Symbol:
Nup85
Name:
nucleoporin 85
RGD ID:
1551928
MGI Page
MGI
Description:
Predicted to enable CCR2 chemokine receptor binding activity. Predicted to be a structural constituent of nuclear pore. Acts upstream of or within lamellipodium assembly and macrophage chemotaxis. Predicted to be located in cytosol; nucleus; and plasma membrane. Predicted to be part of nuclear pore outer ring. Predicted to colocalize with kinetochore. Is expressed in several structures, including blastocyst; cerebral cortex ventricular layer; early embryo; and extraembryonic component. Human ortholog(s) of this gene implicated in nephrotic syndrome type 17. Orthologous to human NUP85 (nucleoporin 85).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
85 kDa nucleoporin; fro; frount; MGC105225; nuclear pore complex protein Nup85; nucleoporin Nup85; Pcn; Pcnt1; pericentrin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NUP85 (nucleoporin 85) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Nup85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nup85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NUP85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NUP85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nup85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NUP85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NUP85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nup85 (nucleoporin 85) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Nup85 (nucleoporin 85)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NUP85 (nucleoporin 85)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nup85 (nucleoporin 85)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
NUP85
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Nup75
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
npp-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
nup85
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 115,455,264 - 115,474,750 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 115,455,260 - 115,474,811 (+) Ensembl GRCm39 Ensembl GRCm38 11 115,564,432 - 115,583,924 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 115,564,434 - 115,583,985 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 115,425,758 - 115,445,226 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 115,380,572 - 115,400,075 (+) NCBI MGSCv36 mm8 Celera 11 127,337,030 - 127,351,679 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 80.87 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nup85 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO NUP85 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NUP85 mRNA CTD PMID:22079256 Nup85 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NUP85 mRNA CTD PMID:22206623 Nup85 Mouse 17beta-estradiol increases expression ISO Nup85 (Rattus norvegicus) 6480464 Estradiol results in increased expression of NUP85 mRNA CTD PMID:32145629 Nup85 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Nup85 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Nup85 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NUP85 mRNA CTD PMID:21215274 Nup85 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nup85 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NUP85 mRNA CTD PMID:33387578 Nup85 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NUP85 mRNA CTD PMID:21570461 Nup85 Mouse 2,4-dinitrotoluene affects expression ISO Nup85 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of NUP85 mRNA CTD PMID:21346803 Nup85 Mouse 2,6-dinitrotoluene affects expression ISO Nup85 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of NUP85 mRNA CTD PMID:21346803 Nup85 Mouse 2-butoxyethanol increases expression EXP 6480464 n-butoxyethanol results in increased expression of NUP85 mRNA CTD PMID:19812364 Nup85 Mouse 3-chloropropane-1,2-diol increases expression ISO Nup85 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of NUP85 protein CTD PMID:34915118 Nup85 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of NUP85 mRNA CTD PMID:39298647 Nup85 Mouse 4-hydroxynon-2-enal increases expression EXP 6480464 4-hydroxy-2-nonenal results in increased expression of NUP85 mRNA CTD PMID:19191707 Nup85 Mouse acrolein multiple interactions ISO NUP85 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NUP85 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of NUP85 mRNA CTD PMID:32699268 Nup85 Mouse all-trans-retinoic acid decreases expression ISO NUP85 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NUP85 mRNA CTD PMID:33167477 Nup85 Mouse alpha-pinene multiple interactions ISO NUP85 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NUP85 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of NUP85 mRNA CTD PMID:32699268 Nup85 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NUP85 mRNA CTD PMID:22228805 Nup85 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO NUP85 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Nup85 Mouse benzo[e]pyrene increases methylation ISO NUP85 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of NUP85 intron CTD PMID:30157460 Nup85 Mouse bisphenol A increases expression ISO Nup85 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NUP85 mRNA CTD PMID:25181051 and PMID:32145629 Nup85 Mouse bisphenol A decreases expression ISO Nup85 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of NUP85 mRNA CTD