Advanced Search (OLGA)

Gene: Pde1a (phosphodiesterase 1A) Rattus norvegicus

Analyze

Symbol:

Pde1a

Name:

phosphodiesterase 1A

RGD ID:

68329

Description:

Enables calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity. Involved in cGMP catabolic process; regulation of smooth muscle cell apoptotic process; and regulation of smooth muscle cell proliferation. Located in neuronal cell body. Orthologous to human PDE1A (phosphodiesterase 1A); PARTICIPATES IN protein kinase A (PKA) signaling pathway; calcium/calcium-mediated signaling pathway; purine metabolic pathway; INTERACTS WITH 3',5'-cyclic GMP; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

3'-RACE clone 8 phosphodiesterase 1A; 3'-RACEclone8phosphodiesterase1A; 3-RACE clone 8 phosphodiesterase 1A; 3-RACEclone8phosphodiesterase1A; calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A; dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A; LOC102554725; phosphodiesterase 1A calmodulin-dependent; phosphodiesterase 1A, calmodulin-dependent; uncharacterized LOC102554725

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDE1A (phosphodiesterase 1A)	HGNC	Ensembl, HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Pde1a (phosphodiesterase 1A, calmodulin-dependent)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pde1a (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDE1A (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDE1A (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pde1a (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDE1A (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDE1A (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pde1a (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pde1a (phosphodiesterase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PDE1A (phosphodiesterase 1A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pde1a (phosphodiesterase 1A, calmodulin-dependent)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pde1a (phosphodiesterase 1A, calmodulin-dependent)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PDE2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PDE2	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pde1c	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pde1c	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pde-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pde1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pde1a	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,152,053 - 85,432,289 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	85,154,184 - 85,519,212 (-)	Ensembl				GRCr8
mRatBN7.2	3	64,745,140 - 65,025,178 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	64,747,269 - 65,024,874 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	68,099,398 - 68,377,059 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	76,682,980 - 76,960,616 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	74,430,024 - 74,703,769 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	66,803,247 - 67,263,658 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	66,803,247 - 66,885,094 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	73,362,390 - 73,443,903 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	62,650,092 - 62,928,487 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	64,201,583 - 64,477,508 (-)	NCBI		Celera
RGSC_v3.1	3	62,546,463 - 62,824,859 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Left Ventricular Hypertrophy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3',5'-cyclic GMP (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

8-Br-cAMP (ISO)

acrylamide (EXP)

amitrole (EXP)

ammonium chloride (EXP)

amphotericin B (ISO)

arotinoid acid (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

CHIR 99021 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cortisol (ISO)

Cuprizon (EXP)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

deguelin (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

fosinopril (EXP)

furan (EXP)

indometacin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

L-methionine (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methimazole (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

Muraglitazar (EXP)

nickel atom (ISO)

nitroglycerin (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

olanzapine (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

phenylephrine (EXP)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

troglitazone (EXP)

uranium atom (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

XAV939 (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cGMP catabolic process (IMP)

negative regulation of cAMP/PKA signal transduction (IBA)

regulation of smooth muscle cell apoptotic process (IMP)

regulation of smooth muscle cell proliferation (IMP)

signal transduction (IEA)

Cellular Component

neuronal cell body (IBA,IDA)

sperm flagellum (ISO)

Molecular Function

3',5'-cyclic-AMP phosphodiesterase activity (IEA,ISO)

3',5'-cyclic-GMP phosphodiesterase activity (IEA,ISO)

3',5'-cyclic-nucleotide phosphodiesterase activity (IEA)

calmodulin binding (IEA)

calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity (IBA,IEA,IMP,ISO)

calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

phosphoric diester hydrolase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

protein kinase A (PKA) signaling pathway (ISO)

purine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Differential changes in the expression of cyclic nucleotide phosphodiesterase isoforms in rat brains by chronic treatment with electroconvulsive shock.	Cho CH, etal., Exp Mol Med 2000 Sep 30;32(3):110-4.
2.	Biochemistry and physiology of cyclic nucleotide phosphodiesterases: essential components in cyclic nucleotide signaling.	Conti M and Beavo J, Annu Rev Biochem. 2007;76:481-511.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Role of nuclear Ca2+/calmodulin-stimulated phosphodiesterase 1A in vascular smooth muscle cell growth and survival.	Nagel DJ, etal., Circ Res. 2006 Mar 31;98(6):777-84. Epub 2006 Mar 2.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Gene expression and protein localization of calmodulin-dependent phosphodiesterase in adult rat retina.	Santone R, etal., J Neurosci Res. 2006 Oct;84(5):1020-6.
13.	cGMP-phosphodiesterase activity is up-regulated in response to pressure overload of rat ventricles.	Yanaka N, etal., Biosci Biotechnol Biochem. 2003 May;67(5):973-9.

