Symbol:
Krt18
Name:
keratin 18
RGD ID:
619935
Description:
Predicted to enable scaffold protein binding activity. Involved in several processes, including cholangiocyte apoptotic process; hepatocyte differentiation; and response to fructose. Located in external side of plasma membrane; extracellular space; and keratin filament. Part of protein-containing complex. Biomarker of metabolic dysfunction-associated steatohepatitis and metabolic dysfunction-associated steatotic liver disease. Human ortholog(s) of this gene implicated in liver cirrhosis and metabolic dysfunction-associated steatohepatitis. Orthologous to human KRT18 (keratin 18); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CK-18; cytokeratin-18; K18; keratin 18, type I; keratin complex 1, acidic, gene 18; keratin, type I cytoskeletal 18; keratin-18; Krt1-18; MGC109143
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRT18 (keratin 18)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Krt18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Krt18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KRT18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRT18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krt18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRT18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRT18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Krt18 (keratin 18)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KRT18 (keratin 18)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Krt18 (keratin 18)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
krt18a.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
krt18b
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
krt18.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 135,036,168 - 135,039,844 (+) NCBI GRCr8 mRatBN7.2 7 133,157,486 - 133,161,162 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 64,877,631 - 64,879,869 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 7 133,157,475 - 133,161,166 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,918,930 - 134,922,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,148,293 - 137,152,013 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,127,118 - 137,130,838 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,629,455 - 143,633,131 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,629,455 - 143,633,131 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,425,684 - 141,429,360 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 2 79,988,565 - 79,989,008 (+) NCBI Celera 7 129,594,039 - 129,597,715 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Krt18 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of KRT18 mRNA] CTD PMID:31150632 Krt18 Rat (1->4)-beta-D-glucan multiple interactions ISO Krt18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRT18 mRNA CTD PMID:36331819 Krt18 Rat (S)-colchicine decreases expression ISO KRT18 (Homo sapiens) 6480464 Colchicine results in decreased expression of KRT18 protein CTD PMID:11259854 Krt18 Rat 1,2-dichloroethane increases expression ISO Krt18 (Mus musculus) 6480464 ethylene dichloride results in increased expression of KRT18 mRNA CTD PMID:28189721 and PMID:28960355 Krt18 Rat 1,2-dimethylhydrazine multiple interactions ISO Krt18 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRT18 mRNA CTD PMID:22206623 Krt18 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of KRT18 mRNA CTD PMID:17522070 more ... Krt18 Rat 1-naphthyl isothiocyanate multiple interactions ISO Krt18 (Mus musculus) 6480464 O(2)-vinyl-1-(pyrrolidin-1-yl)diazen-1-ium-1 and 2-diolate inhibits the reaction [1-Naphthylisothiocyanate results in increased expression of KRT18 mRNA] CTD PMID:15913567 Krt18 Rat 1-naphthyl isothiocyanate increases expression ISO Krt18 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of KRT18 mRNA CTD PMID:15913567 Krt18 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of KRT18 mRNA CTD PMID:12655037 Krt18 Rat 17beta-estradiol multiple interactions ISO KRT18 (Homo sapiens) 6480464 3 more ... CTD PMID:11179685 more ... Krt18 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KRT18 mRNA and Estradiol results in decreased expression of KRT18 protein CTD PMID:32145629 Krt18 Rat 17beta-estradiol increases expression ISO Krt18 (Mus musculus) 6480464 Estradiol results in increased expression of KRT18 mRNA CTD PMID:19484750 and PMID:39298647 Krt18 Rat 17beta-estradiol increases expression ISO KRT18 (Homo sapiens) 6480464 Estradiol results in increased expression of KRT18 mRNA CTD PMID:11179685 and PMID:19484750 Krt18 Rat 17beta-estradiol decreases expression ISO KRT18 (Homo sapiens) 6480464 Estradiol results in decreased expression of KRT18 mRNA and Estradiol results in decreased expression of KRT18 protein CTD PMID:23019147 more ... Krt18 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO KRT18 (Homo sapiens) 6480464 Metribolone results in increased expression of KRT18 protein CTD PMID:17152098 and PMID:17541959 Krt18 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO KRT18 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of KRT18 mRNA CTD PMID:29581250 Krt18 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Krt18 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Krt18 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Krt18 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KRT18 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Estradiol results in increased expression of KRT18 mRNA] CTD PMID:11179685 Krt18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KRT18 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT18 mRNA CTD PMID:23152189 Krt18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT18 mRNA CTD PMID:20959002 more ... Krt18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Krt18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KRT18 mRNA CTD PMID:21570461 Krt18 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Krt18 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Krt18 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of KRT18 mRNA CTD PMID:21346803 Krt18 Rat 2,6-dimethoxyphenol multiple interactions ISO KRT18 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt18 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of KRT18 mRNA CTD PMID:21346803 Krt18 Rat 2-hydroxypropanoic acid decreases expression ISO KRT18 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KRT18 mRNA CTD PMID:30851411 Krt18 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Krt18 Rat 3,3'-diindolylmethane multiple interactions ISO KRT18 (Homo sapiens) 6480464 3 and 3'-diindolylmethane inhibits the reaction [Estradiol results in increased expression of KRT18 mRNA] CTD PMID:11179685 Krt18 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Krt18 (Mus musculus) 6480464 3 more ... CTD PMID:10751352 Krt18 Rat 3-chloropropane-1,2-diol affects expression EXP 6480464 alpha-Chlorohydrin affects the expression of KRT18 protein and alpha-Chlorohydrin analog affects the expression of KRT18 protein CTD PMID:26597043 Krt18 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KRT18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT18 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KRT18 mRNA CTD PMID:28628672 Krt18 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of KRT18 mRNA CTD PMID:25380136 Krt18 Rat 4,4'-sulfonyldiphenol increases expression ISO Krt18 (Mus musculus) 6480464 bisphenol S results in increased expression of KRT18 mRNA CTD PMID:30951980 Krt18 Rat 4,4'-sulfonyldiphenol affects expression ISO Krt18 (Mus musculus) 6480464 bisphenol S affects the expression of KRT18 mRNA CTD PMID:39298647 Krt18 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of KRT18 mRNA CTD PMID:21346803 Krt18 Rat 4-hydroxyphenyl retinamide increases expression ISO Krt18 (Mus musculus) 6480464 Fenretinide results in increased expression of KRT18 mRNA CTD PMID:28973697 Krt18 Rat 4-hydroxyphenyl retinamide increases expression ISO KRT18 (Homo sapiens) 6480464 Fenretinide results in increased expression of KRT18 protein CTD PMID:17387344 Krt18 Rat 5-fluorouracil multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Fluorouracil co-treated with irinotecan co-treated with vorinostat] results in increased cleavage of KRT18 protein CTD PMID:15754201 Krt18 Rat 5-fluorouracil affects expression ISO KRT18 (Homo sapiens) 6480464 Fluorouracil affects the expression of KRT18 mRNA CTD PMID:34151400 Krt18 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KRT18 mRNA CTD PMID:24780913 and PMID:30047161 Krt18 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KRT18 mRNA CTD PMID:25825206 Krt18 Rat 9-cis-retinoic acid increases expression ISO KRT18 (Homo sapiens) 6480464 Alitretinoin results in increased expression of KRT18 mRNA CTD PMID:17034753 Krt18 Rat ABT-737 increases cleavage ISO Krt18 (Mus musculus) 6480464 ABT-737 results in increased cleavage of KRT18 protein CTD PMID:19010845 Krt18 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KRT18 mRNA CTD PMID:31881176 Krt18 Rat acrolein increases metabolic processing ISO KRT18 (Homo sapiens) 6480464 Acrolein results in increased metabolism of KRT18 protein CTD PMID:20015449 Krt18 Rat acrolein multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of KRT18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of KRT18 mRNA CTD PMID:32699268 Krt18 Rat acrylamide decreases