Advanced Search (OLGA)

Gene: Tcirg1 (T-cell immune regulator 1, ATPase H+ transporting V0 subunit A3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tcirg1

Name:

T-cell immune regulator 1, ATPase H+ transporting V0 subunit A3

RGD ID:

735136

Description:

Predicted to enable ATPase binding activity. Predicted to be involved in vacuolar acidification. Predicted to act upstream of or within several processes, including T cell activation; odontogenesis; and regulation of pH. Predicted to be located in several cellular components, including apical plasma membrane; cytoplasmic vesicle; and lysosome. Predicted to be part of vacuolar proton-transporting V-type ATPase complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in autosomal recessive osteopetrosis 1. Orthologous to human TCIRG1 (T cell immune regulator 1, ATPase H+ transporting V0 subunit a3); PARTICIPATES IN oxidative phosphorylation pathway; phagocytosis pathway; rheumatoid arthritis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATPase, H+ transporting, lysosomal V0 protein a; MGC72583; OC116; osteoclastic proton pump; T cell immune response cDNA7 protein; T-cell, immune regulator 1; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a isoform 3; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3; T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3; TIRC7; v-ATPase 116-kDa; v-H+ATPase subunit a3; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a 3; V-type proton ATPase 116 kDa subunit a isoform 3; V-type proton ATPase 116 kDa subunit a3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	210,556,270 - 210,568,021 (-)	NCBI		GRCr8
mRatBN7.2	1	201,127,034 - 201,138,787 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,127,034 - 201,138,742 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,500,301 - 209,509,672 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	216,589,084 - 216,598,473 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	209,263,286 - 209,272,675 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	219,126,687 - 219,139,466 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,127,602 - 219,139,464 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	225,999,292 - 226,012,069 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,420,106 - 206,429,495 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	206,573,497 - 206,585,222 (-)	NCBI
Celera	1	198,679,648 - 198,689,037 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	autosomal recessive osteopetrosis 1		ISO	TCIRG1 (Homo sapiens)	1599350	DNA:deletions and snps:exons:multiple (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	Aicardi-Goutieres Syndrome 3		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 3	ClinVar	PMID:28492532
Tcirg1	Rat	autosomal recessive osteopetrosis 1		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10888887 more ...
Tcirg1	Rat	choreaacanthocytosis		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chorea-acanthocytosis	ClinVar	PMID:10888887 more ...
Tcirg1	Rat	genetic disease		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10942435 more ...
Tcirg1	Rat	immunodeficiency 90		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Infections more ...	ClinVar	PMID:28492532
Tcirg1	Rat	intellectual disability		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Tcirg1	Rat	Leigh disease		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:25741868
Tcirg1	Rat	mitochondrial complex I deficiency		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mitochondrial complex I deficiency	ClinVar	PMID:25741868
Tcirg1	Rat	nuclear type mitochondrial complex I deficiency 1		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mitochondrial complex I deficiency and nuclear type 1	ClinVar	PMID:25741868
Tcirg1	Rat	osteopetrosis		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Osteopetrosis	ClinVar	PMID:10888887 more ...
Tcirg1	Rat	osteosclerosis		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Osteosclerosis	ClinVar	PMID:22231430 more ...
Tcirg1	Rat	severe congenital neutropenia		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia	ClinVar	PMID:24753205
Tcirg1	Rat	severe congenital neutropenia 1		ISO	TCIRG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neutropenia more ...	ClinVar	PMID:22231430 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	autosomal recessive osteopetrosis 1		ISO	TCIRG1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	autosomal recessive osteopetrosis 1		ISS	Tcirg1 (Mus musculus)	13592920	OMIM:259700	MouseDO
Tcirg1	Rat	clubfoot		ISS	Tcirg1 (Mus musculus)	13592920	OMIM:119800	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	autosomal recessive osteopetrosis 1		ISO	TCIRG1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	(-)-demecolcine	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Demecolcine results in decreased expression of TCIRG1 mRNA	CTD	PMID:23649840
Tcirg1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of TCIRG1 mRNA	CTD	PMID:22206623
Tcirg1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TCIRG1 mRNA]	CTD	PMID:22206623
