)

zinc ion binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

ADP-ribosylation pathway, mono and poly-ribosylation (ISO)

base excision repair pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Beta-amyloid activates PARP causing astrocytic metabolic failure and neuronal death.	Abeti R, etal., Brain. 2011 Jun;134(Pt 6):1658-72. doi: 10.1093/brain/awr104.
2.	Structures and Mechanisms of Enzymes Employed in the Synthesis and Degradation of PARP-Dependent Protein ADP-Ribosylation.	Barkauskaite E, etal., Mol Cell. 2015 Jun 18;58(6):935-46. doi: 10.1016/j.molcel.2015.05.007.
3.	PARP inhibition delays transition of hypertensive cardiopathy to heart failure in spontaneously hypertensive rats.	Bartha E, etal., Cardiovasc Res. 2009 Aug 1;83(3):501-10. doi: 10.1093/cvr/cvp144. Epub 2009 May 14.
4.	Isolation of cDNA encoding full-length rat (Rattus norvegicus) poly (ADP-ribose) polymerase.	Beneke S, etal., Biochem Mol Biol Int 1997 Nov;43(4):755-61.
5.	Genomic structure, conservation and FISH mapping of the Rattus norvegicus Adprt gene.	Beneke S, etal., Cytogenet Genome Res 2002;98(4):298-301.
6.	Chemopreventive effect of a novel oleanane triterpenoid in a chemically induced rodent model of breast cancer.	Bishayee A, etal., Int J Cancer. 2013 Sep 1;133(5):1054-63. doi: 10.1002/ijc.28108. Epub 2013 Mar 29.
7.	Gene knockout or pharmacological inhibition of poly(ADP-ribose) polymerase-1 prevents lung inflammation in a murine model of asthma.	Boulares AH, etal., Am J Respir Cell Mol Biol. 2003 Mar;28(3):322-9.
8.	Association analysis of PARP1 polymorphisms with Parkinson's disease.	Brighina L, etal., Parkinsonism Relat Disord. 2011 Nov;17(9):701-4. Epub 2011 Jul 20.
9.	PARP mediates structural alterations in diabetic cardiomyopathy.	Chiu J, etal., J Mol Cell Cardiol. 2008 Sep;45(3):385-93. Epub 2008 Jul 8.
10.	SNPs in DNA repair genes associated to meningitis and host immune response.	da Silva TA, etal., Mutat Res. 2011 Aug 1;713(1-2):39-47. Epub 2011 May 27.
11.	Role of the poly(ADP-ribose)polymerase activity in vancomycin-induced renal injury.	Dalaklioglu S, etal., Toxicol Lett. 2010 Feb 1;192(2):91-6. doi: 10.1016/j.toxlet.2009.10.002. Epub 2009 Oct 13.
12.	Poly(ADP-ribose) polymerase-1 protects neurons against apoptosis induced by oxidative stress.	Diaz-Hernandez JI, etal., Cell Death Differ. 2007 Jun;14(6):1211-21. Epub 2007 Mar 9.
13.	Intramyocardial administration of chimeric ephrinA1-Fc promotes tissue salvage following myocardial infarction in mice.	Dries JL, etal., J Physiol. 2011 Apr 1;589(Pt 7):1725-40. Epub 2011 Jan 31.
14.	Ischemic brain injury is mediated by the activation of poly(ADP-ribose)polymerase.	Endres M, etal., J Cereb Blood Flow Metab. 1997 Nov;17(11):1143-51.
15.	The orphan receptor NOR1 participates in isoprenaline-induced cardiac hypertrophy by regulating PARP-1.	Feng XJ, etal., Br J Pharmacol. 2015 Jun;172(11):2852-63. doi: 10.1111/bph.13091. Epub 2015 Mar 26.
16.	Partial protection against collagen antibody-induced arthritis in PARP-1 deficient mice.	Garcia S, etal., Arthritis Res Ther. 2006;8(1):R14.
17.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
18.	Modulation of poly(ADP-ribose) polymerase-1 (PARP-1)-mediated oxidative cell injury by ring finger protein 146 (RNF146) in cardiac myocytes.	Gerö D, etal., Mol Med. 2014 Jul 31;20:313-28. doi: 10.2119/molmed.2014.00102.
19.	PARP is activated in human asthma and its inhibition by olaparib blocks house dust mite-induced disease in mice.	Ghonim MA, etal., Clin Sci (Lond). 2015 Dec;129(11):951-62. doi: 10.1042/CS20150122. Epub 2015 Jul 23.
20.	Poly(ADP-ribose) polymerase-1: a novel therapeutic target in necrotizing enterocolitis.	Giannone PJ, etal., Pediatr Res. 2011 Jul;70(1):67-71. doi: 10.1038/pr.2011.292.
21.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
22.	Apoptotic splenocytes drive the autoimmune response to poly(ADP-ribose) polymerase 1 in a murine model of lupus.	Grader-Beck T, etal., J Immunol. 2007 Jan 1;178(1):95-102.
23.	Clinical perspectives of PARP inhibitors.	Graziani G and Szabo C, Pharmacol Res. 2005 Jul;52(1):109-18.
24.	Towards non-surgical therapy for uterine fibroids: catechol-O-methyl transferase inhibitor shrinks uterine fibroid lesions in the Eker rat model.	Hassan MH, etal., Hum Reprod. 2011 Nov;26(11):3008-18. doi: 10.1093/humrep/der280. Epub 2011 Sep 6.
25.	Regulation of myofibroblast differentiation by poly(ADP-ribose) polymerase 1.	Hu B, etal., Am J Pathol. 2013 Jan;182(1):71-83. doi: 10.1016/j.ajpath.2012.09.004.
26.	Poly(ADP-ribose) polymerase 1 is indispensable for transforming growth factor-beta Induced Smad3 activation in vascular smooth muscle cell.	Huang D, etal., PLoS One. 2011;6(10):e27123. doi: 10.1371/journal.pone.0027123. Epub 2011 Oct 31.