expression ISO Krt18 (Mus musculus) 6480464 Acrylamide results in decreased expression of KRT18 mRNA CTD PMID:35032568 Krt18 Rat actinomycin D multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KRT18 protein CTD PMID:38460933 Krt18 Rat all-trans-4-oxoretinoic acid increases expression ISO KRT18 (Homo sapiens) 6480464 4-oxoretinoic acid results in increased expression of KRT18 mRNA CTD PMID:17034753 Krt18 Rat all-trans-4-oxoretinol increases expression ISO KRT18 (Homo sapiens) 6480464 4-oxoretinol results in increased expression of KRT18 mRNA CTD PMID:17034753 Krt18 Rat all-trans-retinoic acid increases expression ISO KRT18 (Homo sapiens) 6480464 Tretinoin results in increased expression of KRT18 mRNA and Tretinoin results in increased expression of KRT18 protein CTD PMID:17034753 more ... Krt18 Rat all-trans-retinoic acid decreases expression ISO KRT18 (Homo sapiens) 6480464 Tretinoin results in decreased expression of KRT18 mRNA CTD PMID:33167477 Krt18 Rat all-trans-retinoic acid multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Tretinoin co-treated with BMP4 protein] results in increased expression of KRT18 protein CTD PMID:30397335 Krt18 Rat all-trans-retinoic acid multiple interactions ISO Krt18 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of KRT18 mRNA CTD PMID:30951980 Krt18 Rat all-trans-retinoic acid increases expression ISO Krt18 (Mus musculus) 6480464 Tretinoin results in increased expression of KRT18 mRNA and Tretinoin results in increased expression of KRT18 protein CTD PMID:16236135 and PMID:7201471 Krt18 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of KRT18 mRNA CTD PMID:24977338 Krt18 Rat all-trans-retinol increases expression ISO KRT18 (Homo sapiens) 6480464 Vitamin A results in increased expression of KRT18 mRNA CTD PMID:17034753 Krt18 Rat alpha-pinene multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of KRT18 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of KRT18 mRNA CTD PMID:32699268 Krt18 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of KRT18 mRNA CTD PMID:30047161 Krt18 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KRT18 mRNA and Ammonium Chloride affects the expression of KRT18 protein CTD PMID:16483693 Krt18 Rat arachidonic acid multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT18 protein CTD PMID:17034788 Krt18 Rat aristolochic acid A increases expression ISO KRT18 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of KRT18 mRNA CTD PMID:33212167 Krt18 Rat arsane decreases expression ISO KRT18 (Homo sapiens) 6480464 Arsenic results in decreased expression of KRT18 mRNA CTD PMID:11134558 and PMID:12773770 Krt18 Rat arsane multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat arsane affects methylation ISO KRT18 (Homo sapiens) 6480464 Arsenic affects the methylation of KRT18 gene CTD PMID:25304211 Krt18 Rat arsenic atom decreases expression ISO KRT18 (Homo sapiens) 6480464 Arsenic results in decreased expression of KRT18 mRNA CTD PMID:11134558 and PMID:12773770 Krt18 Rat arsenic atom multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat arsenic atom affects methylation ISO KRT18 (Homo sapiens) 6480464 Arsenic affects the methylation of KRT18 gene CTD PMID:25304211 Krt18 Rat arsenous acid decreases response to substance ISO KRT18 (Homo sapiens) 6480464 KRT18 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Krt18 Rat arsenous acid increases expression ISO Krt18 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of KRT18 mRNA CTD PMID:15073043 Krt18 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of KRT18 gene CTD PMID:28931070 Krt18 Rat azoxystrobin decreases expression ISO KRT18 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of KRT18 mRNA CTD PMID:33512557 Krt18 Rat belinostat increases expression ISO KRT18 (Homo sapiens) 6480464 belinostat results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat belinostat multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat benzo[a]pyrene multiple interactions ISO Krt18 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to KRT18 promoter] CTD PMID:19654925 Krt18 Rat benzo[a]pyrene affects methylation ISO KRT18 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KRT18 promoter CTD PMID:27901495 Krt18 Rat benzo[a]pyrene increases expression ISO KRT18 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of KRT18 mRNA and Benzo(a)pyrene results in increased expression of KRT18 protein CTD PMID:20064835 more ... Krt18 Rat benzo[a]pyrene decreases expression ISO KRT18 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of KRT18 mRNA CTD PMID:31255691 Krt18 Rat benzo[a]pyrene multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in decreased expression of KRT18 protein modified form CTD PMID:24464499 Krt18 Rat benzo[a]pyrene increases expression ISO Krt18 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KRT18 mRNA CTD PMID:27195522 Krt18 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KRT18 protein CTD PMID:21467743 Krt18 Rat benzo[a]pyrene decreases expression ISO Krt18 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of KRT18 mRNA CTD PMID:19770486 Krt18 Rat beta-carotene increases expression ISO KRT18 (Homo sapiens) 6480464 beta Carotene results in increased expression of KRT18 mRNA CTD PMID:17034753 Krt18 Rat beta-lapachone increases expression ISO KRT18 (Homo sapiens) 6480464 beta-lapachone results in increased expression of KRT18 mRNA CTD PMID:38218311 Krt18 Rat bis(2-chloroethyl) sulfide multiple interactions ISO Krt18 (Mus musculus) 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of KRT18 mRNA] CTD PMID:16377760 Krt18 Rat bis(2-chloroethyl) sulfide increases expression ISO Krt18 (Mus musculus) 6480464 Mustard Gas results in increased expression of KRT18 mRNA CTD PMID:16377760 Krt18 Rat bis(2-ethylhexyl) phthalate increases expression ISO KRT18 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of KRT18 mRNA CTD PMID:31163220 Krt18 Rat bis(2-ethylhexyl) phthalate increases expression ISO Krt18 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KRT18 mRNA CTD PMID:34319233 Krt18 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of KRT18 mRNA CTD PMID:26496021 Krt18 Rat bisphenol A increases expression ISO KRT18 (Homo sapiens) 6480464 bisphenol A results in increased expression of KRT18 mRNA and bisphenol A results in increased expression of KRT18 protein CTD PMID:34186270 and PMID:36232920 Krt18 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KRT18 mRNA and bisphenol A results in decreased expression of KRT18 protein CTD PMID:32145629 and PMID:33296240 Krt18 Rat bisphenol A increases expression ISO Krt18 (Mus musculus) 6480464 bisphenol A results in increased expression of KRT18 mRNA CTD PMID:30951980 more ... Krt18 Rat bisphenol A affects expression ISO KRT18 (Homo sapiens) 6480464 bisphenol A affects the expression of KRT18 mRNA CTD PMID:30903817 Krt18 Rat bisphenol A multiple interactions ISO KRT18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT18 mRNA CTD PMID:28628672 Krt18 Rat bisphenol A decreases expression ISO KRT18 (Homo sapiens) 6480464 bisphenol A results in decreased expression of KRT18 mRNA CTD PMID:27685785 Krt18 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRT18 mRNA CTD PMID:25181051 and PMID:34947998 Krt18 Rat bisphenol AF increases expression ISO KRT18 (Homo sapiens) 6480464 bisphenol AF results in increased expression of KRT18 protein CTD PMID:34186270 Krt18 Rat Bisphenol B increases expression ISO KRT18 (Homo sapiens) 6480464 bisphenol B results in increased expression of KRT18 protein CTD PMID:34186270 Krt18 Rat bisphenol F increases expression ISO Krt18 (Mus musculus) 6480464 bisphenol F results in increased expression of KRT18 mRNA CTD PMID:30951980 Krt18 Rat bisphenol F multiple interactions ISO Krt18 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of KRT18 mRNA CTD PMID:30951980 Krt18 Rat bufalin increases expression ISO KRT18 (Homo sapiens) 6480464 bufalin results in increased expression of KRT18 protein CTD PMID:23091618 Krt18 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat buta-1,3-diene decreases expression ISO Krt18 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of KRT18 mRNA CTD PMID:21147608 Krt18 Rat Butylbenzyl phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat cadmium dichloride increases expression ISO KRT18 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KRT18 mRNA CTD PMID:12160620 Krt18 Rat cadmium dichloride affects expression ISO KRT18 (Homo sapiens) 6480464 Cadmium Chloride affects the expression of KRT18 mRNA CTD PMID:23828170 Krt18 Rat caffeine decreases expression ISO KRT18 (Homo sapiens) 6480464 Caffeine results in decreased expression of KRT18 protein CTD PMID:31195006 Krt18 Rat caffeine affects phosphorylation ISO KRT18 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of KRT18 protein CTD PMID:35688186 Krt18 Rat calcitriol increases expression ISO KRT18 (Homo sapiens) 6480464 Calcitriol results in increased expression of KRT18 mRNA CTD PMID:26485663 Krt18 Rat cannabidiol increases expression ISO Krt18 (Mus musculus) 6480464 Cannabidiol results in increased expression of KRT18 mRNA CTD PMID:31052254 Krt18 Rat carbon nanotube affects expression ISO KRT18 (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of KRT18 protein CTD PMID:22001959 Krt18 Rat carbon nanotube increases expression ISO Krt18 