Nup85 (nucleoporin 85) - Rat Genome Database

Name: Nup85
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Nup85 (nucleoporin 85) Rattus norvegicus

Analyze

Symbol:

Nup85

Name:

nucleoporin 85

RGD ID:

1311942

Description:

Predicted to be a structural constituent of nuclear pore. Predicted to be involved in nephron development; nucleocytoplasmic transport; and positive regulation of DNA-templated transcription. Predicted to act upstream of or within lamellipodium assembly and macrophage chemotaxis. Predicted to be located in cytosol; kinetochore; and nucleus. Predicted to be part of nuclear pore outer ring. Human ortholog(s) of this gene implicated in nephrotic syndrome type 17. Orthologous to human NUP85 (nucleoporin 85); PARTICIPATES IN mRNA nuclear export pathway; RNA transport pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

85 kDa nucleoporin; LOC287830; nuclear pore complex protein Nup85; nucleoporin 85kDa; nucleoporin NUP85; Pcnt1; pericentrin 1; pericentrin-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NUP85 (nucleoporin 85)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nup85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nup85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NUP85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NUP85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nup85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NUP85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NUP85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nup85 (nucleoporin 85)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NUP85 (nucleoporin 85)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nup85 (nucleoporin 85)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nup85 (nucleoporin 85)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NUP85	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Nup75	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npp-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nup85	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,305,241 - 101,323,980 (+)	NCBI		GRCr8
mRatBN7.2	10	100,806,482 - 100,825,029 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,806,437 - 100,825,043 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	105,866,595 - 105,885,241 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,329,668 - 105,348,314 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,727,451 - 100,746,001 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,118,999 - 104,137,258 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,118,945 - 104,137,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,144,378 - 104,162,637 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	105,645,505 - 105,665,079 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	105,660,008 - 105,679,580 (+)	NCBI
Celera	10	99,381,083 - 99,399,472 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

nephrotic syndrome type 17 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

3-chloropropane-1,2-diol (EXP)

4-hydroxynon-2-enal (ISO)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

coumestrol (ISO)

DDE (ISO)

deguelin (ISO)

dibutyl phthalate (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

folpet (ISO)

ivermectin (ISO)

methapyrilene (ISO)

N(4)-hydroxycytidine (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

piroxicam (ISO)

potassium chromate (ISO)

propanal (ISO)

quercetin (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

topotecan (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

chemotaxis (ISO)

lamellipodium assembly (ISO)

macrophage chemotaxis (ISO)

mRNA export from nucleus (IBA)

mRNA transport (IEA)

nephron development (ISO,ISS)

nucleocytoplasmic transport (IEA)

positive regulation of DNA-templated transcription (IBA)

protein import into nucleus (IBA)

protein transport (IEA)

Cellular Component

cytosol (IEA,ISO)

kinetochore (ISO)

nuclear envelope (ISO)

nuclear membrane (IEA)

nuclear pore (IEA)

nuclear pore outer ring (IBA,ISO,ISS)

nucleoplasm (IEA,ISO)

spindle (IEA)

Molecular Function

protein binding (ISO)

structural constituent of nuclear pore (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

mRNA nuclear export pathway (ISO)

RNA transport pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Regulation of mRNA trafficking by nuclear pore complexes.	Bonnet A and Palancade B, Genes (Basel). 2014 Sep 2;5(3):767-91. doi: 10.3390/genes5030767.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Removal of a single pore subcomplex results in vertebrate nuclei devoid of nuclear pores.	Harel A, etal., Mol Cell. 2003 Apr;11(4):853-64.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:15146057	PMID:15995708	PMID:17360435	PMID:19946888	PMID:30179222

Genomics

Comparative Map Data

Nup85
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,305,241 - 101,323,980 (+)	NCBI		GRCr8
mRatBN7.2	10	100,806,482 - 100,825,029 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,806,437 - 100,825,043 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	105,866,595 - 105,885,241 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,329,668 - 105,348,314 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,727,451 - 100,746,001 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,118,999 - 104,137,258 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,118,945 - 104,137,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,144,378 - 104,162,637 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	105,645,505 - 105,665,079 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	105,660,008 - 105,679,580 (+)	NCBI
Celera	10	99,381,083 - 99,399,472 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