Tcirg1	Rat	17beta-estradiol	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	Estradiol results in decreased expression of TCIRG1 mRNA	CTD	PMID:39298647
Tcirg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of TCIRG1 mRNA	CTD	PMID:20106945
Tcirg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of TCIRG1 mRNA	CTD	PMID:33387578 and PMID:34747641
Tcirg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tcirg1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TCIRG1 mRNA	CTD	PMID:21570461
Tcirg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of TCIRG1 mRNA	CTD	PMID:21215274
Tcirg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of TCIRG1 mRNA]	CTD	PMID:21215274
Tcirg1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of TCIRG1 mRNA	CTD	PMID:21346803
Tcirg1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of TCIRG1 protein	CTD	PMID:34915118
Tcirg1	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of TCIRG1 mRNA	CTD	PMID:18648102
Tcirg1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	bisphenol S results in decreased expression of TCIRG1 mRNA	CTD	PMID:39298647
Tcirg1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of TCIRG1 mRNA	CTD	PMID:31881176
Tcirg1	Rat	acetylsalicylic acid	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Aspirin results in increased expression of TCIRG1 mRNA	CTD	PMID:11906190
Tcirg1	Rat	aflatoxin B1	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of TCIRG1 mRNA	CTD	PMID:19770486
Tcirg1	Rat	aflatoxin B1	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of TCIRG1 mRNA	CTD	PMID:27153756
Tcirg1	Rat	all-trans-retinoic acid	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Tretinoin results in increased expression of TCIRG1 mRNA	CTD	PMID:15498508 and PMID:33167477
Tcirg1	Rat	antirheumatic drug	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of TCIRG1 mRNA	CTD	PMID:24449571
Tcirg1	Rat	aristolochic acid A	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of TCIRG1 mRNA	CTD	PMID:33212167
Tcirg1	Rat	arsane	affects methylation	ISO	TCIRG1 (Homo sapiens)	6480464	Arsenic affects the methylation of TCIRG1 gene	CTD	PMID:25304211
Tcirg1	Rat	arsenic atom	affects methylation	ISO	TCIRG1 (Homo sapiens)	6480464	Arsenic affects the methylation of TCIRG1 gene	CTD	PMID:25304211
Tcirg1	Rat	benzo[a]pyrene	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TCIRG1 mRNA	CTD	PMID:22228805
Tcirg1	Rat	beta-lapachone	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of TCIRG1 mRNA	CTD	PMID:38218311
Tcirg1	Rat	beta-lapachone	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	beta-lapachone results in increased expression of TCIRG1 mRNA	CTD	PMID:38218311
Tcirg1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TCIRG1 mRNA	CTD	PMID:25181051
Tcirg1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TCIRG1 mRNA	CTD	PMID:32145629 and PMID:35192832
Tcirg1	Rat	bisphenol A	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	bisphenol A results in decreased expression of TCIRG1 mRNA	CTD	PMID:35598803
Tcirg1	Rat	bisphenol A	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	bisphenol A results in increased expression of TCIRG1 mRNA	CTD	PMID:33221593
Tcirg1	Rat	bisphenol F	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	bisphenol F results in decreased expression of TCIRG1 mRNA	CTD	PMID:38685157
Tcirg1	Rat	buspirone	decreases expression	EXP		6480464	Buspirone results in decreased expression of TCIRG1 mRNA	CTD	PMID:24136188
Tcirg1	Rat	cadmium dichloride	affects methylation	EXP		6480464	Cadmium Chloride affects the methylation of TCIRG1 promoter	CTD	PMID:22457795
Tcirg1	Rat	carbon nanotube	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Tcirg1	Rat	cisplatin	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of TCIRG1 mRNA	CTD	PMID:27392435
Tcirg1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of TCIRG1 mRNA	CTD	PMID:27523638
Tcirg1	Rat	diazinon	increases methylation	ISO	TCIRG1 (Homo sapiens)	6480464	Diazinon results in increased methylation of TCIRG1 gene	CTD	PMID:22964155
Tcirg1	Rat	dichloroacetic acid	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	Dichloroacetic Acid results in decreased expression of TCIRG1 protein	CTD	PMID:22705712
Tcirg1	Rat	dorsomorphin	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TCIRG1 mRNA	CTD	PMID:27188386
Tcirg1	Rat	doxorubicin	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of TCIRG1 mRNA	CTD	PMID:29803840
Tcirg1	Rat	endosulfan	affects expression	EXP		6480464	Endosulfan affects the expression of TCIRG1 mRNA	CTD	PMID:29391264
Tcirg1	Rat	entinostat	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	entinostat results in increased expression of TCIRG1 mRNA	CTD	PMID:27188386
Tcirg1	Rat	entinostat	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TCIRG1 mRNA	CTD	PMID:27188386
Tcirg1	Rat	epoxiconazole	decreases expression	ISO	Tcirg1 (Mus musculus)	6480464	epoxiconazole results in decreased expression of TCIRG1 mRNA	CTD	PMID:35436446
Tcirg1	Rat	ethanol	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TCIRG1 mRNA	CTD	PMID:30517762