Additional References at PubMed

PMID:15901640	PMID:19292454	PMID:19672103	PMID:19797176	PMID:20139324	PMID:21078118	PMID:21282562	PMID:22012077	PMID:28910498

Genomics

Comparative Map Data

Pde1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,152,053 - 85,432,289 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	85,154,184 - 85,519,212 (-)	Ensembl				GRCr8
mRatBN7.2	3	64,745,140 - 65,025,178 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	64,747,269 - 65,024,874 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	68,099,398 - 68,377,059 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	76,682,980 - 76,960,616 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	74,430,024 - 74,703,769 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	66,803,247 - 67,263,658 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	66,803,247 - 66,885,094 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	73,362,390 - 73,443,903 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	62,650,092 - 62,928,487 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	64,201,583 - 64,477,508 (-)	NCBI		Celera
RGSC_v3.1	3	62,546,463 - 62,824,859 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

PDE1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	182,140,041 - 182,716,797 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	182,139,968 - 182,523,359 (-)	Ensembl			hg38	GRCh38
GRCh37	2	183,004,768 - 183,388,033 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	182,715,428 - 183,095,710 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	182,832,688 - 183,212,759	NCBI
Celera	2	176,602,916 - 176,983,707 (-)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	174,860,781 - 175,243,522 (-)	NCBI		HuRef
CHM1_1	2	183,010,710 - 183,393,630 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	182,629,098 - 183,205,733 (-)	NCBI		T2T-CHM13v2.0

Pde1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	79,664,797 - 80,026,862 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	79,664,797 - 79,959,802 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	79,834,453 - 80,196,522 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	79,834,453 - 80,129,458 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	79,674,610 - 79,969,569 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	79,635,295 - 79,929,810 (-)	NCBI		MGSCv36	mm8
Celera	2	81,494,586 - 81,789,784 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	47.64	NCBI

Pde1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	14,906,479 - 15,203,313 (+)	Ensembl
ChiLan1.0	NW_004955403	14,906,069 - 15,202,710 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDE1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	84,789,542 - 85,184,965 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	84,804,515 - 85,199,979 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	69,407,511 - 69,798,513 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	187,215,372 - 187,605,421 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	187,215,046 - 187,604,948 (-)	Ensembl			panPan2	panpan1.1

PDE1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	25,250,398 - 25,591,775 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	25,256,314 - 25,578,768 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	25,212,919 - 25,448,739 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	25,410,014 - 25,745,454 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	25,410,016 - 25,732,666 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	25,542,676 - 25,772,033 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	25,472,278 - 25,701,927 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	25,608,455 - 25,838,496 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pde1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	142,265,162 - 142,589,515 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	10,818,912 - 11,142,501 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	10,819,067 - 11,142,964 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDE1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	87,619,067 - 87,966,491 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	87,619,049 - 87,965,068 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	97,009,302 - 97,084,300 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDE1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	67,674,428 - 68,105,662 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	67,715,963 - 67,770,675 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	131,491,332 - 131,895,736 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pde1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624844	3,898,913 - 4,206,706 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624844	3,898,993 - 4,207,596 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pde1a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	57,051,859 - 57,325,909 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pde1a
2314 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	2
Count of miRNA genes:	2
Interacting mature miRNAs:	2
Transcripts:	ENSRNOT00000008872
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

D3Got290

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	64,981,215 - 64,981,438 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	67,284,321 - 67,284,543	NCBI	Rnor6.0
Rnor_6.0	3	67,220,004 - 67,220,226	NCBI	Rnor6.0
Rnor_5.0	3	73,777,626 - 73,777,848	UniSTS	Rnor5.0
Rnor_5.0	3	73,841,903 - 73,842,125	UniSTS	Rnor5.0
RGSC_v3.4	3	62,884,190 - 62,884,412	UniSTS	RGSC3.4
Celera	3	64,435,109 - 64,435,331	UniSTS
Cytogenetic Map	3	q24	UniSTS