NUP85
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	75,205,679 - 75,235,758 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	75,205,659 - 75,235,758 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	73,201,774 - 73,231,853 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	70,713,192 - 70,743,449 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	70,713,380 - 70,743,447	NCBI
Celera	17	69,793,975 - 69,824,185 (+)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	68,611,339 - 68,641,549 (+)	NCBI		HuRef
CHM1_1	17	73,266,184 - 73,296,417 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	76,097,807 - 76,127,836 (+)	NCBI		T2T-CHM13v2.0

Nup85
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	115,455,264 - 115,474,750 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	115,455,260 - 115,474,811 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	115,564,432 - 115,583,924 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	115,564,434 - 115,583,985 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	115,425,758 - 115,445,226 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	115,380,572 - 115,400,075 (+)	NCBI		MGSCv36	mm8
Celera	11	127,337,030 - 127,351,679 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	80.87	NCBI

Nup85
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955553	2,079,503 - 2,107,807 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955553	2,079,418 - 2,107,894 (+)	NCBI	ChiLan1.0	ChiLan1.0

NUP85
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	91,243,861 - 91,275,146 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	96,067,989 - 96,098,214 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	69,152,452 - 69,182,688 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	74,715,056 - 74,735,706 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	74,708,654 - 74,735,628 (+)	Ensembl	panpan1.1		panPan2

NUP85
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	5,251,387 - 5,298,096 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	5,251,419 - 5,285,338 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	5,930,369 - 5,977,004 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	5,921,442 - 5,968,402 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	5,921,442 - 5,968,410 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	5,960,174 - 6,006,787 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	6,070,418 - 6,117,068 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	6,130,422 - 6,177,075 (-)	NCBI		UU_Cfam_GSD_1.0

Nup85
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	5,880,087 - 5,908,344 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	503,720 - 531,875 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	503,698 - 531,851 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUP85
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	6,071,812 - 6,103,979 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	6,072,731 - 6,103,972 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	6,035,178 - 6,066,433 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUP85
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	46,433,821 - 46,463,822 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	46,433,579 - 46,463,759 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	17,203,748 - 17,236,457 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nup85
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	5,022,617 - 5,057,140 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	5,023,255 - 5,057,140 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nup85
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	86
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000005035
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	92238497	101012337	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

Cda0wb11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	100,824,847 - 100,824,994 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	104,137,077 - 104,137,223	NCBI	Rnor6.0
Rnor_5.0	10	104,144,412 - 104,144,559	NCBI	Rnor5.0
RGSC_v3.4	10	105,664,898 - 105,665,044	UniSTS	RGSC3.4
Celera	10	99,399,291 - 99,399,437	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH136713

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	100,821,969 - 100,822,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	104,134,199 - 104,134,342	NCBI	Rnor6.0
Rnor_5.0	10	104,147,294 - 104,147,437	UniSTS	Rnor5.0
RGSC_v3.4	10	105,662,020 - 105,662,163	UniSTS	RGSC3.4
Celera	10	99,396,413 - 99,396,556	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005035 ⟹ ENSRNOP00000005035

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,806,437 - 100,825,043 (+)	Ensembl
Rnor_6.0 Ensembl	10	104,118,945 - 104,137,319 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099013 ⟹ ENSRNOP00000093249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,806,437 - 100,824,916 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101986 ⟹ ENSRNOP00000080318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,806,437 - 100,825,043 (+)	Ensembl

RefSeq Acc Id:

NM_001025401 ⟹ NP_001020572

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,305,435 - 101,323,980 (+)	NCBI
mRatBN7.2	10	100,806,482 - 100,825,029 (+)	NCBI
Rnor_6.0	10	104,118,999 - 104,137,258 (+)	NCBI
Rnor_5.0	10	104,144,378 - 104,162,637 (-)	NCBI
RGSC_v3.4	10	105,645,505 - 105,665,079 (+)	RGD
Celera	10	99,381,083 - 99,399,472 (+)	RGD