Tcirg1	Rat	ethanol	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Ethanol results in increased expression of TCIRG1 mRNA	CTD	PMID:30319688
Tcirg1	Rat	ethanol	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of TCIRG1 mRNA	CTD	PMID:29432896
Tcirg1	Rat	fenamidone	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	fenamidone results in increased expression of TCIRG1 mRNA	CTD	PMID:27029645
Tcirg1	Rat	folic acid	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TCIRG1 mRNA]	CTD	PMID:22206623
Tcirg1	Rat	FR900359	affects phosphorylation	ISO	TCIRG1 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of TCIRG1 protein	CTD	PMID:37730182
Tcirg1	Rat	ivermectin	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of TCIRG1 protein	CTD	PMID:32959892
Tcirg1	Rat	levofloxacin	decreases expression	EXP		6480464	Levofloxacin results in decreased expression of TCIRG1 mRNA	CTD	PMID:24136188
Tcirg1	Rat	manganese atom	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of TCIRG1 mRNA	CTD	PMID:39836092
Tcirg1	Rat	manganese(0)	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of TCIRG1 mRNA	CTD	PMID:39836092
Tcirg1	Rat	manganese(II) chloride	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of TCIRG1 mRNA	CTD	PMID:39836092
Tcirg1	Rat	methylglyoxal	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	[TNFSF11 protein co-treated with Pyruvaldehyde] affects the expression of TCIRG1 mRNA	CTD	PMID:30217477
Tcirg1	Rat	nickel atom	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Nickel results in increased expression of TCIRG1 mRNA	CTD	PMID:24768652 and PMID:25583101
Tcirg1	Rat	ozone	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of TCIRG1 mRNA	CTD	PMID:35430440
Tcirg1	Rat	pentachlorophenol	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of TCIRG1 mRNA	CTD	PMID:23892564
Tcirg1	Rat	perfluorooctanoic acid	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of TCIRG1 protein	CTD	PMID:26879310
Tcirg1	Rat	pinostrobin	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	pinostrobin results in increased expression of TCIRG1 mRNA	CTD	PMID:37777166
Tcirg1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of TCIRG1 mRNA	CTD	PMID:19013527
Tcirg1	Rat	rotenone	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Rotenone results in increased expression of TCIRG1 mRNA	CTD	PMID:29955902 and PMID:31648047
Tcirg1	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of TCIRG1 mRNA	CTD	PMID:28374803
Tcirg1	Rat	SB 431542	multiple interactions	ISO	TCIRG1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TCIRG1 mRNA	CTD	PMID:27188386
Tcirg1	Rat	sodium arsenite	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	sodium arsenite results in increased expression of TCIRG1 protein	CTD	PMID:29044176
Tcirg1	Rat	sodium arsenite	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of TCIRG1 mRNA	CTD	PMID:34032870
Tcirg1	Rat	tamibarotene	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	tamibarotene results in increased expression of TCIRG1 mRNA	CTD	PMID:15498508
Tcirg1	Rat	tamoxifen	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Tamoxifen results in increased expression of TCIRG1 mRNA	CTD	PMID:17555576
Tcirg1	Rat	temozolomide	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Temozolomide results in decreased expression of TCIRG1 mRNA	CTD	PMID:31758290
Tcirg1	Rat	tetrachloromethane	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TCIRG1 mRNA	CTD	PMID:30517762
Tcirg1	Rat	tetrachloromethane	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of TCIRG1 mRNA	CTD	PMID:31919559
Tcirg1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of TCIRG1 mRNA	CTD	PMID:23411599 and PMID:34492290
Tcirg1	Rat	titanium dioxide	increases expression	ISO	Tcirg1 (Mus musculus)	6480464	titanium dioxide results in increased expression of TCIRG1 mRNA	CTD	PMID:23557971
Tcirg1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of TCIRG1 mRNA	CTD	PMID:33387578
Tcirg1	Rat	triphenyl phosphate	affects expression	ISO	TCIRG1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of TCIRG1 mRNA	CTD	PMID:37042841
Tcirg1	Rat	trovafloxacin	decreases expression	EXP		6480464	trovafloxacin results in decreased expression of TCIRG1 mRNA	CTD	PMID:24136188
Tcirg1	Rat	valproic acid	increases methylation	ISO	TCIRG1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of TCIRG1 gene	CTD	PMID:29154799
Tcirg1	Rat	valproic acid	increases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of TCIRG1 mRNA	CTD	PMID:28001369
Tcirg1	Rat	valproic acid	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of TCIRG1 mRNA	CTD	PMID:29154799 and PMID:37505509
Tcirg1	Rat	valproic acid	affects expression	ISO	TCIRG1 (Homo sapiens)	6480464	Valproic Acid affects the expression of TCIRG1 mRNA	CTD	PMID:25979313
Tcirg1	Rat	vincristine	decreases expression	ISO	TCIRG1 (Homo sapiens)	6480464	Vincristine results in decreased expression of TCIRG1 mRNA	CTD	PMID:23649840
Tcirg1	Rat	xanthohumol	multiple interactions	ISO	Tcirg1 (Mus musculus)	6480464	xanthohumol inhibits the reaction [TNFSF11 protein results in increased expression of TCIRG1 mRNA]	CTD	PMID:23994090