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Krt18 Rat CGP 52608 multiple interactions ISO KRT18 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRT18 gene] CTD PMID:28238834 Krt18 Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of KRT18 mRNA CTD PMID:17522070 Krt18 Rat chromium trinitrate decreases expression ISO Krt18 (Mus musculus) 6480464 chromium nitrate results in decreased expression of KRT18 protein CTD PMID:22144121 Krt18 Rat ciguatoxin CTX1B affects expression ISO Krt18 (Mus musculus) 6480464 Ciguatoxins affects the expression of KRT18 mRNA CTD PMID:18353800 Krt18 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of KRT18 mRNA CTD PMID:17522070 Krt18 Rat copper(II) sulfate increases expression ISO KRT18 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KRT18 mRNA CTD PMID:19549813 Krt18 Rat coumarin affects phosphorylation ISO KRT18 (Homo sapiens) 6480464 coumarin affects the phosphorylation of KRT18 protein CTD PMID:35688186 Krt18 Rat crocidolite asbestos increases expression ISO Krt18 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of KRT18 protein CTD PMID:28056339 Krt18 Rat cumene multiple interactions ISO Krt18 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of KRT18 mRNA CTD PMID:18648096 Krt18 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of KRT18 mRNA CTD PMID:26577399 Krt18 Rat cyclosporin A decreases expression ISO KRT18 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KRT18 mRNA CTD PMID:34681664 Krt18 Rat cylindrospermopsin increases expression ISO KRT18 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of KRT18 mRNA CTD PMID:24921660 Krt18 Rat DDE decreases expression ISO KRT18 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of KRT18 protein CTD PMID:26186133 Krt18 Rat DDT decreases expression ISO KRT18 (Homo sapiens) 6480464 DDT results in decreased expression of KRT18 protein CTD PMID:26186133 Krt18 Rat deguelin increases expression ISO KRT18 (Homo sapiens) 6480464 deguelin results in increased expression of KRT18 protein CTD PMID:22986522 Krt18 Rat deguelin multiple interactions ISO KRT18 (Homo sapiens) 6480464 deguelin inhibits the reaction [TGFB1 protein results in decreased expression of KRT18 protein] CTD PMID:22986522 Krt18 Rat deoxynivalenol increases expression ISO KRT18 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of KRT18 protein CTD PMID:33890134 Krt18 Rat dexamethasone multiple interactions ISO KRT18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT18 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KRT18 mRNA CTD PMID:28628672 Krt18 Rat diarsenic trioxide increases expression ISO Krt18 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of KRT18 mRNA CTD PMID:15073043 Krt18 Rat diarsenic trioxide decreases response to substance ISO KRT18 (Homo sapiens) 6480464 KRT18 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Krt18 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of KRT18 mRNA CTD PMID:29108742 Krt18 Rat dibenzo[a,l]pyrene decreases expression ISO KRT18 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of KRT18 mRNA CTD PMID:31255691 Krt18 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of KRT18 mRNA CTD PMID:21266533 Krt18 Rat dibutyl phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat dichloroacetic acid increases expression ISO Krt18 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of KRT18 mRNA CTD PMID:28962523 Krt18 Rat diethyl phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of KRT18 mRNA CTD PMID:32341500 Krt18 Rat diethylstilbestrol decreases expression ISO Krt18 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of KRT18 mRNA CTD PMID:15171707 Krt18 Rat diiodine multiple interactions EXP 6480464 [Iodine deficiency co-treated with sodium perchlorate] results in decreased expression of KRT18 protein CTD PMID:30090431 Krt18 Rat diisobutyl phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat diisononyl phthalate multiple interactions ISO Krt18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of KRT18 mRNA CTD PMID:39150890 Krt18 Rat dimercaprol multiple interactions ISO Krt18 (Mus musculus) 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of KRT18 mRNA] CTD PMID:16377760 Krt18 Rat dimethyl sulfoxide multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Dimethyl Sulfoxide co-treated with TGFB1 protein] results in decreased expression of KRT18 mRNA CTD PMID:35366062 Krt18 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of KRT18 mRNA CTD PMID:17481689 Krt18 Rat dimethylarsinic acid increases expression ISO Krt18 (Mus musculus) 6480464 Cacodylic Acid results in increased expression of KRT18 mRNA CTD PMID:32052077 Krt18 Rat dioscin multiple interactions ISO Krt18 (Mus musculus) 6480464 dioscin inhibits the reaction [Acetaminophen results in increased expression of KRT18 protein] and dioscin inhibits the reaction [Ethanol results in increased expression of KRT18 protein] CTD PMID:22939915 and PMID:24146112 Krt18 Rat dioscin multiple interactions EXP 6480464 dioscin inhibits the reaction [Ethanol results in increased expression of KRT18 protein] CTD PMID:24146112 Krt18 Rat dioxygen multiple interactions ISO Krt18 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of KRT18 mRNA CTD PMID:30529165 Krt18 Rat diquat increases expression ISO Krt18 (Mus musculus) 6480464 Diquat results in increased expression of KRT18 mRNA CTD PMID:36851058 Krt18 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of KRT18 mRNA CTD PMID:21551480 Krt18 Rat dorsomorphin multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Krt18 Rat doxorubicin affects response to substance ISO KRT18 (Homo sapiens) 6480464 KRT18 protein affects the susceptibility to Doxorubicin CTD PMID:16928833 Krt18 Rat doxorubicin increases expression ISO KRT18 (Homo sapiens) 6480464 Doxorubicin results in increased expression of KRT18 mRNA CTD PMID:29803840 Krt18 Rat doxorubicin affects expression ISO KRT18 (Homo sapiens) 6480464 Doxorubicin affects the expression of KRT18 protein CTD PMID:29385562 Krt18 Rat elemental selenium increases expression ISO KRT18 (Homo sapiens) 6480464 Selenium results in increased expression of KRT18 mRNA CTD PMID:19244175 Krt18 Rat entinostat increases expression ISO KRT18 (Homo sapiens) 6480464 entinostat results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat entinostat multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat epoxiconazole increases expression ISO Krt18 (Mus musculus) 6480464 epoxiconazole results in increased expression of KRT18 mRNA CTD PMID:35436446 Krt18 Rat erythromycin estolate increases expression EXP 6480464 Erythromycin Estolate results in increased expression of KRT18 mRNA CTD PMID:17522070 Krt18 Rat estramustine increases expression ISO KRT18 (Homo sapiens) 6480464 Estramustine results in increased expression of KRT18 protein CTD PMID:16685278 Krt18 Rat ethanol multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT18 protein CTD PMID:17034788 Krt18 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of KRT18 protein CTD PMID:24146112 Krt18 Rat ethanol multiple interactions EXP 6480464 dioscin inhibits the reaction [Ethanol results in increased expression of KRT18 protein] CTD PMID:24146112 Krt18 Rat ethanol increases expression ISO Krt18 (Mus musculus) 6480464 Ethanol results in increased expression of KRT18 protein and Ethanol results in increased expression of KRT18 protein modified form CTD PMID:24146112 and PMID:24946281 Krt18 Rat ethanol increases expression ISO KRT18 (Homo sapiens) 6480464 Ethanol results in increased expression of KRT18 protein CTD PMID:20621659 Krt18 Rat ethanol multiple interactions ISO Krt18 (Mus musculus) 6480464 cobaltiprotoporphyrin inhibits the reaction [Ethanol results in increased expression of KRT18 protein modified form] more ... CTD PMID:24146112 and PMID:24946281 Krt18 Rat fenofibrate multiple interactions ISO Krt18 (Mus musculus) 6480464 [Fenofibrate co-treated with Diethylnitrosamine] results in increased expression of KRT18 protein CTD PMID:18978307 Krt18 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of KRT18 mRNA CTD PMID:23962444 Krt18 Rat flavone decreases expression ISO KRT18 (Homo sapiens) 6480464 flavone results in decreased expression of KRT18 protein CTD PMID:14750173 Krt18 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat folic acid multiple interactions ISO Krt18 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRT18 mRNA CTD PMID:22206623 Krt18 Rat folic acid increases expression ISO Krt18 (Mus musculus) 6480464 Folic Acid results in increased expression of KRT18 mRNA CTD PMID:25629700 Krt18 Rat fructose increases expression EXP 26884460 Fructose increases expression of Krt18 protein in liver and serum RGD Krt18 Rat fulvestrant multiple interactions ISO KRT18 (Homo sapiens) 6480464 KRT18 protein promotes the reaction [fulvestrant inhibits the reaction [Estradiol results in increased activity of ESR1 protein]] and KRT18 protein promotes the reaction [fulvestrant results in increased degradation of ESR1 protein] CTD PMID:20061804 Krt18 Rat fulvestrant increases methylation ISO KRT18 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of KRT18 gene CTD PMID:31601247 Krt18 Rat fumonisin B1 increases expression ISO Krt18 (Mus musculus) 6480464 fumonisin B1 results in increased expression of KRT18 mRNA CTD PMID:16221962 Krt18 Rat furan increases expression EXP 6480464 furan results in increased