27.	Neuronal expression of TATA box-binding protein containing expanded polyglutamine in knock-in mice reduces chaperone protein response by impairing the function of nuclear factor-Y transcription factor.	Huang S, etal., Brain. 2011 Jul;134(Pt 7):1943-58.
28.	Poly(ADP-ribose) polymerase (PARP) polymorphisms associated with nephritis and arthritis in systemic lupus erythematosus.	Hur JW, etal., Rheumatology (Oxford). 2006 Jun;45(6):711-7. Epub 2006 Feb 3.
29.	Interaction between poly(ADP-ribose) polymerase 1 and interleukin 1A genes is associated with Alzheimer's disease risk.	Infante J, etal., Dement Geriatr Cogn Disord. 2007;23(4):215-8. Epub 2007 Feb 9.
30.	Poly (ADP-ribose) polymerase-1 (PARP-1) genetic variants are protective against Parkinson's disease.	Infante J, etal., J Neurol Sci. 2007 May 15;256(1-2):68-70. Epub 2007 Mar 23.
31.	Poly(ADP-ribose) polymerase-1 regulates the progression of autoimmune nephritis in males by inducing necrotic cell death and modulating inflammation.	Jog NR, etal., J Immunol. 2009 Jun 1;182(11):7297-306.
32.	Poly(ADP-ribose)polymerase-1 modulates microglial responses to amyloid beta.	Kauppinen TM, etal., J Neuroinflammation. 2011 Nov 3;8(1):152.
33.	Loss of poly(ADP-ribose) polymerase 1 attenuates renal fibrosis and inflammation during unilateral ureteral obstruction.	Kim J and Padanilam BJ, Am J Physiol Renal Physiol. 2011 Aug;301(2):F450-9. Epub 2011 May 25.
34.	PARP expression is increased in astrocytes but decreased in motor neurons in the spinal cord of sporadic ALS patients.	Kim SH, etal., J Neuropathol Exp Neurol. 2003 Jan;62(1):88-103.
35.	p53- and Bax-mediated apoptosis in injured rat spinal cord.	Kotipatruni RR, etal., Neurochem Res. 2011 Nov;36(11):2063-74. doi: 10.1007/s11064-011-0530-2. Epub 2011 Jul 7.
36.	Carbon monoxide induces hypothermia tolerance in kupffer cells and attenuates liver schemia/reperfusion injury in rats.	Lee LY, etal., Liver Transpl. 2011 Aug 17. doi: 10.1002/lt.22415.
37.	By improving regional cortical blood flow, attenuating mitochondrial dysfunction and sequential apoptosis galangin acts as a potential neuroprotective agent after acute ischemic stroke.	Li S, etal., Molecules. 2012 Nov 9;17(11):13403-23. doi: 10.3390/molecules171113403.
38.	Sex differences in the response to poly(ADP-ribose) polymerase-1 deletion and caspase inhibition after stroke.	Liu F, etal., Stroke. 2011 Apr;42(4):1090-6. Epub 2011 Feb 10.
39.	Evaluation of the poly(ADP-ribose) polymerase-1 gene variants in Alzheimer's disease.	Liu HP, etal., J Clin Lab Anal. 2010;24(3):182-6. doi: 10.1002/jcla.20379.
40.	Neuroprotective potential of erythropoietin and its derivative carbamylated erythropoietin in periventricular leukomalacia.	Liu W, etal., Exp Neurol. 2011 Aug;230(2):227-39. Epub 2011 May 6.
41.	Hypochlorite modified albumins promote cell death in the tubule interstitium in rats via mitochondrial damage in obstructive nephropathy and the protective effects of antioxidant peptides.	Liu ZR, etal., Free Radic Res. 2018 May;52(5):616-628. doi: 10.1080/10715762.2018.1457789.
42.	Role of the activation of the nuclear enzyme poly(ADP-ribose) polymerase in the pathogenesis of periodontitis.	Lohinai Z, etal., J Dent Res. 2003 Dec;82(12):987-92.
43.	PARP1 Stabilizes CTCF Binding and Chromatin Structure To Maintain Epstein-Barr Virus Latency Type.	Lupey-Green LN, etal., J Virol. 2018 Aug 29;92(18). pii: JVI.00755-18. doi: 10.1128/JVI.00755-18. Print 2018 Sep 15.
44.	Misregulation of poly(ADP-ribose) polymerase-1 activity and cell type-specific loss of poly(ADP-ribose) synthesis in the cerebellum of aged rats.	Malanga M, etal., J Neurochem. 2005 May;93(4):1000-9.
45.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
46.	Inhibition of poly(ADP-ribose) polymerase attenuates the severity of acute pancreatitis and associated lung injury.	Mota RA, etal., Lab Invest. 2005 Oct;85(10):1250-62.
47.	Reduced Expression of DNA Damage Repair Genes High Mobility Group Box1 and Poly(ADP-ribose) Polymerase1 in Inactive Carriers of Hepatitis B Virus Infection-A Possible Stage of Viral Integration.	Mukherjee RM, etal., J Clin Exp Hepatol. 2013 Jun;3(2):89-95. doi: 10.1016/j.jceh.2013.04.003. Epub 2013 May 22.
48.	Poly(ADP-ribose) polymerase-1 is a key mediator of cisplatin-induced kidney inflammation and injury.	Mukhopadhyay P, etal., Free Radic Biol Med. 2011 Nov 1;51(9):1774-88. Epub 2011 Aug 17.
49.	Nuclear-translocated Glyceraldehyde-3-phosphate Dehydrogenase Promotes Poly(ADP-ribose) Polymerase-1 Activation during Oxidative/Nitrosative Stress in Stroke.	Nakajima H, etal., J Biol Chem. 2015 Jun 5;290(23):14493-503. doi: 10.1074/jbc.M114.635607. Epub 2015 Apr 16.
50.	Poly (ADP-ribose) polymerase and DNA-dependent protein kinase: differential activation in vivo.	Narang H, etal., J Environ Pathol Toxicol Oncol. 2004;23(1):45-51.
51.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
52.	PARP inhibition or gene deficiency counteracts intraepidermal nerve fiber loss and neuropathic pain in advanced diabetic neuropathy.	Obrosova IG, etal., Free Radic Biol Med. 2008 Mar 15;44(6):972-81. Epub 2007 Oct 3.