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	apoptotic process	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:5496553 PMID:21305608 and PMID:23908015	RGD	PMID:21305608 and PMID:23908015
Tcirg1	Rat	apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	autophagosome assembly	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	autophagosome assembly	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	autophagy	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	autophagy	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	B cell differentiation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 more ...	RGD	PMID:15284856 more ...
Tcirg1	Rat	B cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	bone resorption	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 more ...	RGD	PMID:18768394 more ...
Tcirg1	Rat	bone resorption	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	cellular response to cytokine stimulus	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3054898 PMID:15294947	RGD	PMID:15294947
Tcirg1	Rat	cellular response to cytokine stimulus	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	dentin mineralization	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:23174213	RGD	PMID:23174213
Tcirg1	Rat	dentin mineralization	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	enamel mineralization	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:23174213	RGD	PMID:23174213
Tcirg1	Rat	enamel mineralization	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	establishment of cell polarity	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	establishment of cell polarity	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	establishment of vesicle localization	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:29712939	RGD	PMID:29712939
Tcirg1	Rat	establishment of vesicle localization	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	gene expression	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22351931	RGD	PMID:22351931
Tcirg1	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	homeostasis of number of cells	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22087326 and PMID:22351931	RGD	PMID:22087326 and PMID:22351931
Tcirg1	Rat	homeostasis of number of cells	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	immunoglobulin mediated immune response	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:16542376	RGD	PMID:16542376
Tcirg1	Rat	immunoglobulin mediated immune response	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	inflammatory response	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23166162	RGD	PMID:23166162
Tcirg1	Rat	inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	intracellular calcium ion homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	intracellular calcium ion homeostasis	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:19448635	RGD	PMID:19448635
Tcirg1	Rat	intracellular pH reduction	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	intracellular pH reduction	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	macroautophagy	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:23704209	RGD	PMID:23704209
Tcirg1	Rat	macroautophagy	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	memory T cell activation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:16542376	RGD	PMID:16542376
Tcirg1	Rat	memory T cell activation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tcirg1	Rat	myeloid cell differentiation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:15284856	RGD	PMID:15284856
Tcirg1	Rat	myeloid cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	odontogenesis	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22245629	RGD	PMID:22245629
Tcirg1	Rat	odontogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	optic nerve development	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3852642 PMID:20711468	RGD	PMID:20711468
Tcirg1	Rat	optic nerve development	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	ossification	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	ossification	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22087326	RGD	PMID:22087326
Tcirg1	Rat	osteoclast differentiation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 more ...	RGD	PMID:18768394 more ...
Tcirg1	Rat	osteoclast differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	osteoclast proliferation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22087326	RGD	PMID:22087326
Tcirg1	Rat	osteoclast proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	pH reduction	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:19448635 and PMID:23297412	RGD	PMID:19448635 and PMID:23297412
Tcirg1	Rat	pH reduction	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	phagosome acidification	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3852642 PMID:19549681	RGD	PMID:19549681
Tcirg1	Rat	phagosome acidification	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	protein catabolic process in the vacuole	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:23704209	RGD	PMID:23704209
Tcirg1	Rat	protein catabolic process in the vacuole	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	proton transmembrane transport		NAS		1599346		RGD
Tcirg1	Rat	proton transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0375	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tcirg1	Rat	proton transmembrane transport	involved_in	IEA	InterPro:IPR002490	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tcirg1	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3054898 more ...	RGD	PMID:15294947 more ...
Tcirg1	Rat	regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	regulation of insulin secretion	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:17046993	RGD	PMID:17046993
Tcirg1	Rat	regulation of insulin secretion	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	regulation of osteoblast differentiation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22351931	RGD	PMID:22351931
Tcirg1	Rat	regulation of osteoblast differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	regulation of proton transport	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	regulation of proton transport	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:5496553 PMID:21305608	RGD	PMID:21305608
Tcirg1	Rat	response to silver ion	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3054898 PMID:15294947	RGD	PMID:15294947
Tcirg1	Rat	response to silver ion	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	retina development in camera-type eye	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3852642 PMID:20711468	RGD	PMID:20711468
Tcirg1	Rat	retina development in camera-type eye	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	ruffle organization	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23908015	RGD	PMID:23908015
Tcirg1	Rat	ruffle organization	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	T cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	T cell differentiation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:3054898 PMID:15294947	RGD	PMID:15294947
Tcirg1	Rat	T cell homeostasis	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	PMID:23166162	RGD	PMID:23166162
Tcirg1	Rat	T cell homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	T-helper 1 cell activation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	T-helper 1 cell activation	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:15284856	RGD	PMID:15284856
Tcirg1	Rat	tooth eruption	acts_upstream_of_or_within	ISO	Tcirg1 (Mus musculus)	1624291	MGI:1856973 PMID:22245629	RGD	PMID:22245629
Tcirg1	Rat	tooth eruption	acts_upstream_of_or_within	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	vacuolar acidification	involved_in	IBA	CGD:CAL0000191982 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	apical plasma membrane	located_in	ISO	TCIRG1 (Homo sapiens)	1624291	PMID:15800125	RGD	PMID:15800125
Tcirg1	Rat	apical plasma membrane	located_in	IEA	UniProtKB:Q13488 and ensembl:ENSP00000265686	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	late endosome	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	late endosome	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:12672822 and PMID:19549681	RGD	PMID:12672822 and PMID:19549681
Tcirg1	Rat	lysosome	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:12672822 and PMID:19549681	RGD	PMID:12672822 and PMID:19549681
Tcirg1	Rat	lysosome	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tcirg1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tcirg1	Rat	nucleus	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:22245629	RGD	PMID:22245629
Tcirg1	Rat	nucleus	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	phagocytic vesicle	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:19549681	RGD	PMID:19549681
Tcirg1	Rat	phagocytic vesicle	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	phagocytic vesicle membrane	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	phagocytic vesicle membrane	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:19549681	RGD	PMID:19549681
Tcirg1	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0028670 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tcirg1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	plasma membrane	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:10722719 and PMID:12672822	RGD	PMID:10722719 and PMID:12672822
Tcirg1	Rat	proton-transporting V-type ATPase, V0 domain	part_of	IEA	InterPro:IPR002490	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tcirg1	Rat	secretory granule membrane	located_in	IEA	UniProtKB:Q9JHF5 and ensembl:ENSMUSP00000120531	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tcirg1	Rat	secretory granule membrane	located_in	ISO	Tcirg1 (Mus musculus)	1624291	PMID:17046993	RGD	PMID:17046993
Tcirg1	Rat	vacuolar proton-transporting V-type ATPase complex	part_of	IBA	MGI:2153480 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tcirg1	Rat	vacuolar proton-transporting V-type ATPase, V0 domain	part_of	IEA	InterPro:IPR026028	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	ATPase binding	enables	IBA	PANTHER:PTN000179505 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tcirg1	Rat	protein binding	enables	ISO	TCIRG1 (Homo sapiens)	1624291	UniProtKB:O43711 more ...	RGD	PMID:32296183
Tcirg1	Rat	protein binding	enables	ISO	Tcirg1 (Mus musculus)	1624291	PR:P51150 more ...	RGD	PMID:29712939
Tcirg1	Rat	proton transmembrane transporter activity		NAS		1599346		RGD
Tcirg1	Rat	proton-transporting ATPase activity, rotational mechanism	enables	IEA	InterPro:IPR002490 and InterPro:IPR026028	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tcirg1	Rat	proton-transporting ATPase activity, rotational mechanism	enables	IEA	InterPro:IPR002490	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tcirg1	Rat	oxidative phosphorylation pathway		IEA		6907045		KEGG	rno:00190
Tcirg1	Rat	phagocytosis pathway		IEA		6907045		KEGG	rno:04145
Tcirg1	Rat	rheumatoid arthritis pathway		IEA		6907045		KEGG	rno:05323
Tcirg1	Rat	tuberculosis pathway		IEA		6907045		KEGG	rno:05152