expression of KRT18 mRNA CTD PMID:25539665 and PMID:26194646 Krt18 Rat furfural multiple interactions ISO KRT18 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt18 Rat genistein increases expression ISO KRT18 (Homo sapiens) 6480464 Genistein results in increased expression of KRT18 protein CTD PMID:20884965 Krt18 Rat genistein increases expression ISO Krt18 (Mus musculus) 6480464 Genistein results in increased expression of KRT18 mRNA CTD PMID:24365114 Krt18 Rat genistein multiple interactions ISO KRT18 (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in increased expression of KRT18 protein] and ESR2 promotes the reaction [Genistein results in increased expression of KRT18 protein] CTD PMID:20884965 Krt18 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KRT18 mRNA CTD PMID:33387578 Krt18 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of KRT18 mRNA CTD PMID:15345336 Krt18 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of KRT18 mRNA CTD PMID:24395379 Krt18 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of KRT18 mRNA CTD PMID:38314887 Krt18 Rat griseofulvin increases expression ISO Krt18 (Mus musculus) 6480464 Griseofulvin results in increased expression of KRT18 mRNA and Griseofulvin results in increased expression of KRT18 protein CTD PMID:10952237 and PMID:7504119 Krt18 Rat griseofulvin decreases response to substance ISO KRT18 (Homo sapiens) 6480464 KRT18 protein results in decreased susceptibility to Griseofulvin CTD PMID:8770877 Krt18 Rat griseofulvin increases expression ISO KRT18 (Homo sapiens) 6480464 Griseofulvin results in increased expression of KRT18 mRNA CTD PMID:12388748 Krt18 Rat griseofulvin multiple interactions ISO KRT18 (Homo sapiens) 6480464 Griseofulvin promotes the reaction [KRT18 protein binds to KRT18 protein] CTD PMID:12388748 Krt18 Rat heparin increases expression ISO KRT18 (Homo sapiens) 6480464 Heparin results in increased expression of KRT18 protein CTD PMID:15671997 Krt18 Rat hydrazine increases expression EXP 6480464 hydrazine results in increased expression of KRT18 protein CTD PMID:15370871 Krt18 Rat indometacin multiple interactions ISO KRT18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT18 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KRT18 mRNA CTD PMID:28628672 Krt18 Rat irinotecan multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Fluorouracil co-treated with Irinotecan co-treated with Vorinostat] results in increased cleavage of KRT18 protein CTD PMID:15754201 Krt18 Rat iron(III) nitrilotriacetate multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT18 protein CTD PMID:17034788 Krt18 Rat isoprenaline increases expression ISO Krt18 (Mus musculus) 6480464 Isoproterenol results in increased expression of KRT18 mRNA CTD PMID:21335049 Krt18 Rat ivermectin decreases expression ISO KRT18 (Homo sapiens) 6480464 Ivermectin results in decreased expression of KRT18 protein CTD PMID:32959892 Krt18 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of KRT18 protein CTD PMID:36539177 Krt18 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat lipopolysaccharide multiple interactions ISO KRT18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KRT18 mRNA CTD PMID:35811015 Krt18 Rat lovastatin decreases expression ISO Krt18 (Mus musculus) 6480464 Lovastatin results in decreased expression of KRT18 mRNA CTD PMID:20493250 Krt18 Rat manganese atom multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat manganese(0) multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat manganese(II) chloride multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat mercury dibromide increases expression ISO KRT18 (Homo sapiens) 6480464 mercuric bromide results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat mercury dibromide multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of KRT18 mRNA CTD PMID:28935588 and PMID:30467583 Krt18 Rat methapyrilene affects expression EXP 6480464 Methapyrilene affects the expression of KRT18 protein CTD PMID:30467583 Krt18 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of KRT18 mRNA CTD PMID:30047161 Krt18 Rat methotrexate affects expression ISO Krt18 (Mus musculus) 6480464 Methotrexate affects the expression of KRT18 mRNA CTD PMID:18502557 Krt18 Rat methotrexate increases expression ISO KRT18 (Homo sapiens) 6480464 Methotrexate results in increased expression of KRT18 protein CTD PMID:24736981 Krt18 Rat methylarsonic acid decreases expression EXP 6480464 monomethylarsonic acid results in decreased expression of KRT18 mRNA CTD PMID:17481689 Krt18 Rat methylmercury chloride increases expression ISO KRT18 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of KRT18 mRNA CTD PMID:28001369 Krt18 Rat microcystin-LR increases expression ISO Krt18 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of KRT18 mRNA CTD PMID:17654400 Krt18 Rat microcystin-LR multiple interactions ISO KRT18 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [cyanoginosin LR results in increased phosphorylation of KRT18 protein] and U 0126 inhibits the reaction [cyanoginosin LR results in increased phosphorylation of KRT18 protein] CTD PMID:22960429 Krt18 Rat microcystin-LR increases phosphorylation ISO KRT18 (Homo sapiens) 6480464 cyanoginosin LR results in increased phosphorylation of KRT18 protein CTD PMID:22960429 Krt18 Rat N-butyl-N-(4-hydroxybutyl)nitrosamine decreases expression ISO Krt18 (Mus musculus) 6480464 Butylhydroxybutylnitrosamine results in decreased expression of KRT18 protein CTD PMID:24998975 Krt18 Rat N-nitrosodiethylamine multiple interactions ISO Krt18 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of KRT18 protein and [Fenofibrate co-treated with Diethylnitrosamine] results in increased expression of KRT18 protein CTD PMID:18978307 and PMID:20101389 Krt18 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of KRT18 protein CTD PMID:20935162 Krt18 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KRT18 mRNA more ... CTD PMID:19409407 more ... Krt18 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of KRT18 mRNA CTD PMID:17072980 and PMID:25380136 Krt18 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of KRT18 protein CTD PMID:19716841 Krt18 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat nevirapine increases expression ISO KRT18 (Homo sapiens) 6480464 Nevirapine results in increased expression of KRT18 protein CTD PMID:19152342 Krt18 Rat nickel atom decreases expression ISO KRT18 (Homo sapiens) 6480464 Nickel results in decreased expression of KRT18 mRNA CTD PMID:24768652 and PMID:25583101 Krt18 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of KRT18 mRNA CTD PMID:33484710 Krt18 Rat Nutlin-3 multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KRT18 protein CTD PMID:38460933 Krt18 Rat nystatin increases expression ISO Krt18 (Mus musculus) 6480464 Nystatin results in increased expression of KRT18 mRNA CTD PMID:22863853 Krt18 Rat obeticholic acid multiple interactions ISO Krt18 (Mus musculus) 6480464 [Dietary Fats co-treated with obeticholic acid] results in decreased expression of KRT18 mRNA CTD PMID:35267068 Krt18 Rat octreotide multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Octreotide results in increased activity of SSTR2 protein] which results in increased expression of KRT18 protein modified form CTD PMID:16954443 Krt18 Rat oxybenzone decreases expression EXP 6480464 oxybenzone results in decreased expression of KRT18 mRNA CTD PMID:30316929 Krt18 Rat ozone multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of KRT18 mRNA more ... CTD PMID:32699268 Krt18 Rat ozone multiple interactions ISO Krt18 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of KRT18 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of KRT18 mRNA CTD PMID:34911549 Krt18 Rat p-chloromercuribenzoic acid increases expression ISO KRT18 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat p-chloromercuribenzoic acid multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat paclitaxel increases expression ISO KRT18 (Homo sapiens) 6480464 Paclitaxel results in increased expression of KRT18 protein modified form CTD PMID:22907900 Krt18 Rat panobinostat multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat panobinostat increases expression ISO KRT18 (Homo sapiens) 6480464 panobinostat results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat paracetamol decreases response to substance ISO KRT18 (Homo sapiens) 6480464 KRT18 protein results in decreased susceptibility to Acetaminophen CTD PMID:8770877 Krt18 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KRT18 mRNA CTD PMID:33387578 Krt18 Rat paracetamol increases expression ISO KRT18 (Homo sapiens) 6480464 Acetaminophen results in increased expression of KRT18 protein CTD PMID:38521541 Krt18 Rat paracetamol multiple interactions ISO Krt18 (Mus musculus) 6480464 dioscin inhibits the reaction [Acetaminophen results in increased expression of KRT18 protein] CTD PMID:22939915 Krt18 Rat paracetamol increases expression ISO Krt18 (Mus musculus) 6480464 Acetaminophen results in increased expression of KRT18 protein CTD PMID:22939915 Krt18 Rat paracetamol decreases expression ISO KRT18 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KRT18 mRNA CTD PMID:21420995 Krt18 Rat paracetamol increases cleavage ISO Krt18 (Mus musculus) 6480464 Acetaminophen results in increased cleavage of KRT18 protein CTD PMID:19783637 Krt18 