53.	Role of poly(ADP-ribose) polymerase activation in endotoxin-induced cardiac collapse in rodents.	Pacher P, etal., Biochem Pharmacol. 2002 Dec 15;64(12):1785-91.
54.	Activation of poly(ADP-ribose) polymerase contributes to the endothelial dysfunction associated with hypertension and aging.	Pacher P, etal., Int J Mol Med 2002 Jun;9(6):659-64.
55.	Zinc promotes the death of hypoxic astrocytes by upregulating hypoxia-induced hypoxia-inducible factor-1alpha expression via poly(ADP-ribose) polymerase-1.	Pan R, etal., CNS Neurosci Ther. 2013 Jul;19(7):511-20. doi: 10.1111/cns.12098. Epub 2013 Apr 13.
56.	Poly(ADP-ribose) polymerase-deficient mice are protected from streptozotocin-induced diabetes.	Pieper AA, etal., Proc Natl Acad Sci U S A 1999 Mar 16;96(6):3059-64.
57.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
58.	SIRT1 promotes cell survival under stress by deacetylation-dependent deactivation of poly(ADP-ribose) polymerase 1.	Rajamohan SB, etal., Mol Cell Biol. 2009 Aug;29(15):4116-29. doi: 10.1128/MCB.00121-09. Epub 2009 May 26.
59.	GOA pipeline	RGD automated data pipeline
60.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
61.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
62.	Poly (ADP-ribose) polymerase-1 haplotypes are associated with coeliac disease.	Rueda B, etal., Int J Immunogenet. 2005 Aug;32(4):245-8.
63.	ROS-mediated PARP activity undermines mitochondrial function after permeability transition pore opening during myocardial ischemia-reperfusion.	Schriewer JM, etal., J Am Heart Assoc. 2013 Apr 18;2(2):e000159. doi: 10.1161/JAHA.113.000159.
64.	Poly(ADP-ribose) polymerase-1 (PARP-1) gene deficiency alleviates diabetic kidney disease.	Shevalye H, etal., Biochim Biophys Acta. 2010 Nov;1802(11):1020-7. doi: 10.1016/j.bbadis.2010.07.004. Epub 2010 Jul 16.
65.	Androgen and PARP-1 regulation of TRPM2 channels after ischemic injury.	Shimizu T, etal., J Cereb Blood Flow Metab. 2013 Oct;33(10):1549-55. doi: 10.1038/jcbfm.2013.105. Epub 2013 Jun 26.
66.	Effect of aging and oxidative/genotoxic stress on poly(ADP-ribose) polymerase-1 activity in rat brain.	Strosznajder RP, etal., Acta Biochim Pol. 2005;52(4):909-14. Epub 2005 Nov 21.
67.	Effect of repetitive daily ethanol intoxication on adult rat brain: significant changes in phospholipase A2 enzyme levels in association with increased PARP-1 indicate neuroinflammatory pathway activation.	Tajuddin NF, etal., Alcohol. 2013 Feb;47(1):39-45. doi: 10.1016/j.alcohol.2012.09.003. Epub 2012 Oct 25.
68.	Poly(ADP-ribose)polymerase activity is reduced in circulating mononuclear cells from type 2 diabetic patients.	Tempera I, etal., J Cell Physiol. 2005 Dec;205(3):387-92.
69.	Bone marrow expression of poly(ADP-ribose) polymerase underlies diabetic neuropathy via hematopoietic-neuronal cell fusion.	Terashima T, etal., FASEB J. 2011 Oct 6.
70.	Expression pattern of apoptosis-related markers in Huntington's disease.	Vis JC, etal., Acta Neuropathol. 2005 Mar;109(3):321-8. Epub 2005 Jan 25.
71.	PolyADP-ribosylation is involved in neurotrophic activity.	Visochek L, etal., J Neurosci. 2005 Aug 10;25(32):7420-8.
72.	PARP1 is required for adhesion molecule expression in atherogenesis.	von Lukowicz T, etal., Cardiovasc Res. 2008 Apr 1;78(1):158-66. Epub 2007 Dec 18.
73.	Hippocampal poly(ADP-Ribose) polymerase 1 and caspase 3 activation in neonatal bornavirus infection.	Williams BL, etal., J Virol. 2008 Feb;82(4):1748-58. Epub 2007 Dec 5.
74.	Increased intranuclear matrix metalloproteinase activity in neurons interferes with oxidative DNA repair in focal cerebral ischemia.	Yang Y, etal., J Neurochem. 2010 Jan;112(1):134-49. Epub 2009 Oct 15.
75.	Effects of PARP-1 deficiency on airway inflammatory cell recruitment in response to LPS or TNF: differential effects on CXCR2 ligands and Duffy Antigen Receptor for Chemokines.	Zerfaoui M, etal., J Leukoc Biol. 2009 Dec;86(6):1385-92. Epub 2009 Sep 10.
76.	Attenuation of neointima formation through the inhibition of DNA repair enzyme PARP-1 in balloon-injured rat carotid artery.	Zhang C, etal., Am J Physiol Heart Circ Physiol. 2004 Aug;287(2):H659-66. Epub 2004 Mar 25.
77.	Poly(ADP-ribose) polymerase 1 is a key regulator of estrogen receptor alpha-dependent gene transcription.	Zhang F, etal., J Biol Chem. 2013 Apr 19;288(16):11348-57. doi: 10.1074/jbc.M112.429134. Epub 2013 Mar 14.
78.	PARP-1 Val762Ala polymorphism, CagA+ H. pylori infection and risk for gastric cancer in Han Chinese population.	Zhang Q, etal., Mol Biol Rep. 2009 Jul;36(6):1461-7. Epub 2008 Aug 21.
79.	Genetic disruption of poly (ADP-ribose) synthetase inhibits the expression of P-selectin and intercellular adhesion molecule-1 in myocardial ischemia/reperfusion injury.	Zingarelli B, etal., Circ Res. 1998 Jul 13;83(1):85-94.