BioCyc Pathways

ATP biosynthesis

#	Reference Title	Reference Citation
1.	Defects in TCIRG1 subunit of the vacuolar proton pump are responsible for a subset of human autosomal recessive osteopetrosis.	Frattini A, etal., Nat Genet. 2000 Jul;25(3):343-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Alternative splicing controls neuronal expression of v-ATPase subunit a1 and sorting to nerve terminals.	Poea-Guyon S, etal., J Biol Chem. 2006 Jun 23;281(25):17164-72. Epub 2006 Apr 18.
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Three subunit a isoforms of mouse vacuolar H(+)-ATPase. Preferential expression of the a3 isoform during osteoclast differentiation.	Toyomura T, etal., J Biol Chem 2000 Mar 24;275(12):8760-5.

PMID:12477932	PMID:12672822	PMID:15284856	PMID:15294947	PMID:15800125	PMID:16542376	PMID:16797412	PMID:17046993	PMID:17897319	PMID:18614015	PMID:18768394	PMID:19448635
PMID:19549681	PMID:20711468	PMID:21305608	PMID:22087326	PMID:22245629	PMID:22351931	PMID:23166162	PMID:23174213	PMID:23288846	PMID:23297412	PMID:23704209	PMID:23908015
PMID:29712939

Tcirg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	210,556,270 - 210,568,021 (-)	NCBI		GRCr8
mRatBN7.2	1	201,127,034 - 201,138,787 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,127,034 - 201,138,742 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,500,301 - 209,509,672 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	216,589,084 - 216,598,473 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	209,263,286 - 209,272,675 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	219,126,687 - 219,139,466 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,127,602 - 219,139,464 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	225,999,292 - 226,012,069 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,420,106 - 206,429,495 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	206,573,497 - 206,585,222 (-)	NCBI
Celera	1	198,679,648 - 198,689,037 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

TCIRG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	68,039,025 - 68,053,762 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	68,039,025 - 68,050,895 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	67,806,492 - 67,818,362 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	67,563,059 - 67,574,942 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	65,140,155 - 65,152,040 (+)	NCBI		Celera
Cytogenetic Map	11	q13.2	NCBI
HuRef	11	64,141,805 - 64,153,709 (+)	NCBI		HuRef
CHM1_1	11	67,690,218 - 67,702,120 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	68,042,666 - 68,057,403 (+)	NCBI		T2T-CHM13v2.0

Tcirg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	3,946,050 - 3,957,717 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	3,946,050 - 3,957,133 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	3,896,050 - 3,907,133 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	3,896,050 - 3,907,133 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	3,896,050 - 3,907,133 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	3,896,053 - 3,905,230 (-)	NCBI		MGSCv36	mm8
Celera	19	3,776,425 - 3,787,508 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	3.62	NCBI

Tcirg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	17,768,469 - 17,779,003 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	17,768,469 - 17,778,976 (-)	NCBI	ChiLan1.0	ChiLan1.0

TCIRG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	68,989,593 - 69,001,506 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	70,032,855 - 70,044,768 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	63,120,913 - 63,132,831 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	66,429,435 - 66,441,327 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	66,429,435 - 66,441,327 (+)	Ensembl	panpan1.1		panPan2

TCIRG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	49,784,480 - 49,794,361 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	49,784,490 - 49,794,317 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	48,393,818 - 48,403,688 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	50,705,711 - 50,715,580 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	50,703,574 - 50,715,558 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	49,919,281 - 49,929,147 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	49,494,101 - 49,503,970 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	50,287,643 - 50,297,518 (-)	NCBI		UU_Cfam_GSD_1.0

Tcirg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	5,627,790 - 5,636,842 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	2,066,847 - 2,079,206 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	2,070,211 - 2,079,169 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TCIRG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	4,844,637 - 4,860,498 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	4,844,627 - 4,860,562 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	3,476,372 - 3,488,494 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TCIRG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	6,484,469 - 6,497,008 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	6,484,474 - 6,494,719 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	103,762,696 - 103,775,284 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tcirg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	18,809,689 - 18,820,390 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	18,809,626 - 18,820,360 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tcirg1
38 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	36
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000023425
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	199773958	202166723	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_199089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006230728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ286426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023425 ⟹ ENSRNOP00000023425