Rat paracetamol affects expression ISO Krt18 (Mus musculus) 6480464 Acetaminophen affects the expression of KRT18 mRNA CTD PMID:17562736 Krt18 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of KRT18 mRNA CTD PMID:32680482 Krt18 Rat pentachlorophenol increases expression ISO Krt18 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of KRT18 mRNA CTD PMID:23892564 Krt18 Rat perfluorobutyric acid increases expression ISO Krt18 (Mus musculus) 6480464 perfluorobutyric acid results in increased expression of KRT18 mRNA CTD PMID:34474067 Krt18 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Krt18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRT18 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of KRT18 mRNA CTD PMID:36331819 Krt18 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of KRT18 mRNA CTD PMID:19162173 Krt18 Rat perfluorooctanoic acid affects methylation ISO KRT18 (Homo sapiens) 6480464 perfluorooctanoic acid affects the methylation of KRT18 gene CTD PMID:35266797 Krt18 Rat perfluorooctanoic acid increases expression ISO Krt18 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of KRT18 protein CTD PMID:37422089 Krt18 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of KRT18 mRNA CTD PMID:31324951 Krt18 Rat phenobarbital multiple interactions ISO Krt18 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of KRT18 mRNA] CTD PMID:19482888 Krt18 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KRT18 mRNA more ... CTD PMID:19409407 and PMID:20935162 Krt18 Rat phenobarbital increases expression ISO Krt18 (Mus musculus) 6480464 Phenobarbital results in increased expression of KRT18 mRNA CTD PMID:19482888 and PMID:33398415 Krt18 Rat phenylmercury acetate increases expression ISO KRT18 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of KRT18 mRNA CTD PMID:26272509 Krt18 Rat phenylmercury acetate multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Krt18 (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT18 mRNA CTD PMID:16368122 Krt18 Rat phosgene affects expression ISO Krt18 (Mus musculus) 6480464 Phosgene affects the expression of KRT18 mRNA CTD PMID:16300373 Krt18 Rat picoxystrobin decreases expression ISO KRT18 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of KRT18 mRNA CTD PMID:33512557 Krt18 Rat piperonyl butoxide multiple interactions ISO Krt18 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of KRT18 protein CTD PMID:20101389 Krt18 Rat pirinixic acid decreases expression ISO Krt18 (Mus musculus) 6480464 pirinixic acid results in decreased expression of KRT18 mRNA CTD PMID:17426115 and PMID:18445702 Krt18 Rat pirinixic acid increases expression ISO Krt18 (Mus musculus) 6480464 pirinixic acid results in increased expression of KRT18 mRNA CTD PMID:16221962 Krt18 Rat potassium chromate decreases expression ISO Krt18 (Mus musculus) 6480464 potassium chromate(VI) results in decreased expression of KRT18 protein CTD PMID:22144121 Krt18 Rat procymidone increases expression EXP 6480464 procymidone results in increased expression of KRT18 mRNA CTD PMID:15686871 Krt18 Rat progesterone multiple interactions ISO Krt18 (Mus musculus) 6480464 NCOA2 protein affects the reaction [Progesterone results in decreased expression of KRT18 mRNA] CTD PMID:17556502 Krt18 Rat progesterone decreases expression ISO KRT18 (Homo sapiens) 6480464 Progesterone results in decreased expression of KRT18 mRNA CTD PMID:21795739 Krt18 Rat progesterone decreases expression ISO Krt18 (Mus musculus) 6480464 Progesterone results in decreased expression of KRT18 mRNA CTD PMID:17556502 Krt18 Rat pyrimidifen decreases expression ISO KRT18 (Homo sapiens) 6480464 pyrimidifen results in decreased expression of KRT18 mRNA CTD PMID:33512557 Krt18 Rat pyrogallol increases expression ISO Krt18 (Mus musculus) 6480464 Pyrogallol results in increased expression of KRT18 mRNA CTD PMID:20362636 Krt18 Rat quartz decreases expression ISO KRT18 (Homo sapiens) 6480464 Quartz results in decreased expression of KRT18 protein CTD PMID:27917503 Krt18 Rat quercetin increases expression ISO KRT18 (Homo sapiens) 6480464 Quercetin results in increased expression of KRT18 protein CTD PMID:14750173 Krt18 Rat rac-lactic acid decreases expression ISO KRT18 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KRT18 mRNA CTD PMID:30851411 Krt18 Rat rotenone decreases expression ISO KRT18 (Homo sapiens) 6480464 Rotenone results in decreased expression of KRT18 mRNA CTD PMID:33512557 Krt18 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KRT18 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KRT18 mRNA CTD PMID:35811015 Krt18 Rat SB 203580 multiple interactions ISO KRT18 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [cyanoginosin LR results in increased phosphorylation of KRT18 protein] CTD PMID:22960429 Krt18 Rat SB 431542 increases expression ISO KRT18 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of KRT18 protein CTD PMID:25670856 Krt18 Rat SB 431542 increases expression ISO Krt18 (Mus musculus) 6480464 4-(5-benzo(1 more ... CTD PMID:20852150 Krt18 Rat SB 431542 multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Krt18 Rat selenium atom increases expression ISO KRT18 (Homo sapiens) 6480464 Selenium results in increased expression of KRT18 mRNA CTD PMID:19244175 Krt18 Rat serpentine asbestos decreases expression ISO KRT18 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of KRT18 mRNA CTD PMID:29523930 Krt18 Rat silicon dioxide affects secretion ISO KRT18 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of KRT18 protein CTD PMID:25895662 Krt18 Rat silicon dioxide affects expression ISO KRT18 (Homo sapiens) 6480464 Silicon Dioxide affects the expression of KRT18 protein CTD PMID:35288261 Krt18 Rat silicon dioxide multiple interactions ISO KRT18 (Homo sapiens) 6480464 BMI1 protein affects the reaction [Silicon Dioxide affects the expression of KRT18 protein] CTD PMID:35288261 Krt18 Rat silicon dioxide decreases expression ISO KRT18 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of KRT18 protein CTD PMID:27917503 Krt18 Rat silicon dioxide increases expression ISO Krt18 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of KRT18 mRNA CTD PMID:23221170 Krt18 Rat sodium arsenite affects expression ISO KRT18 (Homo sapiens) 6480464 sodium arsenite affects the expression of KRT18 mRNA and sodium arsenite affects the expression of KRT18 protein CTD PMID:20056578 Krt18 Rat sodium arsenite multiple interactions ISO KRT18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KRT18 mRNA CTD PMID:39836092 Krt18 Rat sodium arsenite decreases expression ISO Krt18 (Mus musculus) 6480464 sodium arsenite results in decreased expression of KRT18 mRNA CTD PMID:15276417 Krt18 Rat sodium arsenite affects expression ISO Krt18 (Mus musculus) 6480464 sodium arsenite affects the expression of KRT18 mRNA CTD PMID:16507464 Krt18 Rat sodium arsenite increases expression ISO Krt18 (Mus musculus) 6480464 sodium arsenite results in increased expression of KRT18 mRNA and sodium arsenite results in increased expression of KRT18 protein CTD PMID:17340120 Krt18 Rat sodium arsenite multiple interactions ISO Krt18 (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT18 mRNA and S-ethyl-N-acetyl-cysteine inhibits the reaction [sodium arsenite results in increased expression of KRT18 mRNA] CTD PMID:16368122 and PMID:17340120 Krt18 Rat sodium arsenite increases expression ISO KRT18 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KRT18 mRNA and sodium arsenite results in increased expression of KRT18 protein CTD PMID:19524636 Krt18 Rat sodium chloride multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of KRT18 protein more ... CTD PMID:38598786 Krt18 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of KRT18 mRNA CTD PMID:25993096 Krt18 Rat sodium dodecyl sulfate increases expression ISO KRT18 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of KRT18 mRNA CTD PMID:31734321 Krt18 Rat sodium fluoride decreases expression ISO Krt18 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of KRT18 protein CTD PMID:28918527 Krt18 Rat sodium perchlorate multiple interactions EXP 6480464 [Iodine deficiency co-treated with sodium perchlorate] results in decreased expression of KRT18 protein CTD PMID:30090431 Krt18 Rat SU6656 increases expression ISO KRT18 (Homo sapiens) 6480464 SU 6656 results in increased expression of KRT18 protein CTD PMID:23527294 Krt18 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of KRT18 mRNA CTD PMID:30047161 Krt18 Rat sunitinib decreases expression ISO KRT18 (Homo sapiens) 6480464 Sunitinib results in decreased expression of KRT18 mRNA CTD PMID:31533062 Krt18 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of KRT18 mRNA CTD PMID:26496021 Krt18 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of KRT18 mRNA CTD PMID:17522070 and PMID:31150632 Krt18 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of KRT18 mRNA] CTD PMID:31150632 Krt18 Rat tetrachloromethane increases expression ISO Krt18 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KRT18 mRNA CTD PMID:27339419 and PMID:31919559 Krt18 Rat tetrachloromethane affects expression ISO Krt18 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of KRT18 mRNA CTD PMID:17484886 Krt18 Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of KRT18 mRNA CTD PMID:17522070 Krt18 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of KRT18 