PMID:34947998 Nup85 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NUP85 mRNA CTD PMID:33221593 Nup85 Mouse bisphenol A decreases expression ISO NUP85 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NUP85 mRNA and bisphenol A results in decreased expression of NUP85 protein CTD PMID:29275510 and PMID:37567409 Nup85 Mouse captan decreases expression EXP 6480464 Captan results in decreased expression of NUP85 mRNA CTD PMID:31558096 Nup85 Mouse carbon nanotube multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of NUP85 protein CTD PMID:34864091 Nup85 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of NUP85 mRNA CTD PMID:37019170 Nup85 Mouse chrysene increases expression EXP 6480464 chrysene results in increased expression of NUP85 mRNA CTD PMID:26377693 Nup85 Mouse copper(II) sulfate decreases expression ISO NUP85 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NUP85 mRNA CTD PMID:19549813 Nup85 Mouse coumarin increases phosphorylation ISO NUP85 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of NUP85 protein CTD PMID:35688186 Nup85 Mouse coumestrol increases expression ISO NUP85 (Homo sapiens) 6480464 Coumestrol results in increased expression of NUP85 mRNA CTD PMID:19167446 Nup85 Mouse DDE increases expression ISO NUP85 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NUP85 mRNA CTD PMID:38568856 Nup85 Mouse deguelin decreases expression ISO NUP85 (Homo sapiens) 6480464 deguelin results in decreased expression of NUP85 mRNA CTD PMID:33512557 Nup85 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NUP85 mRNA CTD PMID:21266533 Nup85 Mouse dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of NUP85 protein CTD PMID:34864091 Nup85 Mouse enzyme inhibitor multiple interactions ISO NUP85 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NUP85 protein CTD PMID:23301498 Nup85 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NUP85 mRNA CTD PMID:22206623 Nup85 Mouse folpet decreases expression EXP 6480464 folpet results in decreased expression of NUP85 mRNA CTD PMID:31558096 Nup85 Mouse ivermectin decreases expression ISO NUP85 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NUP85 protein CTD PMID:32959892 Nup85 Mouse methapyrilene increases methylation ISO NUP85 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of NUP85 intron CTD PMID:30157460 Nup85 Mouse N(4)-hydroxycytidine decreases expression EXP 6480464 N(4)-hydroxycytidine results in decreased expression of NUP85 mRNA CTD PMID:37748715 Nup85 Mouse oxaliplatin multiple interactions ISO Nup85 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NUP85 mRNA CTD PMID:25729387 Nup85 Mouse oxaliplatin decreases expression ISO Nup85 (Rattus norvegicus) 6480464 oxaliplatin results in decreased expression of NUP85 mRNA CTD PMID:25729387 Nup85 Mouse ozone multiple interactions ISO NUP85 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NUP85 mRNA more ... CTD PMID:32699268 Nup85 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of NUP85 mRNA CTD PMID:17562736 Nup85 Mouse paracetamol decreases expression ISO NUP85 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NUP85 mRNA CTD PMID:21420995 Nup85 Mouse paraquat decreases expression ISO NUP85 (Homo sapiens) 6480464 Paraquat results in decreased expression of NUP85 mRNA CTD PMID:35182771 Nup85 Mouse piroxicam decreases expression ISO NUP85 (Homo sapiens) 6480464 Piroxicam results in decreased expression of NUP85 mRNA CTD PMID:21858171 Nup85 Mouse potassium chromate multiple interactions ISO NUP85 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NUP85 mRNA CTD PMID:22079256 Nup85 Mouse potassium chromate decreases expression ISO NUP85 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of NUP85 mRNA CTD PMID:22079256 Nup85 Mouse propanal decreases expression ISO NUP85 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of NUP85 mRNA CTD PMID:26079696 Nup85 Mouse quercetin increases expression ISO NUP85 (Homo sapiens) 6480464 Quercetin results in increased expression of NUP85 mRNA CTD PMID:21632981 Nup85 Mouse rotenone decreases expression ISO NUP85 (Homo sapiens) 6480464 Rotenone results in decreased expression of NUP85 mRNA CTD PMID:33512557 Nup85 Mouse sodium arsenite increases expression ISO NUP85 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NUP85 mRNA CTD PMID:28595984 and PMID:34032870 Nup85 Mouse sodium arsenite multiple interactions ISO NUP85 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [NUP85 protein binds to CAPRIN1 protein] CTD PMID:33939924 Nup85 Mouse sodium arsenite decreases expression ISO NUP85 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NUP85 mRNA CTD PMID:38568856 Nup85 Mouse sodium dichromate affects expression ISO Nup85 (Rattus norvegicus) 6480464 sodium bichromate affects the expression of NUP85 mRNA CTD PMID:22110744 Nup85 Mouse sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of NUP85 mRNA CTD PMID:31558096 Nup85 Mouse sodium dichromate increases expression ISO Nup85 (Rattus norvegicus) 6480464 sodium bichromate results in increased expression of NUP85 mRNA CTD PMID:25993096 Nup85 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NUP85 mRNA CTD PMID:31919559 Nup85 Mouse thioacetamide increases expression ISO Nup85 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of NUP85 mRNA CTD PMID:23411599 Nup85 Mouse topotecan multiple interactions ISO Nup85 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NUP85 mRNA CTD PMID:25729387 Nup85 Mouse triphenyl phosphate affects expression ISO NUP85 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NUP85 mRNA CTD PMID:37042841 Nup85 Mouse valproic acid decreases expression ISO NUP85 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NUP85 mRNA CTD PMID:23179753 Nup85 Mouse valproic acid affects expression ISO NUP85 (Homo sapiens) 6480464 Valproic Acid affects the expression of NUP85 mRNA CTD PMID:25979313