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,127,034 - 201,138,742 (-)	Ensembl
Rnor_6.0 Ensembl	1	219,127,602 - 219,139,449 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089107 ⟹ ENSRNOP00000074537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,127,036 - 201,135,172 (-)	Ensembl
Rnor_6.0 Ensembl	1	219,127,740 - 219,139,464 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104991 ⟹ ENSRNOP00000079519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,127,034 - 201,138,733 (-)	Ensembl

RefSeq Acc Id:

NM_199089 ⟹ NP_954520

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,556,270 - 210,567,935 (-)	NCBI
mRatBN7.2	1	201,127,034 - 201,138,699 (-)	NCBI
Rnor_6.0	1	219,127,801 - 219,137,190 (-)	NCBI
Rnor_5.0	1	225,999,292 - 226,012,069 (-)	NCBI
RGSC_v3.4	1	206,420,106 - 206,429,495 (-)	RGD
Celera	1	198,679,648 - 198,689,037 (-)	RGD

Sequence:

show sequence

ATGGGCTCCATGTTCCGGAGTGAAGAGGTGGCCTTGGTCCAGCTCCTGTTGCCCACAGCATCTGCCTACAACTGTGTGAGCCAGCTGGGTGAGCTGGGCCTCGTGGAGTTTAGAGACCTCAACGAGTC
GGTGAGTGCCTTCCAGAGACGCTTCGTGGTAGAGGTCCGGCGCTGCGAGGAGCTGGAGAAGACCTTCACCTTCTTGCGGGAAGAAGTGCAGCGGGCAGGCCTGACACTGACCCCACCCGAGGGGACAC
TGCCAGCACCGCCTCCCCGAGACCTGCTGCGCATCCAGGAGGAAACGGACCGCTTGGCCCAGGAGCTTCGGGATGTTCGAGGCAACCAACAGGCACTTCGGGCCCAGCTGCACCAGCTACAGCTCCAC
TCAGCCGTGCTGGGCCAGAGCCACGCCCCTCCGATGGCAGCTGTCCATACGGAGGGACCCACCACTGAGAGAACACCCCTGCTTTCAGCCACCCCAGGGCCACATGCAGACCTGAAGGTCAATTTTGT
GGCAGGTGCTGTGGAGCCTTGCAAGGCTGCAGCCCTGGAGCGCCTGCTTTGGAGAGCTTGCCGCGGCTTCCTCATTGCCAGCTTTAAGGAGACTGAGGGGCAGCTGGAGGACCCGGTGACGGGTGAGC
CTGCAACTTGGATGACCTTTGTCATCTCCTACTGGGGTGAGCAGATCGGACAGAAGGTTCGGAAGATCACAGACTGCTTTCACTGTCATGTCTTCCCGTACCTGGAGCAGGAGGAAGCCCGGCTCAGG
ACCTTGCAGCAGCTGCAGCAGCAGAGCCAGGAGCTTCAGGAGGTCCTGGGGGAGACAGAACGGTTCCTGAGCCAGGTGTTGGGCCGGGTGCAGCAGCTGCTGCCCCCAGGGCAGGTGCAGATCCGGAA
GATGAAGGCCGTGCACCTGACCCTCAACCAGTGCAGTGTGAACACCACACACAAGTGCCTCATTGCGGAGGTCTGGTGTGCCACGAGGGACCTTCCCACTGTACAGCAGGCGCTGCAGAGCGGCTCGA
GTGAGGAAGGAGTGAGTGCTGTGGCTCACCGTATCCCTTGCCAGGACATGCCTCCAACTCTCATCAGGACCAACCGCTTCACCTCCAGCTTCCAGGGCATTGTGGATGCCTATGGTGTGGGCCGATAC
AGGGAAGTCAACCCTGCTCCCTACACCATCATCACATTCCCCTTCCTCTTTGCTGTGATGTTTGGCGACGTGGGCCACGGACTGCTCATGTTTCTCTTCGCCCTGGCTATGGTCCTCACTGAGAACCA
ACCAGCTGTAAAGACCACGCAAAATGAGATCTGGCAGACCTTCTTTGGGGGTCGCTACCTACCCCTGCTCATGGGTCTGTTCTCCATCTACACGGGCTTCATCTACAACGAGTGCTTCAGCCGAGCCA
CCACTATTTTCCCCTCAGGCTGGAGTGTGGCTGCCATGGCCAACCAGTCAGGCTGGAGTGACGAGTATCTGTCCCAGCACCCCATGCTTACCCTGAACCCTAACATCACTGGTGTCTTCCTCGGACCT
TATCCCTTCGGCATTGACCCGATCTGGAGCCTGGCCACCAACCACCTGAGCTTCCTCAACTCCTTCAAGATGAAGATGTCTGTCATCCTTGGGGTCACACACATGGCCTTTGGGGTGTTCCTCAGCAT
CTTCAACCATGTGCACTTTGGCCAGGCCCACCGGCTACTGCTGGAGACCGTGCCTGAGCTCATCTTCCTGTTGGGCCTCTTTGGCTACCTTGTTTTCCTCATTGTCTACAAGTGGCTCTACGTCTCAG
CTGCCAGCGCCTCCTCGGCCCCCAGTATCCTCATTCACTTCATCAATATGTTCCTCTTCTCCCAAAACCCCACCAATCGGCTGCTCTTCCACGGGCAGGTAGTGGTACAGTATGCGCTGGTGGTCCTG
GCTTTGGCCACAGTTCCTATCCTGCTGCTGGGCACACCCTTGTACCTTCTGCGCCAGCACCACCGAAGAAACACTCAGAGAAGGCCTACAGCAGGCAGACAGGATGAGGACAGTGACAAGCTTCTGGC
CTCCCCGGATGCTTCCACCTTGGAGAACAGCTGGAGCCCTGATGAGGAGAAGGCTGGGAGCTCAGGAGATGAAGAAGCTGAGTTTGTCCCTTCGGAGATCTTCATGCACCAAGCCATCCACACCATTG
AGTTCTGCCTGGGCTGCATCTCCAACACAGCCTCCTACTTGCGTCTCTGGGCCCTGAGCCTGGCTCATGCTCAGCTGTCTGAGGTCCTGTGGGCCATGGTGATGCGCATAGGCCTAGGCATGGGCCGA
GAGATTGGTGTGGCATCTGTGGTGCTGGTCCCTGTGTTTGCTGCCTTTGCTGTGTTGACTGTGGCCATCTTGCTAGTGATGGAGGGGCTCTCAGCCTTCCTACATGCCCTGCGGTTGCACTGGGTGGA
GTTCCAGAACAAGTTCTATTCAGGGACCGGCTACAAGCTCAGCCCCTTCGCCTTCACTGTGGACAGTGACTAG