Sequence:

show sequence

CCCTGCTGCGGGCGCACCGCACTATGGAGGAGCTCGACTGCGAGCCCGCAGTAACTTGGATTCC
AGGTGTGAATTCCAAGAAGAAGCAAATGTGTTTTGACTGGGGCCCAGGGGAGATGCTCCTATGT
GAAACTTCCTTCAACAAAACAGACAAATCAGAGAAGGTCCCGAGCTGCCCCTTTATTTATATCA
TAAGGAAAGATGTCGATGTTTACTCTCAAATTTTGAGAAAACTCTTCAACGAATCCCATGGAAT
CTTCGTTGGCCTGCAAAGACTTGAGGAAGAACTGTCCGGGAAATCCAGGAAAGCTCAATTGGTT
CGAGTGAGTAAAAATTACCGGTCAGTTATACGTGCCTGTATGGAAGAAATGCACCAGGTTGCAA
TTGCTGCTAAAGACCCAGCCAGTGGCCGGCAGTTCAGCAGTCAGGTCTCCATTTTGTCAGCCAT
GGAGCTTATTTGGAACCTGTGCGAGATTCTTTTCATTGAAGTAGCTCCAGCTGGACCTCTCCTC
CTCCATCTTCTTGACTGGGTCCGACTGCACGTGTGCGAGGTGGACAGTTTGTCAGCAGATGTCC
TGGGCAGTGACCACCCAAGCAAGCATGAGAGCTTCTGGAACTTGGTGACCGTCTTGGTGCTTCA
GGGCCGGCTGGATGAGGCCCGACAAATGCTGTCCAAAGAAGCTGATGCCAGCCCCTCTTCTGCA
GGCATGTGCCGCGTCCTTGGGGATCTGATGAGGACAATGCCCATTCTCAGTCCTGGCAACACTC
AGACGCTGACAGAGTTGGAGCTGAAGTGGCAGCACTGGCGTGAGGAGTGTGAGCGACACTTGCA
AGACAACACATTTGCAGCCAACCCCCATCTGGAGTCTCTCTGCAAGATCATGCTGGGGGATGAG
GCCACCTTGTTGGAGCAGAAGGAGCTTATGAGCAACTGGTACCATTTCTTAGTGACTCGGCTGC
TGTATTCCAACCCCACAGTGAAGCCCACTGACCTGCACTTGTACGCCCAGTCCAGCCTGGACAT
GTTTCTTGGAGGTGAGAGCAGTCCAGAACCACTGGACAACATCTTGATGGCTGCCTTTGAATTC
GACATTCACCAAGTGATCAAGGAGTGCAGCATTGCCCTGAGCAACTGGTGGTTCGTAGCTCACC
TCACAGACCTTTTGGATCACTGCAGACTCCTCCAGTCACACAATCTCTATTTTGGTTCTAACAT
GAGAGAATTCCTCCTTCTGGAATATGCCTCAGGACTGTTTGCTCATCACAGCCTGTGGCAGCTG
GGGGTGGATTACTTTGACTACTGCCCGGAGCTGGGCCGAGTTTCCTTGGAGCTGCACATTGAGC
GGATTCCTCTCAACACAGAGCAGAAAGCTTTGAAGGTGCTGAGGATTTGTGAGCAGCGGCAGAT
GACTGAACAAGTTGGAAGCATCTGTAAGATCTTGGCCATGAAGGCTGTTCGTAATAATCGCTTG
GGCTCAGCCCTCTCCTGGAGCATCCGCGCCAAAGATGCTGCCTTCGCCACACTCGTGTCCGACA
GATTCCTCCGGGATTACTGTGAAAGAGGCTGCTTTTCTGACTTGGATCTCATTGACAATCTGGG
GCCAGCCATGATGCTCAGTGACCGACTGACATTTCTGGGAAAGTACCGGGAGTTCCACAGACTG
TACGGGGAGAAGCGCTTTGGTGATGCTGCTTCTCTTCTGCTGTCCCTCATGACCTCTCAGATTG
CACCCCGTTCTTTCTGGATGACTCTGCTCACAGATGCCCTTCCTCTTTTGGAACAGAAGCAGGT
GATTTTTTCAGCAGAGCAGACCTACGAGCTGATGCGATGCCTGGAAGACTTGGCCTCCAGAAGG
CCAGAGTGTGGTGAGCCCGACGCCCAGCGACTGCAGGATGACGACATAGAGACCACCAAGGTGG
AGATGCTGAGACTAGCTCTTGCCCGGAATCTTGCTCGGGCAATTATAAGGGAAGGCTCACTGGA
GGGTTCCTGAGAGAAGCTGAGGACAGCTGCAGTGTAGTAACTTTGTATGGCAATGTAAATAGAT
TTTAAAATAAATTGTTTTGCAAATATAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063268782 ⟹ XP_063124852