Additional References at PubMed

PMID:1601134	PMID:2508731	PMID:7852410	PMID:9518481	PMID:10082530	PMID:11112786	PMID:11756244	PMID:11906946	PMID:11948190	PMID:12477932	PMID:12675907	PMID:12707040
PMID:12802178	PMID:12870658	PMID:14580948	PMID:14734561	PMID:14754756	PMID:14770035	PMID:14988256	PMID:15158362	PMID:15489334	PMID:15504977	PMID:15517597	PMID:15564335
PMID:15565177	PMID:15607978	PMID:15615785	PMID:15674325	PMID:15777284	PMID:16077187	PMID:16107709	PMID:16181422	PMID:16204795	PMID:16207712	PMID:16627622	PMID:16771873
PMID:17167533	PMID:17177976	PMID:17244536	PMID:17395016	PMID:17396150	PMID:17612561	PMID:17632284	PMID:17766683	PMID:17947304	PMID:17996029	PMID:18053973	PMID:18073140
PMID:18078960	PMID:18516100	PMID:18782186	PMID:18815186	PMID:18945670	PMID:19131967	PMID:19135898	PMID:19225880	PMID:19303849	PMID:19427306	PMID:19513971	PMID:19521970
PMID:19764761	PMID:19796622	PMID:19813144	PMID:19854869	PMID:19946888	PMID:20122899	PMID:20177052	PMID:20399804	PMID:20502958	PMID:21270334	PMID:21375507	PMID:21416227
PMID:21613793	PMID:21635224	PMID:21765948	PMID:22019940	PMID:22153339	PMID:22405498	PMID:22504299	PMID:22555049	PMID:22658674	PMID:22681889	PMID:22736760	PMID:23230272
PMID:23275542	PMID:23382074	PMID:23481255	PMID:23555743	PMID:23994215	PMID:24151909	PMID:24191052	PMID:24270264	PMID:24289924	PMID:24434514	PMID:24449909	PMID:24550317
PMID:24954469	PMID:24988468	PMID:25043379	PMID:25378300	PMID:25440363	PMID:25470037	PMID:25634059	PMID:25749521	PMID:25835215	PMID:25868125	PMID:26165350	PMID:26200703
PMID:26220474	PMID:26344098	PMID:26526840	PMID:26586427	PMID:26963167	PMID:27027354	PMID:27067600	PMID:27248496	PMID:27257257	PMID:27471034	PMID:27686254	PMID:28002403
PMID:28190768	PMID:28656263	PMID:28698869	PMID:29049980	PMID:29128369	PMID:29278652	PMID:29501586	PMID:29608885	PMID:30030529	PMID:30323296	PMID:30356214	PMID:30898999
PMID:31178959	PMID:32139662	PMID:32139900	PMID:32338336	PMID:32357304	PMID:33908150	PMID:34020532	PMID:34738744	PMID:35002525	PMID:35190759	PMID:36728307