protein CTD PMID:35544339 Krt18 Rat thioacetamide multiple interactions ISO Krt18 (Mus musculus) 6480464 KRT18 protein affects the reaction [Thioacetamide results in increased expression of MMP13 mRNA] more ... CTD PMID:18395095 Krt18 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of KRT18 mRNA CTD PMID:28943392 Krt18 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KRT18 mRNA CTD PMID:23411599 and PMID:34492290 Krt18 Rat thioacetamide increases expression ISO Krt18 (Mus musculus) 6480464 Thioacetamide results in increased expression of KRT18 mRNA CTD PMID:18395095 Krt18 Rat thiram decreases expression ISO KRT18 (Homo sapiens) 6480464 Thiram results in decreased expression of KRT18 mRNA CTD PMID:38568856 Krt18 Rat titanium dioxide increases phosphorylation ISO KRT18 (Homo sapiens) 6480464 titanium dioxide results in increased phosphorylation of KRT18 protein CTD PMID:21439344 Krt18 Rat titanium dioxide increases methylation ISO Krt18 (Mus musculus) 6480464 titanium dioxide results in increased methylation of KRT18 promoter CTD PMID:35295148 Krt18 Rat titanium dioxide increases expression ISO Krt18 (Mus musculus) 6480464 titanium dioxide results in increased expression of KRT18 mRNA CTD PMID:27760801 Krt18 Rat titanium dioxide decreases expression ISO Krt18 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KRT18 mRNA CTD PMID:23557971 Krt18 Rat triadimefon decreases expression ISO KRT18 (Homo sapiens) 6480464 triadimefon results in decreased expression of KRT18 mRNA CTD PMID:26705709 Krt18 Rat trichostatin A increases expression ISO KRT18 (Homo sapiens) 6480464 trichostatin A results in increased expression of KRT18 mRNA CTD PMID:24935251 and PMID:26272509 Krt18 Rat trichostatin A multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat triclosan decreases expression ISO KRT18 (Homo sapiens) 6480464 Triclosan results in decreased expression of KRT18 mRNA CTD PMID:34681664 Krt18 Rat trimethylarsine oxide decreases expression EXP 6480464 trimethylarsine oxide results in decreased expression of KRT18 mRNA CTD PMID:17481689 Krt18 Rat triphenyl phosphate decreases expression ISO KRT18 (Homo sapiens) 6480464 triphenyl phosphate results in decreased expression of KRT18 mRNA CTD PMID:28934090 Krt18 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of KRT18 mRNA CTD PMID:24136188 Krt18 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of KRT18 mRNA CTD PMID:15885361 Krt18 Rat valproic acid increases expression ISO Krt18 (Mus musculus) 6480464 Valproic Acid results in increased expression of KRT18 mRNA CTD PMID:15345369 Krt18 Rat valproic acid multiple interactions ISO KRT18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT18 mRNA CTD PMID:27188386 Krt18 Rat valproic acid increases expression ISO KRT18 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KRT18 mRNA CTD PMID:23179753 more ... Krt18 Rat valproic acid affects expression ISO Krt18 (Mus musculus) 6480464 Valproic Acid affects the expression of KRT18 mRNA CTD PMID:17292431 Krt18 Rat vancomycin decreases expression ISO Krt18 (Mus musculus) 6480464 Vancomycin results in decreased expression of KRT18 mRNA CTD PMID:18930951 Krt18 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of KRT18 mRNA CTD PMID:15686871 Krt18 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KRT18 mRNA CTD PMID:19015723 Krt18 Rat vinorelbine increases expression ISO KRT18 (Homo sapiens) 6480464 vinorelbine results in increased expression of KRT18 protein CTD PMID:16685278 Krt18 Rat vinorelbine increases metabolic processing ISO KRT18 (Homo sapiens) 6480464 vinorelbine results in increased metabolism of KRT18 protein CTD PMID:16685278 Krt18 Rat vorinostat multiple interactions ISO KRT18 (Homo sapiens) 6480464 [Fluorouracil co-treated with irinotecan co-treated with vorinostat] results in increased cleavage of KRT18 protein CTD PMID:15754201 Krt18 Rat warfarin decreases expression ISO Krt18 (Mus musculus) 6480464 Warfarin results in decreased expression of KRT18 mRNA CTD PMID:20493250
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (S)-colchicine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3'-diindolylmethane (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) ABT-737 (ISO) acetamide (EXP) acrolein (ISO) acrylamide (ISO) actinomycin D (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-4-oxoretinol (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) arachidonic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) azoxystrobin (ISO) belinostat (ISO) benzo[a]pyrene (EXP,ISO) beta-carotene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bufalin (ISO) buspirone (EXP) buta-1,3-diene (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroform (EXP) chromium trinitrate (ISO) ciguatoxin CTX1B (ISO) clofibrate (EXP) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) cumene (ISO) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) DDE (ISO) DDT (ISO) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) diethyl phthalate (EXP,ISO) diethylstilbestrol (ISO) diiodine (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimercaprol (ISO) dimethyl sulfoxide (ISO) dimethylarsinic acid (EXP,ISO) dioscin (EXP,ISO) dioxygen (ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) epoxiconazole (ISO) erythromycin estolate (EXP) estramustine (ISO) ethanol (EXP,ISO) fenofibrate (ISO) finasteride (EXP) fipronil (EXP) flavone (ISO) flutamide (EXP) folic acid (ISO) fructose (EXP) fulvestrant (ISO) fumonisin B1 (ISO) furan (EXP) furfural (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glutathione (EXP) glycidol (EXP) glyphosate (EXP) griseofulvin (ISO) heparin (ISO) hydrazine (EXP) indometacin (ISO) irinotecan (ISO) iron(III) nitrilotriacetate (ISO) isoprenaline (ISO) ivermectin (ISO) lead diacetate (EXP) levofloxacin (EXP) lipopolysaccharide (ISO) lovastatin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) methylarsonic acid (EXP) methylmercury chloride (ISO) microcystin-LR (ISO) N-butyl-N-(4-hydroxybutyl)nitrosamine (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nevirapine (ISO) nickel atom (ISO) nitrofen (EXP) Nutlin-3 (ISO) nystatin (ISO) obeticholic acid (ISO) octreotide (ISO) oxybenzone (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorobutyric acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenformin (EXP) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) phosgene (ISO) picoxystrobin (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) potassium chromate (ISO) procymidone (EXP) progesterone (ISO) pyrimidifen (ISO) pyrogallol (ISO) quartz (ISO) quercetin (ISO) rac-lactic acid (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (ISO) SB 431542 (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) sodium perchlorate (EXP) SU6656 (ISO) sulfadimethoxine (EXP) sunitinib (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetracycline (EXP) thapsigargin (EXP) thioacetamide (EXP,ISO) thiram (ISO) titanium dioxide (ISO) triadimefon (ISO) trichostatin A (ISO) triclosan (ISO) trimethylarsine oxide (EXP) triphenyl phosphate (ISO) trovafloxacin (EXP) ursodeoxycholic acid (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vinorelbine (ISO) vorinostat (ISO) warfarin (ISO)
1.
Evaluation of the diagnostic value of serum and tissue apoptotic cytokeratin-18 in patients with chronic hepatitis C.
Abdel Haleem H, etal., Arab J Gastroenterol. 2013 Jun;14(2):68-72. doi: 10.1016/j.ajg.2013.03.004. Epub 2013 Apr 28.
2.
Recovery of the Cholangiocytes After Ischemia and Reperfusion Injury: Ultra-Structural, Hystological and Molecular Assessment in Rats.
Aloia TPA, etal., J Clin Exp Hepatol. 2018 Dec;8(4):380-389. doi: 10.1016/j.jceh.2018.01.003. Epub 2018 Feb 11.
3.
Relationship between liver injury and serum cytokeratin 18 levels in asymptomatic hepatitis B virus carriers and in patients with chronic hepatitis B infection.
Balkan A, etal., Arab J Gastroenterol. 2017 Jun;18(2):98-103. doi: 10.1016/j.ajg.2017.05.008. Epub 2017 Jun 1.
4.
Keratin 18-deficiency results in steatohepatitis and liver tumors in old mice: A model of steatohepatitis-associated liver carcinogenesis.
Bettermann K, etal., Oncotarget. 2016 Nov 8;7(45):73309-73322. doi: 10.18632/oncotarget.12325.
5.
Association Between Serum CK-18 Levels and the Degree of Liver Damage in Fructose-Induced Metabolic Syndrome.
Bratoeva K, etal., Metab Syndr Relat Disord. 2018 Sep;16(7):350-357. doi: 10.1089/met.2017.0162. Epub 2018 Jul 10.
6.
In vitro and in vivo study of the application of volvox spheres to co-culture vehicles in liver tissue engineering.
Chang SH, etal., Acta Biomater. 2017 Nov;63:261-273. doi: 10.1016/j.actbio.2017.09.028. Epub 2017 Sep 21.
7.
Elevated serum cytokeratin-18 concentration in patients with type 2 diabetes mellitus and non-alcoholic fatty liver disease.
Chang YH, etal., Ann Clin Biochem. 2019 Jan;56(1):141-147. doi: 10.1177/0004563218796259. Epub 2018 Aug 27.
8.
Serum cytokeratin-18 and its relation to liver fibrosis and steatosis diagnosed by FibroScan and controlled attenuation parameter in nonalcoholic fatty liver disease and hepatitis C virus patients.
Darweesh SK, etal., Eur J Gastroenterol Hepatol. 2019 May;31(5):633-641. doi: 10.1097/MEG.0000000000001385.
9.
Hepatic stellate cells modulate the differentiation of bone marrow mesenchymal stem cells into hepatocyte-like cells.
Deng X, etal., J Cell Physiol. 2008 Oct;217(1):138-44. doi: 10.1002/jcp.21481.