RH140302

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	64,918,505 - 64,918,719 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	66,979,304 - 66,979,517	NCBI	Rnor6.0
Rnor_6.0	3	67,133,137 - 67,133,350	NCBI	Rnor6.0
Rnor_5.0	3	73,538,453 - 73,538,666	UniSTS	Rnor5.0
Rnor_5.0	3	73,693,104 - 73,693,317	UniSTS	Rnor5.0
RGSC_v3.4	3	62,820,791 - 62,821,004	UniSTS	RGSC3.4
Celera	3	64,372,632 - 64,372,845	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	159	91	90	59	33	59	6	297	133	11	138	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001431462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_030871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF327836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF327837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF327838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000084299 ⟹ ENSRNOP00000071226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	85,171,213 - 85,219,251 (-)	Ensembl
mRatBN7.2 Ensembl	3	64,764,298 - 64,812,336 (-)	Ensembl
Rnor_6.0 Ensembl	3	66,805,395 - 66,885,085 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090547 ⟹ ENSRNOP00000072275

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	85,154,184 - 85,342,894 (-)	Ensembl
mRatBN7.2 Ensembl	3	64,747,269 - 64,866,718 (-)	Ensembl
Rnor_6.0 Ensembl	3	66,803,247 - 66,885,094 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097071 ⟹ ENSRNOP00000086595

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	64,747,269 - 64,936,422 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099888 ⟹ ENSRNOP00000087351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	85,154,184 - 85,519,212 (-)	Ensembl
mRatBN7.2 Ensembl	3	64,747,269 - 65,024,874 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102686 ⟹ ENSRNOP00000077769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	85,170,212 - 85,219,251 (-)	Ensembl
mRatBN7.2 Ensembl	3	64,764,249 - 64,936,201 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112170 ⟹ ENSRNOP00000076926

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	85,154,184 - 85,432,431 (-)	Ensembl
mRatBN7.2 Ensembl	3	64,747,269 - 65,024,874 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112686 ⟹ ENSRNOP00000091537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	64,747,269 - 64,812,403 (-)	Ensembl

RefSeq Acc Id:

NM_030871 ⟹ NP_110498

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,154,184 - 85,431,778 (-)	NCBI
mRatBN7.2	3	64,747,269 - 65,024,874 (-)	NCBI
Rnor_6.0	3	66,803,247 - 67,263,658 (-)	NCBI
Rnor_5.0	3	73,362,390 - 73,443,903 (-)	NCBI
RGSC_v3.4	3	62,650,092 - 62,928,487 (-)	RGD
Celera	3	64,201,583 - 64,477,508 (-)	RGD

Sequence:

show sequence

GAGGATAGCCTGAACAGTCGGTCAGTAGTACAGTAGCAGCTCACATGTGTGGATTGCTCCCGTG
AGGAACATCATTATGGGCTCTACAGATACAGACATCGAAGAACTGGAAAACGCCACTTACAAGT
ATCTCATTGGAGAACAGACCGAGAAGATGTGGCAACGCCTGAAAGGAATACTAAGATGCTTAGT
GAAGCAGCTGGAGAAAGGTGATGTCAACGTTGTCGACCTAAAGAAGAATATCGAATATGCGGCA
TCTGTACTGGAAGCTGTTTACATCGACGAGACGAGGAGGCTTCTGGATACTGAGGATGAGCTCA
GCGACATTCAGACCGACTCGGTTCCTTCGGAAGTCCGGGACTGGTTGGCTTCAACCTTTACACG
GAAAATGGGGATGACGAAAAAGAAACCCGAGGAAAAACCGAAGTTTCGCAGCATTGTCCACGCT
GTCCAGGCTGGGATTTTTGTGGAAAGGATGTACAGGAAGAACTATCACATGGTTGGTTTGACAT
ATCCTGCAGCTGTCATAGTGACACTCAAGGAAGTTGATAAATGGTCTTTTGATGTATTTGCCTT
AAATGAAGCAAGCGGGGAGCATAGTCTGAAGTTTATGATTTATGAACTATTTACCAGTAATGAT
CTTATCAACCGCTTCAAGATTCCTGTTTCTTGCCTAATTGCCTTTGCAGAAGCTTTAGAAGTTG
GTTACAGCAAGCACAAAAATCCGTATCATAATTTGGTCCATGCAGCTGATGTCACTCAAACTGT
GCATTACATAATGCTTCATACAGGTATCATGCACTGGCTCACTGAACTGGAAATCTTAGCCATG
GTCTTTGCAGCCGCCGTTCATGACTATGAACACACAGGAACTACAAACAACTTCCATATTCAGA
CGAGGTCAGACGTCGCCATTCTGTATAACGACCGCTCAGTTCTTGAGAATCACCATGTCAGCGC
AGCCTACAGACTTATGCAAGAGGAGGAAATGAATATTTTGGTAAATTTATCTAAAGATGACTGG
AGGGATCTTCGGAACTTAGTGATTGAAACGGTCTTAGCAACAGACATGTCAGGCCATTTCCAGC
AAATTAAAAACATAAGAAGCAGCTTGCAGCAGCCTGAAGGGATTGACAGAGCCAAAACGATGTC
CCTGATACTCCACGCAGCCGACATCAGCCACCCAGCCAAAACGTGGAAGCTGCACTACAGGTGG
ACTATGGCCTTAATGGAGGAATTTTTCCTGCAGGGAGACAAAGAAGCTGAATTAGGGCTTCCGT
TTTCTCCACTTTGTGATCGGAAGTCAACGATGGTTGCCCAGTCTCAAATAGGTTTCATTGATTT
CATAGTGGAGCCAACGTTTTCTCTCCTGACAGACTCGACAGAGAAAATTGTTATTCCTCTTATA
GAGGAAGCTTCAAAACCAGAGTCTTCTAACTATGGGGCAAGCAGCTCGTCCACCATGATTGGGT
TCCATGTTGCTGACGCTCTGAGGCGGTCAAACACAAAAGGCTGCATGAGTGATGGGACCTATGC
CCCAGACTACTCTCTGTCAGCTGTGGACCTGAAGAGCTTCAAAAACAACCTGGTGGACATCATT
CAGCAGAACAAGGAGAGGTGGAAAGAGTTGGCTGCCCAAGGCGAACTTGATCTTCATAAGAACT
CAGAAGACTTAGAAGAAAAGCATGCTGACACACATCCATAGGTGTGAACGAACTTTAAGAGTTC
AGTTATTTTAAACACAAGAGGAAAATGAAAGCAGCATGAAAAACATGCAAAGACCTTGATTTTT
CTGCAAAAAAATATATGTTTGGCTCAGGCCATTTTAGTCGACTCCTCCATAAGGAACAAGAGCA
TAAGTTTCACTCTTCTTAGCTCAGCAAAGCAGTACCTGCAAGTTATCATTAGGATTCTGGCTGC
TGTTTCTGCCATCGTTCTCCCTCCATGATTTGGCCATCTTCAATGAAGCCAGAGAAATCTGGAG
ACTTTCAACTTTCCGTCATGTTTGACTTGGCCTGAAGACAGAATGGTTTTCAATGCACTTCTTG
CACCGTGTCACTCAAGAGGACCCACAACCACAC

hide sequence

RefSeq Acc Id:

XM_039105907 ⟹ XP_038961835

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,171,017 - 85,431,630 (-)	NCBI
mRatBN7.2	3	64,764,095 - 65,024,570 (-)	NCBI

RefSeq Acc Id:

XM_039105908 ⟹ XP_038961836

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,152,053 - 85,432,072 (-)	NCBI
mRatBN7.2	3	64,745,140 - 65,025,178 (-)	NCBI

RefSeq Acc Id:

XM_039105909 ⟹ XP_038961837

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,152,053 - 85,343,212 (-)	NCBI
mRatBN7.2	3	64,745,140 - 64,936,276 (-)	NCBI

RefSeq Acc Id:

XM_039105910 ⟹ XP_038961838

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,152,053 - 85,219,333 (-)	NCBI
mRatBN7.2	3	64,745,140 - 64,812,395 (-)	NCBI

RefSeq Acc Id:

XM_063284612 ⟹ XP_063140682

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,152,053 - 85,432,289 (-)	NCBI

RefSeq Acc Id:

XM_063284613 ⟹ XP_063140683

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,171,017 - 85,432,289 (-)	NCBI

RefSeq Acc Id:

XM_063284614 ⟹ XP_063140684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,171,017 - 85,343,217 (-)	NCBI

RefSeq Acc Id:

XM_063284616 ⟹ XP_063140686

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,171,017 - 85,219,336 (-)	NCBI

RefSeq Acc Id:

XM_063284617 ⟹ XP_063140687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,171,017 - 85,431,750 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001418391	(Get FASTA)	NCBI Sequence Viewer
	NP_001418392	(Get FASTA)	NCBI Sequence Viewer
	NP_001418393	(Get FASTA)	NCBI Sequence Viewer
	NP_001418394	(Get FASTA)	NCBI Sequence Viewer
	NP_001418395	(Get FASTA)	NCBI Sequence Viewer
	NP_001418396	(Get FASTA)	NCBI Sequence Viewer
	NP_001418397	(Get FASTA)	NCBI Sequence Viewer
	NP_001418398	(Get FASTA)	NCBI Sequence Viewer
	NP_001418399	(Get FASTA)	NCBI Sequence Viewer
	NP_001418400	(Get FASTA)	NCBI Sequence Viewer
	NP_110498	(Get FASTA)	NCBI Sequence Viewer
	XP_038961835	(Get FASTA)	NCBI Sequence Viewer
	XP_038961836	(Get FASTA)	NCBI Sequence Viewer
	XP_038961837	(Get FASTA)	NCBI Sequence Viewer
	XP_038961838	(Get FASTA)	NCBI Sequence Viewer
	XP_063140682	(Get FASTA)	NCBI Sequence Viewer
	XP_063140683	(Get FASTA)	NCBI Sequence Viewer
	XP_063140684	(Get FASTA)	NCBI Sequence Viewer
	XP_063140686	(Get FASTA)	NCBI Sequence Viewer
	XP_063140687	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG48734	(Get FASTA)	NCBI Sequence Viewer
	AAG48735	(Get FASTA)	NCBI Sequence Viewer
	AAG48736	(Get FASTA)	NCBI Sequence Viewer
	EDL79271	(Get FASTA)	NCBI Sequence Viewer
	EDL79272	(Get FASTA)	NCBI Sequence Viewer
	EDL79273	(Get FASTA)	NCBI Sequence Viewer
	EDL79274	(Get FASTA)	NCBI Sequence Viewer
	EDL79275	(Get FASTA)	NCBI Sequence Viewer
	EDL79276	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071226.2
	ENSRNOP00000072275
	ENSRNOP00000072275.3
	ENSRNOP00000076926
	ENSRNOP00000076926.2
	ENSRNOP00000077769
	ENSRNOP00000077769.2
	ENSRNOP00000087351
	ENSRNOP00000087351.2

RefSeq Acc Id:

NP_110498 ⟸ NM_030871

- UniProtKB:

A0A8I6A416 (UniProtKB/TrEMBL), A6HMM1 (UniProtKB/TrEMBL), Q9EPR9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGSTDTDIEELENATYKYLIGEQTEKMWQRLKGILRCLVKQLEKGDVNVVDLKKNIEYAASVLE
AVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAG
IFVERMYRKNYHMVGLTYPAAVIVTLKEVDKWSFDVFALNEASGEHSLKFMIYELFTSNDLINR
FKIPVSCLIAFAEALEVGYSKHKNPYHNLVHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAA
AVHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNILVNLSKDDWRDLR
NLVIETVLATDMSGHFQQIKNIRSSLQQPEGIDRAKTMSLILHAADISHPAKTWKLHYRWTMAL
MEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDSTEKIVIPLIEEAS
KPESSNYGASSSSTMIGFHVADALRRSNTKGCMSDGTYAPDYSLSAVDLKSFKNNLVDIIQQNK
ERWKELAAQGELDLHKNSEDLEEKHADTHP

hide sequence

Ensembl Acc Id:

ENSRNOP00000072275 ⟸ ENSRNOT00000090547

Ensembl Acc Id:

ENSRNOP00000071226 ⟸ ENSRNOT00000084299

RefSeq Acc Id:	XP_038961836 ⟸ XM_039105908
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038961837 ⟸ XM_039105909
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038961838 ⟸ XM_039105910
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038961835 ⟸ XM_039105907
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000077769 ⟸ ENSRNOT00000102686

Ensembl Acc Id:

ENSRNOP00000086595 ⟸ ENSRNOT00000097071

Ensembl Acc Id:

ENSRNOP00000087351 ⟸ ENSRNOT00000099888

Ensembl Acc Id:

ENSRNOP00000076926 ⟸ ENSRNOT00000112170

Ensembl Acc Id:

ENSRNOP00000091537 ⟸ ENSRNOT00000112686

RefSeq Acc Id:	XP_063140682 ⟸ XM_063284612
- Peptide Label:	isoform X1
- UniProtKB:	Q9EPR9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140683 ⟸ XM_063284613
- Peptide Label:	isoform X2
- UniProtKB:	Q9EPR9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140687 ⟸ XM_063284617
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063140684 ⟸ XM_063284614
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063140686 ⟸ XM_063284616
- Peptide Label:	isoform X8

Protein Domains

PDEase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K2K1-F1-model_v2	AlphaFold	A0A0G2K2K1	1-512	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68329	AgrOrtholog
BioCyc Gene	G2FUF-49229	BioCyc
Ensembl Genes	ENSRNOG00000054212	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000084299.3	UniProtKB/TrEMBL
	ENSRNOT00000090547	ENTREZGENE
	ENSRNOT00000090547.3	UniProtKB/TrEMBL
	ENSRNOT00000099888	ENTREZGENE
	ENSRNOT00000099888.2	UniProtKB/TrEMBL
	ENSRNOT00000102686	ENTREZGENE
	ENSRNOT00000102686.2	UniProtKB/TrEMBL
	ENSRNOT00000112170	ENTREZGENE
	ENSRNOT00000112170.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1300.10	UniProtKB/TrEMBL
InterPro	HD/PDEase_dom	UniProtKB/TrEMBL
	PDEase	UniProtKB/TrEMBL
	PDEase_catalytic_dom	UniProtKB/TrEMBL
	PDEase_catalytic_dom_sf	UniProtKB/TrEMBL
	PDEase_CS	UniProtKB/TrEMBL
	PDEase_N	UniProtKB/TrEMBL
KEGG Report	rno:81529	UniProtKB/TrEMBL
NCBI Gene	81529	ENTREZGENE
PANTHER	CYCLIC NUCLEOTIDE PHOSPHODIESTERASE	UniProtKB/TrEMBL
Pfam	PDEase_I	UniProtKB/TrEMBL
	PDEase_I_N	UniProtKB/TrEMBL
PhenoGen	Pde1a	PhenoGen
PRINTS	PDIESTERASE1	UniProtKB/TrEMBL
PROSITE	PDEASE_I	UniProtKB/TrEMBL
	PDEASE_I_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000054212	RatGTEx
SMART	HDc	UniProtKB/TrEMBL
Superfamily-SCOP	HD-domain/PDEase-like	UniProtKB/TrEMBL
UniProt	A0A0G2JZX9	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K2K1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y792_RAT	UniProtKB/TrEMBL
	A0A8I5Y879	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A416	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A5M3	ENTREZGENE
	A0A8I6GJQ6	ENTREZGENE
	A6HMM1	ENTREZGENE, UniProtKB/TrEMBL
	A6HMM2	ENTREZGENE, UniProtKB/TrEMBL
	A6HMM4	ENTREZGENE, UniProtKB/TrEMBL
	A6HMM5_RAT	UniProtKB/TrEMBL
	Q9EPR9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pde1a	phosphodiesterase 1A	LOC102554725	uncharacterized LOC102554725	Data merged from RGD:7502853	737654	PROVISIONAL
2015-11-30	Pde1a	phosphodiesterase 1A	Pde1a	phosphodiesterase 1A, calmodulin-dependent	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-12-17	LOC102554725	uncharacterized LOC102554725			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Pde1a	phosphodiesterase 1A, calmodulin-dependent		phosphodiesterase 1A	Name updated	1299863	APPROVED
2002-06-10	Pde1a	phosphodiesterase 1A			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)