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-butoxyethanol (EXP) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxynon-2-enal (EXP) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) captan (EXP) carbon nanotube (EXP) chlorpyrifos (EXP) chrysene (EXP) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) DDE (ISO) deguelin (ISO) dibutyl phthalate (EXP) enzyme inhibitor (ISO) folic acid (EXP) folpet (EXP) ivermectin (ISO) methapyrilene (ISO) N(4)-hydroxycytidine (EXP) oxaliplatin (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) piroxicam (ISO) potassium chromate (ISO) propanal (ISO) quercetin (ISO) rotenone (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) tetrachloromethane (EXP) thioacetamide (ISO) topotecan (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Nup85 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 115,455,264 - 115,474,750 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 115,455,260 - 115,474,811 (+) Ensembl GRCm39 Ensembl GRCm38 11 115,564,432 - 115,583,924 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 115,564,434 - 115,583,985 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 115,425,758 - 115,445,226 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 115,380,572 - 115,400,075 (+) NCBI MGSCv36 mm8 Celera 11 127,337,030 - 127,351,679 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 80.87 NCBI
NUP85 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 75,205,679 - 75,235,758 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 75,205,659 - 75,235,758 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 73,201,774 - 73,231,853 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 70,713,192 - 70,743,449 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 70,713,380 - 70,743,447 NCBI Celera 17 69,793,975 - 69,824,185 (+) NCBI Celera Cytogenetic Map 17 q25.1 NCBI HuRef 17 68,611,339 - 68,641,549 (+) NCBI HuRef CHM1_1 17 73,266,184 - 73,296,417 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 76,097,807 - 76,127,836 (+) NCBI T2T-CHM13v2.0
Nup85 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 101,305,241 - 101,323,980 (+) NCBI GRCr8 mRatBN7.2 10 100,806,482 - 100,825,029 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 100,806,437 - 100,825,043 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 105,866,595 - 105,885,241 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 105,329,668 - 105,348,314 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 100,727,451 - 100,746,001 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 104,118,999 - 104,137,258 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 104,118,945 - 104,137,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 104,144,378 - 104,162,637 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 105,645,505 - 105,665,079 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 105,660,008 - 105,679,580 (+) NCBI Celera 10 99,381,083 - 99,399,472 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
Nup85 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955553 2,079,503 - 2,107,807 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955553 2,079,418 - 2,107,894 (+) NCBI ChiLan1.0 ChiLan1.0
NUP85 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 91,243,861 - 91,275,146 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 96,067,989 - 96,098,214 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 69,152,452 - 69,182,688 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 74,715,056 - 74,735,706 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 74,708,654 - 74,735,628 (+) Ensembl panpan1.1 panPan2
NUP85 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 5,251,387 - 5,298,096 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 5,251,419 - 5,285,338 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 5,930,369 - 5,977,004 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 5,921,442 - 5,968,402 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 5,921,442 - 5,968,410 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 5,960,174 - 6,006,787 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 6,070,418 - 6,117,068 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 6,130,422 - 6,177,075 (-) NCBI UU_Cfam_GSD_1.0
Nup85
NUP85 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 6,071,812 - 6,103,979 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 6,072,731 - 6,103,972 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 6,035,178 - 6,066,433 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NUP85 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 46,433,821 - 46,463,822 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 46,433,579 - 46,463,759 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 17,203,748 - 17,236,457 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nup85
.