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,305,241 - 101,323,978 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020572	(Get FASTA)	NCBI Sequence Viewer
	XP_063124852	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98031	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005035.5
	ENSRNOP00000080318.1
	ENSRNOP00000093249.1
GenBank Protein	Q4QQS8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020572 ⟸ NM_001025401

- UniProtKB:

Q4QQS8 (UniProtKB/Swiss-Prot), A0A8I5ZPV6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEELDCEPAVTWIPGVNSKKKQMCFDWGPGEMLLCETSFNKTDKSEKVPSCPFIYIIRKDVDVY
SQILRKLFNESHGIFVGLQRLEEELSGKSRKAQLVRVSKNYRSVIRACMEEMHQVAIAAKDPAS
GRQFSSQVSILSAMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSLSADVLGSDHPSK
HESFWNLVTVLVLQGRLDEARQMLSKEADASPSSAGMCRVLGDLMRTMPILSPGNTQTLTELEL
KWQHWREECERHLQDNTFAANPHLESLCKIMLGDEATLLEQKELMSNWYHFLVTRLLYSNPTVK
PTDLHLYAQSSLDMFLGGESSPEPLDNILMAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHC
RLLQSHNLYFGSNMREFLLLEYASGLFAHHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQ
KALKVLRICEQRQMTEQVGSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCE
RGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMT
LLTDALPLLEQKQVIFSAEQTYELMRCLEDLASRRPECGEPDAQRLQDDDIETTKVEMLRLALA
RNLARAIIREGSLEGS

hide sequence

Ensembl Acc Id:

ENSRNOP00000005035 ⟸ ENSRNOT00000005035

Ensembl Acc Id:

ENSRNOP00000080318 ⟸ ENSRNOT00000101986

Ensembl Acc Id:

ENSRNOP00000093249 ⟸ ENSRNOT00000099013

RefSeq Acc Id:	XP_063124852 ⟸ XM_063268782
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQS8-F1-model_v2	AlphaFold	Q4QQS8	1-656	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697890

Promoter ID:

EPDNEW_R8415

Type:

initiation region

Name:

Nup85_1

Description:

nucleoporin 85

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	104,118,954 - 104,119,014	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311942	AgrOrtholog
BioCyc Gene	G2FUF-22669	BioCyc
Ensembl Genes	ENSRNOG00000003673	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005035.8	UniProtKB/Swiss-Prot
	ENSRNOT00000099013.1	UniProtKB/TrEMBL
	ENSRNOT00000101986.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7456325	IMAGE-MGC_LOAD
InterPro	Nucleoporin_Nup85	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:287830	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116185	IMAGE-MGC_LOAD
NCBI Gene	287830	ENTREZGENE
PANTHER	NUCLEAR PORE COMPLEX PROTEIN NUP85	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13373	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Nucleopor_Nup85	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nup85	PhenoGen
RatGTEx	ENSRNOG00000003673	RatGTEx
UniProt	A0A8I5ZPV6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GKK7_RAT	UniProtKB/TrEMBL
	NUP85_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-10-22	Nup85	nucleoporin 85	Nup85	nucleoporin 85kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Nup85	nucleoporin 85kDa	Nup85	nucleoporin 85	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Nup85	nucleoporin 85	Pcnt1	pericentrin 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Pcnt1	pericentrin 1	Pcnt1_predicted	pericentrin 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pcnt1_predicted	pericentrin 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)