hide sequence

RefSeq Acc Id:

XM_006230728 ⟹ XP_006230790

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,556,270 - 210,567,951 (-)	NCBI
mRatBN7.2	1	201,127,034 - 201,138,755 (-)	NCBI
Rnor_6.0	1	219,126,687 - 219,139,466 (-)	NCBI
Rnor_5.0	1	225,999,292 - 226,012,069 (-)	NCBI

Sequence:

show sequence

CACGCCCACTCTGGTATTTCGGAGCTGGAGTGAGCTGCAGAGGCCGGCGGGCGGGCGGGCTCAGATCCTAAGTCCTGAGTTGAGAGACGAGTCTACGTAGGATCATGGGCTCCATGTTCCGGAGTGAA
GAGGTGGCCTTGGTCCAGCTCCTGTTGCCCACAGCATCTGCCTACAACTGTGTGAGCCAGCTGGCTCAACGAATCGGTGAGTGCCTTCCAGAGACGCTTCGTGGTAGAGGTCCGGCGCTGCGAGGAGC
TGGAGAAGACCTTCACCTTCTTGCGGGAAGAAGTGCAGCGGGCAGGCCTGACACTGACCCCACCCGAGGGGACACTGCCAGCACCACCTCCCCGAGACCTGCTGCGCATCCAGGAGGAAACGGACCGC
TTGGCCCAGGAGCTTCGGGATGTTCGAGGCAACCAACAGGCACTTCGGGCCCAGCTGCACCAGCTACAGCTCCACTCAGCCGTGCTGGGCCAGAGCCACGCCCCTCCGATGGCAGCTGTCCATACGGA
GGGACCCACCACTGAGAGAACACCCCTGCTTTCAGCCACCCCAGGGCCACATGCAGACCTGAAGGTCAATTTTGTGGCAGGTGCTGTGGAGCCTTGCAAGGCTGCAGCCCTGGAGCGCCTGCTTTGGA
GAGCTTGCCGCGGCTTCCTCATTGCCAGCTTTAAGGAGACTGAGGGGCAGCTGGAGGACCCGGTGACGGGTGAGCCTGCAACTTGGATGACCTTTGTCATCTCCTACTGGGGTGAGCAGATCGGACAG
AAGGTTCGGAAGATCACAGACTGCTTTCACTGTCATGTCTTCCCGTACCTGGAGCAGGAGGAAGCCCGGCTCAGGACCTTGCAGCAGCTGCAGCAGCAGAGCCAGGAGCTTCAGGAGGTCCTGGGGGA
GACAGAACGGTTCCTGAGCCAGGTGTTGGGCCGGGTGCAGCAGCTGCTGCCCCCAGGGCAGGTGCAGATCCGGAAGATGAAGGCCGTGTACCTGACCCTCAACCAGTGCAGTGTGAACACCACACACA
AGTGCCTCATTGCGGAGGTCTGGTGTGCCACGAGGGACCTTCCCACTGTACAGCAGGCGCTGCAGAGCGGCTCGAGTGAGGAAGGAGTGAGTGCTGTGGCTCACCGTATCCCTTGCCAGGACATGCCT
CCAACTCTCATCAGGACCAACCGCTTCACCTCCAGCTTCCAGGGCATTGTGGATGCCTATGGTGTGGGCCGATACAGGGAAGTCAACCCTGCTCCCTACACCATCATCACATTCCCCTTCCTCTTTGC
TGTGATGTTTGGCGATGTGGGCCACGGACTGCTCATGTTTCTCTTCGCCCTGGCTATGGTCCTCACTGAGAACCAACCAGCTGTAAAGACCACGCAAAATGAGATCTGGCAGACCTTCTTTGGGGGTC
GCTACCTACTCCTGCTCATGGGTCTGTTCTCCATCTACACGGGCTTCATCTACAACGAGTGCTTCAGCCGAGCCACCACTATTTTCCCCTCAGGCTGGAGTGTGGCTGCCATGGCCAACCAGTCAGGC
TGGAGTGACGAGTATCTGTCCCAGCACCCCATGCTTACCCTGAACCCTAACATCACTGGTGTCTTCCTCGGACCTTATCCCTTCGGCATTGACCCGATCTGGAGCCTGGCCACCAACCACCTGAGCTT
CCTCAACTCCTTCAAGATGAAGATGTCTGTCATCCTTGGGGTCACACACATGGCCTTTGGGGTGTTCCTCAGCATCTTCAACCATGTGCACTTTGGCCAGGCCCACCGGCTACTGCTGGAGACCGTGC
CTGAGCTCATCTTCCTGTTGGGCCTCTTTGGCTACCTTGTTTTCCTCATTGTCTACAAGTGGCTCTACGTCTCAGCTGCCAGCGCCTCCTCGGCCCCCAGTATCCTCATTCACTTCATCAATATGTTC