Predicted Target Of
Count of predictions: 897 Count of miRNA genes: 481 Interacting mature miRNAs: 563 Transcripts: ENSMUST00000021085, ENSMUST00000127126, ENSMUST00000128745, ENSMUST00000134209, ENSMUST00000135893, ENSMUST00000138998, ENSMUST00000140986, ENSMUST00000143351, ENSMUST00000144473 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1302034 Pkccl_m protein kinase C content in lungs (mouse) Not determined 11 91604608 121973369 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 1301072 Eae22_m experimental allergic encephalomyelitis 22 (mouse) Not determined 11 82377698 116377820 Mouse 1300944 Alcp20_m alcohol preference locus 20 (mouse) Not determined 11 95403965 121973369 Mouse 1301012 Vispl_m visual placing (mouse) Not determined 11 101022590 121973369 Mouse 4141939 Pregq2_m pregnancy QTL 2 (mouse) Not determined 11 94063779 118022724 Mouse 1301983 Berr2_m berghei resistance locus 2 (mouse) Not determined 11 98352609 121973369 Mouse 1300766 Skull16_m skull morphology 16 (mouse) Not determined 11 81574481 115574636 Mouse 10043976 Obq33_m obesity QTL 33 (mouse) Not determined 11 98500469 121973369 Mouse 1301057 Nidd4_m non-insulin-dependent diabetes mellitus 4 (mouse) Not determined 11 96810136 121973369 Mouse 1301958 Alcp18_m alcohol preference locus 18 (mouse) Not determined 11 95403965 121973369 Mouse 14747003 Mancz9_m mandible centroid size 9 (mouse) 11 85844911 119844911 Mouse 10412288 Carg4_m Candida albicans resistance gene 4 (mouse) Not determined 11 81810267 115810267 Mouse 11251723 Ewc5_m ethanol withdrawal and consumption 5 (mouse) 11 89869251 121973369 Mouse 15014785 Mvlq1_m macrovesicular liver lesion QTL 1 (mouse) 11 86608320 120608320 Mouse 4141465 Dbm2_m diabetes modifier 2 (mouse) Not determined 94437183 118022724 Mouse 15039374 Adip29_m adiposity 29 (mouse) 11 86608320 120608320 Mouse 1300962 Cd8mts4_m CD8 memory T cell subset 4 (mouse) Not determined 11 96137674 121973369 Mouse 1301095 El6_m epilepsy 6 (mouse) Not determined 11 93229183 121973369 Mouse 27226731 Tibmd4_m tibia midshaft diameter 4, 10 week (mouse) 11 94190826 118890826 Mouse 11341721 Rvfs2_m Rift Valley fever susceptibility 2 (mouse) 11 100254186 120887165 Mouse 15039376 Bw42_m body weight QTL 42 (mouse) 11 86608320 120608320 Mouse 1558753 Ath19_m atherosclerosis 19 (mouse) Not determined 11 91604608 121973369 Mouse 10044001 Alcw8_m alcohol withdrawal 8 (mouse) Not determined 11 99254187 121973369 Mouse 1300649 Crhq1_m compensatory renal hypertrophy QTL 1 (mouse) Not determined 11 81574481 115574636 Mouse 27226789 Feml16_m femur length 16, 10 week (mouse) 11 87490826 121873369 Mouse 11553867 Stmm5_m skin tumor modifier of MSM 5 (mouse) 11 100058103 121973369 Mouse 10044007 Hbnr14_m Heligmosomoides bakeri nematode resistance 14 (mouse) Not determined 11 87502600 121502698 Mouse
42.MHAa95d6.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 115,573,796 - 115,573,954 UniSTS GRCm38 MGSCv37 11 115,435,110 - 115,435,268 UniSTS GRCm37 Celera 11 127,341,474 - 127,341,632 UniSTS Celera 11 127,341,000 - 127,341,632 UniSTS Cytogenetic Map 11 E2 UniSTS Whitehead_YAC 11 UniSTS
Cda0wb11