10.
Cytokeratin 18 fragment levels as a noninvasive biomarker for nonalcoholic steatohepatitis in bariatric surgery patients.
Diab DL, etal., Clin Gastroenterol Hepatol. 2008 Nov;6(11):1249-54. doi: 10.1016/j.cgh.2008.07.016. Epub 2008 Jul 26.
11.
Apoptotic and anti-apoptotic seromarkers for assessment of disease severity of non-alcoholic steatohepatitis.
El Bassat H, etal., Arab J Gastroenterol. 2014 Mar;15(1):6-11. doi: 10.1016/j.ajg.2014.01.009. Epub 2014 Feb 7.
12.
Cytokeratin-18 fragment levels as noninvasive biomarkers for nonalcoholic steatohepatitis: a multicenter validation study.
Feldstein AE, etal., Hepatology. 2009 Oct;50(4):1072-8. doi: 10.1002/hep.23050.
13.
Switch in the expression of the K19/K18 keratin genes as a very early evidence of testicular differentiation in the rat.
Fridmacher V, etal., Mech Dev 1995 Aug;52(2-3):199-207.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
16.
Arsenite induced oxidative damage in mouse liver is associated with increased cytokeratin 18 expression.
Gonsebatt ME, etal., Arch Toxicol. 2007 Sep;81(9):619-26. doi: 10.1007/s00204-007-0192-7. Epub 2007 Mar 6.
17.
Caspase-cleaved cytokeratin 18 and 20 S proteasome in liver degeneration.
Hetz H, etal., J Clin Lab Anal. 2007;21(5):277-81. doi: 10.1002/jcla.20180.
18.
Elevated serum CK18 levels in chronic hepatitis C patients are associated with advanced fibrosis but not steatosis.
Jazwinski AB, etal., J Viral Hepat. 2012 Apr;19(4):278-82. doi: 10.1111/j.1365-2893.2011.01546.x. Epub 2011 Nov 24.
19.
[Subcellular proteome analysis of immune or alcohol induced rat liver fibrosis].
Jia XF, etal., Zhonghua Gan Zang Bing Za Zhi. 2010 Nov;18(11):826-30. doi: 10.3760/cma.j.issn.1007-3418.2010.11.009.
20.
Prospective biopsy-controlled evaluation of cell death biomarkers for prediction of liver fibrosis and nonalcoholic steatohepatitis.
Joka D, etal., Hepatology. 2012 Feb;55(2):455-64. doi: 10.1002/hep.24734. Epub 2011 Nov 29.
21.
Mutation of human keratin 18 in association with cryptogenic cirrhosis.
Ku NO, etal., J Clin Invest. 1997 Jan 1;99(1):19-23.
22.
Cell death markers in patients with cirrhosis and acute decompensation.
Macdonald S, etal., Hepatology. 2018 Mar;67(3):989-1002. doi: 10.1002/hep.29581. Epub 2018 Jan 24.
23.
Identification of cytokeratin 18 as a biomarker of mouse and human hepatosplenic schistosomiasis.
Manivannan B, etal., Infect Immun. 2011 May;79(5):2051-8. doi: 10.1128/IAI.01214-10. Epub 2011 Feb 28.
24.
Individuals with Primary Sclerosing Cholangitis Have Elevated Levels of Biomarkers for Apoptosis but Not Necrosis.
Masuoka HC, etal., Dig Dis Sci. 2015 Dec;60(12):3642-6. doi: 10.1007/s10620-015-3805-7. Epub 2015 Jul 21.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
GOA pipeline
RGD automated data pipeline
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
Comprehensive gene review and curation
RGD comprehensive gene curation
31.
Serum cell death biomarkers for prediction of liver fibrosis and poor prognosis in primary biliary cirrhosis.
Sekiguchi T, etal., PLoS One. 2015 Jun 25;10(6):e0131658. doi: 10.1371/journal.pone.0131658. eCollection 2015.
32.
Keratin 18 phosphorylation as a progression marker of chronic hepatitis B.
Shi Y, etal., Virol J. 2010 Mar 24;7:70. doi: 10.1186/1743-422X-7-70.
33.
Differentiation and migration of bone marrow mesenchymal stem cells transplanted through the spleen in rats with portal hypertension.
Sun S, etal., PLoS One. 2013 Dec 10;8(12):e83523. doi: 10.1371/journal.pone.0083523. eCollection 2013.
34.
Mutation of caspase-digestion sites in keratin 18 interferes with filament reorganization, and predisposes to hepatocyte necrosis and loss of membrane integrity.
Weerasinghe SV, etal., J Cell Sci. 2014 Apr 1;127(Pt 7):1464-75. doi: 10.1242/jcs.138479. Epub 2014 Jan 24.
35.
Cytokeratin 18 is expressed on the hepatocyte plasma membrane surface and interacts with thrombin-antithrombin complexes.
Wells MJ, etal., J Biol Chem. 1997 Nov 7;272(45):28574-81. doi: 10.1074/jbc.272.45.28574.
36.
Serum CK 18-M30 reflect liver pathological severity during NAFLD progression in a rat model.
Xue L, etal., Pathol Res Pract. 2018 Nov;214(11):1778-1786. doi: 10.1016/j.prp.2018.08.016. Epub 2018 Aug 20.
37.
Elevated apoptosis-associated cytokeratin 18 fragments (CK18Asp386) in serum of patients with chronic liver diseases indicate hepatic and biliary inflammation.
Yagmur E, etal., Clin Biochem. 2007 Jun;40(9-10):651-5. doi: 10.1016/j.clinbiochem.2006.12.010. Epub 2007 Jan 17.
38.
Phosphorylation of keratin intermediate filaments by protein kinase C, by calmodulin-dependent protein kinase and by cAMP-dependent protein kinase.
Yano T, etal., Eur J Biochem. 1991 Apr 23;197(2):281-90.
39.
High-fat-cholesterol diet mainly induced necrosis in fibrotic steatohepatitis rat by suppressing caspase activity.
Yetti H, etal., Life Sci. 2013 Nov 4;93(18-19):673-80. doi: 10.1016/j.lfs.2013.09.013. Epub 2013 Sep 23.
40.
Elevated serum levels of caspase-cleaved cytokeratin 18 (CK18-Asp396) in patients with nonalcoholic steatohepatitis and chronic hepatitis C.
Yilmaz Y, etal., Med Sci Monit. 2009 Apr;15(4):CR189-93.