Genomics

Comparative Map Data

Parp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	94,839,484 - 94,871,295 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	94,839,433 - 94,871,567 (+)	Ensembl				GRCr8
mRatBN7.2	13	92,307,593 - 92,339,406 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,307,586 - 92,339,404 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	94,812,753 - 94,844,565 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	96,212,939 - 96,244,750 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	93,387,644 - 93,419,455 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	98,857,255 - 98,889,444 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	98,857,177 - 98,889,716 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	103,859,760 - 103,891,949 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	96,309,670 - 96,341,486 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	91,853,812 - 91,885,580 (+)	NCBI		Celera
RGSC_v3.1	13	96,498,605 - 96,530,421 (+)	NCBI
Cytogenetic Map	13	q26	NCBI

PARP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	226,360,691 - 226,408,093 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	226,360,210 - 226,408,154 (-)	Ensembl			hg38	GRCh38
GRCh37	1	226,548,392 - 226,595,794 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	224,615,015 - 224,662,424 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	222,855,240 - 222,902,526	NCBI
Celera	1	199,739,310 - 199,786,722 (-)	NCBI		Celera
Cytogenetic Map	1	q42.12	NCBI
HuRef	1	197,065,678 - 197,113,094 (-)	NCBI		HuRef
CHM1_1	1	227,821,256 - 227,868,667 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	225,548,804 - 225,596,198 (-)	NCBI		T2T-CHM13v2.0

Parp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	180,396,456 - 180,428,564 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	180,396,489 - 180,428,819 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	180,568,891 - 180,600,999 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	180,568,924 - 180,601,254 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	182,499,106 - 182,531,385 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	182,405,650 - 182,437,929 (+)	NCBI		MGSCv36	mm8
Celera	1	187,634,811 - 187,667,071 (+)	NCBI		Celera
Cytogenetic Map	1	H4	NCBI
cM Map	1	84.44	NCBI

Parp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955489	520,875 - 557,615 (-)	Ensembl
ChiLan1.0	NW_004955489	520,875 - 557,609 (-)	NCBI	ChiLan1.0	ChiLan1.0

PARP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	23,130,083 - 23,178,179 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	23,078,568 - 23,126,669 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	201,820,355 - 201,867,673 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	206,812,981 - 206,860,356 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	206,812,981 - 206,860,356 (-)	Ensembl			panPan2	panpan1.1

PARP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	38,503,072 - 38,542,556 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	38,503,067 - 38,542,127 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	37,984,470 - 38,024,231 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	38,336,543 - 38,376,496 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	38,336,478 - 38,376,795 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	38,175,521 - 38,215,272 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	38,182,459 - 38,222,219 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	38,453,305 - 38,493,301 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Parp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	51,599,711 - 51,644,827 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936526	3,102,039 - 3,147,642 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936526	3,102,468 - 3,147,601 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PARP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	14,203,160 - 14,241,196 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	14,203,157 - 14,241,164 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	16,598,164 - 16,636,214 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PARP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	3,350,798 - 3,405,040 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	3,353,198 - 3,400,806 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Parp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	446,647 - 479,069 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624807	446,662 - 478,571 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Parp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	58,901,223 - 58,933,123 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Parp1
178 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	262
Count of miRNA genes:	187
Interacting mature miRNAs:	206
Transcripts:	ENSRNOT00000004232
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

AW535466

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	92,339,436 - 92,339,561 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	98,889,475 - 98,889,599	NCBI	Rnor6.0
Rnor_5.0	13	103,891,980 - 103,892,104	UniSTS	Rnor5.0
RGSC_v3.4	13	96,341,517 - 96,341,641	UniSTS	RGSC3.4
Celera	13	91,885,611 - 91,885,735	UniSTS
RH 3.4 Map	13	629.9	UniSTS
Cytogenetic Map	13	q26	UniSTS

RH129597

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	92,339,328 - 92,339,548 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	98,889,367 - 98,889,586	NCBI	Rnor6.0
Rnor_5.0	13	103,891,872 - 103,892,091	UniSTS	Rnor5.0
RGSC_v3.4	13	96,341,409 - 96,341,628	UniSTS	RGSC3.4
Celera	13	91,885,503 - 91,885,722	UniSTS
RH 3.4 Map	13	627.7	UniSTS
Cytogenetic Map	13	q26	UniSTS

RH94656

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	92,338,912 - 92,339,022 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	98,888,951 - 98,889,060	NCBI	Rnor6.0
Rnor_5.0	13	103,891,456 - 103,891,565	UniSTS	Rnor5.0
RGSC_v3.4	13	96,340,993 - 96,341,102	UniSTS	RGSC3.4
Celera	13	91,885,087 - 91,885,196	UniSTS
Cytogenetic Map	13	q26	UniSTS

RH138341

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	92,336,624 - 92,336,780 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	98,886,663 - 98,886,818	NCBI	Rnor6.0
Rnor_5.0	13	103,889,168 - 103,889,323	UniSTS	Rnor5.0
RGSC_v3.4	13	96,338,705 - 96,338,860	UniSTS	RGSC3.4
Celera	13	91,882,799 - 91,882,954	UniSTS
RH 3.4 Map	13	629.6	UniSTS
Cytogenetic Map	13	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U94340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004232 ⟹ ENSRNOP00000004232