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 115,583,722 - 115,583,868 UniSTS GRCm38 MGSCv37 11 115,445,036 - 115,445,182 UniSTS GRCm37 Celera 11 127,351,489 - 127,351,635 UniSTS Cytogenetic Map 11 E2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000021085 ⟹ ENSMUSP00000021085
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,455,260 - 115,474,811 (+) Ensembl GRCm38.p6 Ensembl 11 115,564,434 - 115,583,985 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000127126
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,471,922 - 115,472,860 (+) Ensembl GRCm38.p6 Ensembl 11 115,581,096 - 115,582,034 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000128745
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,472,574 - 115,473,104 (+) Ensembl GRCm38.p6 Ensembl 11 115,581,748 - 115,582,278 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000134209
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,473,883 - 115,474,609 (+) Ensembl GRCm38.p6 Ensembl 11 115,583,057 - 115,583,783 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000135893
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,455,351 - 115,460,717 (+) Ensembl GRCm38.p6 Ensembl 11 115,564,525 - 115,569,891 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138998
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,472,467 - 115,474,732 (+) Ensembl GRCm38.p6 Ensembl 11 115,581,641 - 115,583,906 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140986 ⟹ ENSMUSP00000117333
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,468,810 - 115,472,865 (+) Ensembl GRCm38.p6 Ensembl 11 115,577,984 - 115,582,039 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143351
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,471,330 - 115,472,245 (+) Ensembl GRCm38.p6 Ensembl 11 115,580,504 - 115,581,419 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144473 ⟹ ENSMUSP00000116069
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 115,460,941 - 115,472,669 (+) Ensembl GRCm38.p6 Ensembl 11 115,570,115 - 115,581,843 (+) Ensembl
RefSeq Acc Id:
NM_001002929 ⟹ NP_001002929
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,270 - 115,474,750 (+) NCBI GRCm38 11 115,564,444 - 115,583,924 (+) NCBI MGSCv37 11 115,425,758 - 115,445,226 (+) RGD Celera 11 127,337,031 - 127,351,691 (+) ENTREZGENE cM Map 11 ENTREZGENE
Sequence:
CTCTTTGGCAGCTGTCTGTGAGCGGGAGGCCTGAGCGCAGAGAAGCGGCCGCGCGGCAGGGTCCCAGCCGCGGGGGGCACGGCGCTATGGAGGAGCTCGACTGCGAGCCCGCAGTAACTTGGATTCCA
hide sequence
RefSeq Acc Id:
XM_006533670 ⟹ XP_006533733
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,264 - 115,474,738 (+) NCBI GRCm38 11 115,564,432 - 115,583,906 (+) NCBI
Sequence:
GGGGTCCTCTTTGGCAGCTGTCTGTGAGCGGGAGGCCTGAGCGCAGAGAAGCGGCCGCGCGGCA
hide sequence
RefSeq Acc Id:
XM_006533671 ⟹ XP_006533734
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,316 - 115,474,738 (+) NCBI GRCm38 11 115,564,484 - 115,583,906 (+) NCBI
Sequence:
GGCCGCGCGGCAGGGTCCCAGCCGCGGGGGGCACGGCGCTATGGAGGAGCTCGACTGCGAGCCC
hide sequence
RefSeq Acc Id:
XM_030246116 ⟹ XP_030101976
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,316 - 115,474,738 (+) NCBI GRCm38 11 115,564,495 - 115,583,906 (+) NCBI