Krt18 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 135,036,168 - 135,039,844 (+) NCBI GRCr8 mRatBN7.2 7 133,157,486 - 133,161,162 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 64,877,631 - 64,879,869 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 7 133,157,475 - 133,161,166 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,918,930 - 134,922,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,148,293 - 137,152,013 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,127,118 - 137,130,838 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,629,455 - 143,633,131 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,629,455 - 143,633,131 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,425,684 - 141,429,360 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 2 79,988,565 - 79,989,008 (+) NCBI Celera 7 129,594,039 - 129,597,715 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
KRT18 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,948,855 - 52,952,906 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,948,871 - 52,952,906 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,342,639 - 53,346,690 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 51,628,922 - 51,632,952 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 51,628,921 - 51,632,951 NCBI Celera 12 52,989,626 - 52,993,657 (+) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,386,471 - 50,390,501 (+) NCBI HuRef CHM1_1 12 53,309,411 - 53,313,442 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 52,913,414 - 52,917,465 (+) NCBI T2T-CHM13v2.0
Krt18 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,936,651 - 101,940,461 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,936,615 - 101,940,462 (+) Ensembl GRCm39 Ensembl GRCm38 15 102,028,216 - 102,032,026 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 102,028,180 - 102,032,027 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,858,647 - 101,862,457 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,856,259 - 101,860,055 (+) NCBI MGSCv36 mm8 Celera 15 104,183,109 - 104,186,912 (+) NCBI Celera Cytogenetic Map 15 F2 NCBI cM Map 15 57.22 NCBI
Krt18 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 226,805 - 232,728 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 227,017 - 230,752 (+) NCBI ChiLan1.0 ChiLan1.0
KRT18 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 41,240,278 - 41,244,325 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 41,237,041 - 41,241,089 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 35,807,660 - 35,811,691 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 36,587,149 - 36,591,196 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 36,587,149 - 36,591,196 (-) Ensembl panpan1.1 panPan2
KRT18 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,189,269 - 2,193,368 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 2,189,269 - 2,193,368 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 44,058,883 - 44,062,982 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,190,002 - 2,194,108 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 2,189,986 - 2,194,112 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 2,207,095 - 2,210,994 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,193,381 - 2,197,266 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 44,457,950 - 44,461,835 (+) NCBI UU_Cfam_GSD_1.0
Krt18 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 62,870,183 - 62,874,137 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 10,290,690 - 10,294,651 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 10,290,706 - 10,294,647 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRT18 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 18,217,691 - 18,221,429 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 18,217,686 - 18,221,432 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 18,726,205 - 18,729,755 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRT18 (Chlorocebus sabaeus - green monkey)
Krt18 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 46 Count of miRNA genes: 43 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000073951 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH131703
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 8 25,170,981 - 25,171,164 NCBI Rnor5.0 Rnor_5.0 2 100,546,425 - 100,546,621 NCBI Rnor5.0 RGSC_v3.4 8 23,625,335 - 23,625,517 UniSTS RGSC3.4 RGSC_v3.4 2 80,044,296 - 80,044,491 UniSTS RGSC3.4 Celera 8 24,075,285 - 24,075,467 UniSTS Celera 2 74,545,867 - 74,546,062 UniSTS RH 3.4 Map 7 1065.8 UniSTS Cytogenetic Map 7 q36 UniSTS
AA891608
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 135,039,313 - 135,039,801 (+) Marker Load Pipeline mRatBN7.2 7 133,160,631 - 133,161,119 (+) MAPPER mRatBN7.2 Rnor_6.0 7 143,632,601 - 143,633,088 NCBI Rnor6.0 Rnor_5.0 7 141,428,830 - 141,429,317 UniSTS Rnor5.0 Celera 7 129,597,185 - 129,597,672 UniSTS RH 3.4 Map 2 401.5 UniSTS Cytogenetic Map 7 q36 UniSTS
Krt18
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 78,910,620 - 78,911,453 (+) MAPPER mRatBN7.2 mRatBN7.2 2 78,910,690 - 78,911,453 (+) MAPPER mRatBN7.2 Rnor_6.0 2 80,878,793 - 80,879,555 NCBI Rnor6.0 Rnor_6.0 2 80,878,570 - 80,879,555 NCBI Rnor6.0 Rnor_5.0 2 100,545,637 - 100,546,399 UniSTS Rnor5.0 Rnor_5.0 2 100,545,414 - 100,546,399 UniSTS Rnor5.0 RGSC_v3.4 2 80,043,507 - 80,044,269 UniSTS RGSC3.4 Celera 2 74,545,078 - 74,545,840 UniSTS Cytogenetic Map 7 q36 UniSTS
Krt18
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 78,911,416 - 78,911,583 (+) MAPPER mRatBN7.2 mRatBN7.2 8 22,497,552 - 22,497,716 (+) MAPPER mRatBN7.2 Rnor_6.0 2 80,879,519 - 80,879,685 NCBI Rnor6.0 Rnor_6.0 8 25,137,020 - 25,137,183 NCBI Rnor6.0 Rnor_5.0 8 25,170,922 - 25,171,085 UniSTS Rnor5.0 Rnor_5.0 2 100,546,363 - 100,546,529 UniSTS Rnor5.0 RGSC_v3.4 8 23,625,275 - 23,625,438 UniSTS RGSC3.4 RGSC_v3.4 2 80,044,233 - 80,044,399 UniSTS RGSC3.4 Celera 8 24,075,225 - 24,075,388 UniSTS Celera 2 74,545,804 - 74,545,970 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 8 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
49
113
91
90
59
25
59
6
215
94
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000073951 ⟹ ENSRNOP00000067234
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 133,157,475 - 133,161,166 (+) Ensembl Rnor_6.0 Ensembl 7 143,629,455 - 143,633,131 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100179 ⟹ ENSRNOP00000084901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 64,877,631 - 64,879,869 (-) Ensembl
RefSeq Acc Id:
NM_053976 ⟹ NP_446428
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 135,036,168 - 135,039,844 (+) NCBI mRatBN7.2 7 133,157,486 - 133,161,162 (+) NCBI Rnor_6.0 7 143,629,455 - 143,633,131 (+) NCBI Rnor_5.0 7 141,425,684 - 141,429,360 (+) NCBI Celera 7 129,594,039 - 129,597,715 (+) RGD
Sequence:
CCAATCCTGGTCTCTCGCTTCGTTCTCCTCTCCAGACAAGATGAGCTTCACCACCCGCTCCACCACCTTCTCCACCAACTACCGGTCCCTGGGCTCTGTGCGGACTCCCAGCCAGCGGGTCCGGCCTG CCAGCAGCGCAGCCAGCGTCTATGCAGGTGCTGGGGGCTCAGGGTCCCGGATATCCGTGTCCCGCTCTGTCTGGGGTGGCTCCGTGGGGTCCGCAGGCCTGGCGGGAATGGGTGGGGTCCAGACTGAG AAGGAGACCATGCAAGACCTGAACGACCGCCTGGCCAGCTACCTAGACAAGGTGAAGAACCTGGAAACCGAGAACAGGAGACTAGAGAGCAAAATCCGGGAATATCTGGAGAAAAGGGGTCCCCAGGG CGTCAGAGACTGGGGCCACTACTTCAAGACCATCGAAGATCTGAGGGCTCAGATCTTTGCGAATTCTGTGGACAATGCCCGCATCGTCCTGCAGATCGACAATGCCCGTCTTGCCGCTGATGACTTTA GAGTCAAGTATGAGACGGAACTGGCCATGCGCCAGTCTGTGGAGAGTGACATTCATGGACTCCGCAAGGTGGTGGATGACACCAACATCACGAGGTTGCAGCTGGAGACAGAAATCGAAGCGCTCAAG GAGGAGCTGCTGTTCATGAAGAAGAATCATGAGGAGGAAGTCCAAGGCCTGGAAGCTCAGATTGCCAGTTCTGGGTTGACTGTGGAAGTGGATGCTCCCAAATCTCAGGACCTCAGCAAGATCATGGC GGACATCCGTGCCCAGTATGAACAGCTGGCTCAGAAGAACCGTGAGGAACTGGACAAGTACTGGTCTCAGCAGATTGAAGAGAGTACCACGGTAGTCACCACCAAGTCTGCCGAAATCAGGGACGCTG AGACCACACTCTTGGAGCTGAGACGCACCCTCCAGACCTTGGAGATTGACCTGGACTCGATGAAAAACCAGAACATCAACTTGGAGAACAACCTCGGGGAAGTGGAGGCCAGATACAGGGTGCAGATG GAGCAACTCAATGGGGTCCTTCTGCATCTGGAATCAGAGCTGGCACAAACTCGGGCAGAAGGACAGCGCCAGACCCAGGAATACGAAGCCCTGTTGAACATCAAGGTCAAGCTTGAGGCGGAGATTGC CACCTACCGCCGCTTGCTGGAGGATGGGGACGATTTCAGTCTCAACGACGCCCTGGACTCCAGCAACTCCATGCAAACTGTCCAGAGGACAACTACCCGTAAGGTCGTGGATGGCAAAGTGGTGTCCG AGACCAATGATACCAGAGTTCTGAGGCACTAAGGCTCAGAAGAAGGGAACCCCTTGGGGACTGAGGGACCAATAAAAGTTTAGAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_446428 ⟸ NM_053976
- UniProtKB:
Q63278 (UniProtKB/Swiss-Prot), Q5BJY9 (UniProtKB/Swiss-Prot), A0A8I6A244 (UniProtKB/TrEMBL), A6KCS5 (UniProtKB/TrEMBL)
- Sequence:
MSFTTRSTTFSTNYRSLGSVRTPSQRVRPASSAASVYAGAGGSGSRISVSRSVWGGSVGSAGLAGMGGVQTEKETMQDLNDRLASYLDKVKNLETENRRLESKIREYLEKRGPQGVRDWGHYFKTIED LRAQIFANSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVESDIHGLRKVVDDTNITRLQLETEIEALKEELLFMKKNHEEEVQGLEAQIASSGLTVEVDAPKSQDLSKIMADIRAQYEQLAQKN REELDKYWSQQIEESTTVVTTKSAEIRDAETTLLELRRTLQTLEIDLDSMKNQNINLENNLGEVEARYRVQMEQLNGVLLHLESELAQTRAEGQRQTQEYEALLNIKVKLEAEIATYRRLLEDGDDFS LNDALDSSNSMQTVQRTTTRKVVDGKVVSETNDTRVLRH
hide sequence
Ensembl Acc Id:
ENSRNOP00000067234 ⟸ ENSRNOT00000073951
Ensembl Acc Id:
ENSRNOP00000084901 ⟸ ENSRNOT00000100179
RGD ID: 13695686
Promoter ID: EPDNEW_R6211
Type: multiple initiation site
Name: Krt18_1
Description: keratin 18
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 143,629,441 - 143,629,501 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Krt18
keratin 18
Krt18
keratin 18, type I
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-01-28
Krt18
keratin 18, type I
Krt18
keratin 18
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-02-22
Krt18
keratin 18
Krt1-18
keratin complex 1, acidic, gene 18
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-02-11
Krt1-18
keratin complex 1, acidic, gene 18
Symbol and Name status set to approved
625702
APPROVED
2002-08-07
Krt1-18
keratin complex 1, acidic, gene 18
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA expressed at the onset of testicular differentiation and in male gonads
633091
gene_expression
exclusively expressed in fetal Sertoli cells from 14.5 days of gestation
633091
gene_regulation
expression regulated at the transcriptional level
633091