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	94,839,433 - 94,871,567 (+)	Ensembl
mRatBN7.2 Ensembl	13	92,307,586 - 92,339,404 (+)	Ensembl
Rnor_6.0 Ensembl	13	98,857,177 - 98,889,716 (+)	Ensembl

RefSeq Acc Id:

NM_013063 ⟹ NP_037195

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	94,839,484 - 94,871,295 (+)	NCBI
mRatBN7.2	13	92,307,593 - 92,339,406 (+)	NCBI
Rnor_6.0	13	98,857,255 - 98,889,444 (+)	NCBI
Rnor_5.0	13	103,859,760 - 103,891,949 (+)	NCBI
RGSC_v3.4	13	96,309,670 - 96,341,486 (+)	RGD
Celera	13	91,853,812 - 91,885,580 (+)	RGD

Sequence:

show sequence

CGACACGTTAGCGGAGCGGACCGGCGGCGGCGTCTGCCTGCCGCTGCGGCACGAGAGGGAGGAT
GGCGGAGGCCACGGAGAGGCTTTACCGAGTGGAGTACGCTAAGAGCGGGCGCGCCTCTTGCAAG
AAATGCAGCGAGAGTATCCCCAAGGACTCGCTCCGCATGGCCATCATGGTGCAGTCACCCATGT
TCGATGGAAAAGTCCCACACTGGTATCACTTCTCCTGCTTCTGGAAGGTGGGCCACTCCATCCG
GCAGCCTGACACAGAGGTGGACGGGTTCTCTGAGCTGCGGTGGGATGACCAGCAGAAGGTCAAG
AAGACCGCAGAGGCTGGAGGCGTGGCAGGCAAAGGCCAGCATGGAGGTGGCGGCAAGGCGGAGA
AGACGCTGGGCGACTTTGCGGCAGAGTATGCCAAGTCCAACAGGAGCACATGCAAGGGCTGCAT
GGAGAAGATAGAGAAGGGTCAGATGCGCCTGTCCAAGAAGATGCTGGATCCAGAGAAGCCGCAA
CTGGGTATGATTGACCGCTGGTACCATCCAACTTGCTTTGTCAAGAACCGGGACGAGCTGGGCT
TCCGGCCTGAGTACAGTGCCAGCCAGCTCAAGGGCTTTAGCCTCCTCTCTGCAGAAGACAAAGA
AGCTCTGAAGAAGCAGCTCCCGGCAGTCAAGAGTGAAGGAAAGAGAAAATGTGACGAGGTGGAT
GGAATAGATGAAGTAGCCAAAAAGAAATCTAAAAAAGGAAAGGACAAGGAGAGTAGTAAACTGG
AAAAGGCGCTCAAGGCTCAGAACGAGCTGGTCTGGAATATCAAAGATGAGCTGAAGAAAGCCTG
CTCCACCAACGACCTGAAGGAGTTGCTCATCTTCAACCAGCAGCAAGTACCATCTGGAGAGTCC
GCAATCCTGGACCGAGTTGCTGATGGCATGGCGTTTGGGGCCCTTCTGCCCTGCAAGGAGTGTT
CAGGACAGCTGGTTTTTAAGAGCGACGCTTATTACTGTACTGGGGATGTCACTGCCTGGACCAA
GTGCATGGTCAAGACACAGAATCCCAGCCGAAAGGAATGGGTAACTCCAAAGGAATTCCGAGAA
ATATCCTACCTCAAGAAATTAAAGATCAAAAAGCAGGACCGGCTGTTCCCTCCAGAGAGCAGCG
CCCCAGCACCACCAGCACCTCCCGTCTCGATCACCTCCGCACCCACAGCTGTGAACTCCTCTGC
ACCAGCAGACAAACCCCTGTCTAACATGAAGATCCTGACTCTTGGTAAGCTCTCCCAGAACAAG
GACGAAGCAAAGGCCATGATTGAGAAACTCGGAGGCAAGCTGACAGGATCTGCCAACAAGGCCT
CCTTGTGTATCAGCACTAAGAAGGAGGTGGAGAAGATGAGTAAGAAGATGGAGGAAGTGAAAGC
AGCCAATGTTCGAGTCGTGTGTGAGGACTTCCTCCAGGATGTGTCTGCCTCAGCTAAGAGCCTC
CAAGAGCTGCTCTCAGCCCATAGCTTGTCCTCGTGGGGGGCTGAGGTGAAGGTAGAGCCTGGTG
AAGTGGTGGTCCCCAAGGGGAAGTCAGCTGCACCCTCCAAGAAGAGCAAGGGTGCTGTCAAGGA
GGAAGGTGTCAACAAGTCTGAAAAGAGGATGAAACTAACTCTGAAGGGAGGAGCAGCCGTTGAT
CCTGACTCTGGTCTGGAACACTCTGCACATGTCCTGGAGAAAGGCGGGAAGGTGTTCAGTGCCA
CGCTTGGCCTGGTGGACATTGTGAAAGGGACTAACTCCTATTACAAACTGCAACTTCTGGAGTC
CGACAAGGAGAGCAGGTATTGGATCTTCCGGTCCTGGGGCCGAGTGGGCACAGTTATCGGCAGT
AACAAGCTTGAGCAGATGCCGTCCAAAGAGGATGCTGTTGAACACTTCATGAAGTTATACGAAG
AGAAGACTGGAAATGCCTGGCACTCGAAAAACTTCACAAAGTATCCCAAGAAGTTCTACCCTCT
GGAGATTGACTATGGCCAGGACGAAGAGGCAGTAAAGAAGCTGGCGGTGAAGCCTGGCACTAAG
TCGAAGCTGCCGAAGCCGGTGCAGGAGCTCGTCGGGATGATCTTCGACGTGGAGAGCATGAAGA
AGGCCTTGGTGGAGTACGAGATTGACCTTCAGAAGATGCCCTTGGGGAAACTGAGCAGAAGGCA
GATCCAGGCCGCCTACTCTATCCTCAGTGAGGTCCAGCAGGCAGTGTCCCAAGGCAGCAGTGAA
TCTCAGATCCTGGATCTCTCCAATCGCTTCTACACCCTCATCCCCCATGACTTTGGAATGAAGA