Sequence:
GGCCGCGCGGCAGGGTCCCAGCCGCGGGGGGCACGGCGCTATGGAGGAGCTCGACTGCGAGCCC
hide sequence
RefSeq Acc Id:
XR_004936985
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,264 - 115,474,738 (+) NCBI
Sequence:
GGGGTCCTCTTTGGCAGCTGTCTGTGAGCGGGAGGCCTGAGCGCAGAGAAGCGGCCGCGCGGCA
hide sequence
RefSeq Acc Id:
XR_004936986
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,264 - 115,474,729 (+) NCBI
Sequence:
GGGGTCCTCTTTGGCAGCTGTCTGTGAGCGGGAGGCCTGAGCGCAGAGAAGCGGCCGCGCGGCAGGGTCCCAGCCGCGGGGGGCACGGCGCTATGGAGGAGCTCGACTGCGAGCCCGCAGTAACTTGG
hide sequence
RefSeq Acc Id:
XR_388489
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 115,455,264 - 115,474,738 (+) NCBI GRCm38 11 115,564,433 - 115,583,906 (+) NCBI
Sequence:
GGGGTCCTCTTTGGCAGCTGTCTGTGAGCGGGAGGCCTGAGCGCAGAGAAGCGGCCGCGCGGCAGGGTCCCAGCCGCGGGGGGCACGGCGCTATGGAGGAGCTCGACTGCGAGCCCGCAGTAACTTGG
hide sequence
RefSeq Acc Id:
NP_001002929 ⟸ NM_001002929
- UniProtKB:
A2A9X0 (UniProtKB/Swiss-Prot), A2A9W9 (UniProtKB/Swiss-Prot), Q9CYI9 (UniProtKB/Swiss-Prot), Q8R480 (UniProtKB/Swiss-Prot)
- Sequence:
MEELDCEPAVTWIPGVNSKKKQMCFDWGPGEMLLCETSFNQTGKSEKVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFVGLQKIEEELSGKSRKAQLVRVSKNYRSVIRACMEEMHQVAIAAKDPAS
hide sequence
RefSeq Acc Id:
XP_006533733 ⟸ XM_006533670
- Peptide Label:
isoform X1
- Sequence:
MEELDCEPAVTWIPGVNSKKKQMCFDWGPGEMLLCETSFNQTGKSEKVPSCPFIYIIRKDVDVY
hide sequence
RefSeq Acc Id:
XP_006533734 ⟸ XM_006533671
- Peptide Label:
isoform X2
- Sequence:
MCFDWGPGEMLLCETSFNQTGKSEKVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFVGLQKIEEELSGKSRKAQLVRVSKNYRSVIRACMEEMHQVAIAAKDPASGRQFSSQVSILSAMELIWNLCE
hide sequence
RefSeq Acc Id:
XP_030101976 ⟸ XM_030246116
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSMUSP00000116069 ⟸ ENSMUST00000144473
Ensembl Acc Id:
ENSMUSP00000117333 ⟸ ENSMUST00000140986
Ensembl Acc Id:
ENSMUSP00000021085 ⟸ ENSMUST00000021085
RGD ID: 6821470 Promoter ID: MM_KWN:10538 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000106510, OTTMUST00000007443, OTTMUST00000007447 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 115,425,376 - 115,425,876 (+) MPROMDB
RGD ID: 6821469 Promoter ID: MM_KWN:10540 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Lung Transcripts: ENSMUST00000106511, OTTMUST00000007444 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 115,439,221 - 115,439,721 (+) MPROMDB
RGD ID: 6821473 Promoter ID: MM_KWN:10542 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: MEF_B6 Transcripts: OTTMUST00000007446, OTTMUST00000014285, OTTMUST00000014286 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 115,442,481 - 115,442,981 (+) MPROMDB
RGD ID: 6821466 Promoter ID: MM_KWN:10543 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, MEF_B4, MEF_B6 Transcripts: OTTMUST00000007449 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 115,443,851 - 115,444,607 (+) MPROMDB
RGD ID: 8677358 Promoter ID: EPDNEW_M16710 Type: initiation region Name: Nup85_1 Description: Mus musculus nucleoporin 85 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 115,564,482 - 115,564,542 EPDNEW