AGCCCCCACTTCTGAACAACACAGACAGTGTGCAGGCCAAGGTGGAGATGCTGGACAACCTCCT
GGACATCGAGGTTGCCTATAGTCTTCTCAGGGGTGGGTCTGATGACAGCAGTAAGGACCCCATC
GATGTCAACTATGAGAAGCTCAAAACTGACATTAAGGTGGTTGACAGAGATTCTGAAGAGGCTG
AGGTCATCAGGAAGTATGTGAAGAACACTCACGCGACCACGCACAATGCCTATGACCTGGAAGT
GATAGACATCTTTAAGATAGAGCGAGAGGGAGAGAGCCAACGCTACAAGCCCTTCAGGCAGCTT
CACAACCGGAGACTGCTGTGGCACGGGTCCAGGACCACCAACTTCGCAGGCATCCTGTCACAGG
GTCTGCGGATAGCCCCACCTGAAGCACCTGTGACAGGCTACATGTTTGGGAAAGGAATCTACTT
TGCTGATATGGTGTCCAAAAGTGCGAACTACTGCCACACGTCTCAGGGAGACCCGATTGGCTTA
ATACTGTTGGGAGAAGTTGCCCTTGGAAACATGTACGAACTCAAGCATGCTTCTCACATCAGCA
AGTTACCCAAGGGCAAGCACAGTGTCAAAGGTTTGGGCAAAACCGCCCCTGACCCTTCGGCCAG
CATCACCCTGGATGGTGTAGAGGTTCCGCTGGGAACAGGGATTCCGTCTGGTGTTAATGACACC
TGCCTGCTGTATAACGAGTACATTGTCTACGACATTGCTCAGGTGAATCTGAAGTACCTACTGA
AACTGAAGTTCAATTTCAAGACCTCCTTGTGGTAGAGTGAAGGCGGGCTTTGCCAGCACCCGGG
GCCTAGGGGATAATGCCCCTAGTGCCTCTGCACCAAACACCACAACACCTCAGCCATGCTGCCG
CCTCAGGGTGGCACCCTCACCGAATCTCCTTAGGAAGGACTTTACACAGATAGGTTGCGCTGGA
GTGGGACGGCTGTTTGTGGTTTGTCCAACCAGGCACAGCCGTGACAGACAGCTGGCAGTAGAGG
GAAAGTTGGGGAGAGGTTTTTGTTGTTTGCCTAGACTAGTCCTGAGGGAAGAAACCGCCACGTC
ACAGTCACAATGTCTGCCTTACTGGCTTCCCCAGGGAAGGAAAATGTGCTTCCTCCCTTCTTTC
AAGGGTTCATCTTTGGTTTGATTTTGGCAAAATGTTAAGCATTTATTTTGAGCTAAAAAATAAA
AACTAATTTCATACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037195	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC53544	(Get FASTA)	NCBI Sequence Viewer
	AAH85765	(Get FASTA)	NCBI Sequence Viewer
	CAA46477	(Get FASTA)	NCBI Sequence Viewer
	CAA46478	(Get FASTA)	NCBI Sequence Viewer
	EDL94827	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004232
	ENSRNOP00000004232.3
GenBank Protein	P27008	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037195 ⟸ NM_013063

- UniProtKB:

O35937 (UniProtKB/Swiss-Prot), P27008 (UniProtKB/Swiss-Prot), A6JGH1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEATERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSI
RQPDTEVDGFSELRWDDQQKVKKTAEAGGVAGKGQHGGGGKAEKTLGDFAAEYAKSNRSTCKGC
MEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPTCFVKNRDELGFRPEYSASQLKGFSLLSAEDK
EALKKQLPAVKSEGKRKCDEVDGIDEVAKKKSKKGKDKESSKLEKALKAQNELVWNIKDELKKA
CSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWT
KCMVKTQNPSRKEWVTPKEFREISYLKKLKIKKQDRLFPPESSAPAPPAPPVSITSAPTAVNSS
APADKPLSNMKILTLGKLSQNKDEAKAMIEKLGGKLTGSANKASLCISTKKEVEKMSKKMEEVK
AANVRVVCEDFLQDVSASAKSLQELLSAHSLSSWGAEVKVEPGEVVVPKGKSAAPSKKSKGAVK
EEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLE
SDKESRYWIFRSWGRVGTVIGSNKLEQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYP
LEIDYGQDEEAVKKLAVKPGTKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRR
QIQAAYSILSEVQQAVSQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNTDSVQAKVEMLDNL
LDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLE
VIDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY
FADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSA
SITLDGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

hide sequence

Ensembl Acc Id:

ENSRNOP00000004232 ⟸ ENSRNOT00000004232

Protein Domains

BRCT PADR1 zinc-binding PARP alpha-helical PARP catalytic PARP-type WGR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P27008-F1-model_v2	AlphaFold	P27008	1-1014	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699059

Promoter ID:

EPDNEW_R9584

Type:

initiation region

Name:

Parp1_1

Description:

poly (ADP-ribose) polymerase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	98,857,212 - 98,857,272	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2053	AgrOrtholog
BioCyc Gene	G2FUF-17121	BioCyc
Ensembl Genes	ENSRNOG00000003084	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004232	ENTREZGENE
	ENSRNOT00000004232.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.20.130	UniProtKB/Swiss-Prot
	1.20.142.10	UniProtKB/Swiss-Prot
	2.20.25.630	UniProtKB/Swiss-Prot
	3.30.1740.10	UniProtKB/Swiss-Prot
	3.40.50.10190	UniProtKB/Swiss-Prot
	3.90.228.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7107130	IMAGE-MGC_LOAD
InterPro	ARTD/PARP	UniProtKB/Swiss-Prot
	BRCT_dom	UniProtKB/Swiss-Prot
	BRCT_dom_sf	UniProtKB/Swiss-Prot
	PADR1	UniProtKB/Swiss-Prot
	PADR1_dom_sf	UniProtKB/Swiss-Prot
	PARP	UniProtKB/Swiss-Prot
	PARP1-like_PADR1_N	UniProtKB/Swiss-Prot
	Poly(ADP-ribose)pol_cat_dom	UniProtKB/Swiss-Prot
	Poly(ADP-ribose)pol_reg_dom	UniProtKB/Swiss-Prot
	Poly(ADP-ribose)pol_reg_dom_sf	UniProtKB/Swiss-Prot
	WGR_dom_sf	UniProtKB/Swiss-Prot
	WGR_domain	UniProtKB/Swiss-Prot
	Znf_PARP	UniProtKB/Swiss-Prot
	Znf_PARP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:25591	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93658	IMAGE-MGC_LOAD
NCBI Gene	25591	ENTREZGENE
PANTHER	DNA LIGASE	UniProtKB/Swiss-Prot
	POLY [ADP-RIBOSE] POLYMERASE 1	UniProtKB/Swiss-Prot
Pfam	BRCT	UniProtKB/Swiss-Prot
	PADR1	UniProtKB/Swiss-Prot
	PADR1_N	UniProtKB/Swiss-Prot
	PARP	UniProtKB/Swiss-Prot
	PARP_reg	UniProtKB/Swiss-Prot
	WGR	UniProtKB/Swiss-Prot
	zf-PARP	UniProtKB/Swiss-Prot
PharmGKB	PARP1	RGD
PhenoGen	Parp1	PhenoGen
PIRSF	NAD_ADPRT	UniProtKB/Swiss-Prot
PROSITE	BRCT	UniProtKB/Swiss-Prot
	PADR1	UniProtKB/Swiss-Prot
	PARP_ALPHA_HD	UniProtKB/Swiss-Prot
	PARP_CATALYTIC	UniProtKB/Swiss-Prot
	PARP_ZN_FINGER_1	UniProtKB/Swiss-Prot
	PARP_ZN_FINGER_2	UniProtKB/Swiss-Prot
	WGR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003084	RatGTEx
SMART	BRCT	UniProtKB/Swiss-Prot
	PADR1	UniProtKB/Swiss-Prot
	WGR	UniProtKB/Swiss-Prot
	zf-PARP	UniProtKB/Swiss-Prot
Superfamily-SCOP	ADP-ribosylation	UniProtKB/Swiss-Prot
	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot
	SSF142921	UniProtKB/Swiss-Prot
	SSF47587	UniProtKB/Swiss-Prot
	SSF52113	UniProtKB/Swiss-Prot
UniProt	A6JGH1	ENTREZGENE, UniProtKB/TrEMBL
	O35937	ENTREZGENE
	P27008	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	O35937	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-30	Parp1	poly (ADP-ribose) polymerase 1	Parp1	poly (ADP-ribose) polymerase family, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Parp1	poly (ADP-ribose) polymerase family, member 1	Adprt	ADP-ribosyltransferase 1	Symbol and Name updated	1299863	APPROVED
2002-11-06	Adprt	ADP-ribosyltransferase 1		ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)	Name updated	625702	APPROVED
2002-06-10	Adprt	ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the nucleus	631745
gene_disease	may contribute to the pathogenesis of endothelial dysfunction associated with aging and hypertension	631765
gene_function	binds to DNA breaks where it catalyzes the poly (ADP-ribose) protein modification	631745
gene_homology	gene structure of 23 exons is conserved between rat, human, and mouse homologs	631764
gene_process	plays a role in DNA repair and genomic stability	631745

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)