CTCTTCTCCCAAAACCCCACCAATCGGCTGCTCTTCCACGGGCAGGTAGTGGTACAGTATGCGCTGGTGGTCCTGGCTTTGGCCACAGTTCCTATCCTGCTGCTGGGCACACCCTTGTACCTTCTGCG
CCAGCACCACCGAAGAAACACTCAGAGAAGGCCTACAGCAGGCAGACAGGATGAGGACAGTGACAAGCTTCTGGCCTCCCCGGATGCTTCCACCTTGGAGAACAGCTGGAGCCCTGATGAGGAGAAGG
CTGGGAGCTCAGGAGATGAAGAAGCTGAGTTTGTCCCTTCGGAGATCTTCATGCACCAAGCCATCCACACCATTGAGTTCTGCCTGGGCTGCATCTCCAACACAGCCTCCTACTTGCGTCTCTGGGCC
CTGAGCCTGGCTCATGCTCAGCTGTCTGAGGTCCTGTGGGCCATGGTGATGCGCATAGGCCTAGGCATGGGCCGAGAGATTGGTGTGGCATCTGTGGTGCTGGTCCCTGTGTTTGCTGCCTTTGCTGT
GTTGACTGTGGCCATCTTGCTAGTGATGGAGGGGCTCTCAGCCTTCCTACATGCCCTGCGGTTGCACTGGGTGGAGTTCCAGAACAAGTTCTATTCAGGGACCGGCTACAAGCTCAGCCCCTTCGCCT
TCACTGTGGACAGTGACTAGCACCTACTTCGATTCCTGCTTCTTCAAAATGGGACAGGAATAAAAAGCTGGCTGGCCCAGGAACTCTGCCTTTGTCCTCTCTGGGGTACCAGGGTTAGACTGACACTT
TACTGGTCACAGCTCTAGATTCTGAAGATGACATCTACTTAGACCATCCTTCAAGGGAGGTAGAGGGTAGGAGGCACTGTTTTAGGATCTGAGCCTTTAGAAATTGCTGGGATAGCTGTGTTAAAAAT
CTGCAGACTCTTGGGGGACAAAAGGGACAGTTAGTTTCGTGAGAGTGGATTCCAGTCAGGTGGGAGGAGGTTCCCACTTTTGAGGTGTGCAACTGGCTTTGACTTCAGGCTTTGTCTCCCTGAAGTCC
TTATTAAGGTCCTCCATGCTTGGTTGAGGTAGGCGTGGCCTCTTTCACTCCCTCTGGCTGGGAGGCATATACATAGCCAGTGCATGTCAGAGGCCAGAGGCTCAAGTTTTCCAAGTTACAAAGTAGTT
CTTGCAGCTGAAGGCCCCAGCAACAAAGGCTGCTTTGAGGCCAGAGCTGCTCTGGGCATAGCGAGCCACAATGACCCTGGCCAAGTTGCTGGGAGGGTTGTAGACTGTCCTGCTGAAGACACTGAATG
CAGGGTTGGAAATAATAGTGCCTTTCAGGCACTTTCACATGCTTGGCAGACTAAGCTAAGAGAAACATTACAGAGCTGGGCAGATGAGTGCAGAGAATCCCCAAGGAGTTAGCAGGCCTGTCCGAACT
CTGAAGCTTGCCGTCCTAGACTGGCTATTTCAGTTGCCATGGGAACAGCATACCATAACACCAACAAGCTCTGTCCTGGCAGTGATGACCACTTACAGGTGTGACTGATCAGACCAAGATGGATCTGA
TCCCCACTCATTTGAGCAGGAAATAACTGTCACAAATGGGAAGCTATGGAAAAGCAGGTGGTGGGTGAGTGAGAGAGGGCTCAGTGACCTTAAGAGCCTAGACTACTCTTGCAGAGGGCCTGGGTTTG
TTTCCCAGCACTCACTGGGCCATTCACACTGGCCTATGATTCCGCTCCACAGCACCCTACTCCTCTGGACTTCTGGACTCGTGTAAAAACAATAAAAACGCTTAAGAGAA

hide sequence

RefSeq Acc Id:

XM_008760097 ⟹ XP_008758319

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,556,270 - 210,568,006 (-)	NCBI
mRatBN7.2	1	201,127,034 - 201,138,771 (-)	NCBI
Rnor_6.0	1	219,126,687 - 219,139,466 (-)	NCBI

Sequence:

show sequence

CACGCCCACTCTGGTATTTCGGAGCTGGAGTGAGCTGCAGAGGCCGGCGGGCGGGCGGGCTCAGATCCTAAGTCCTGAGTTGAGAGACGAGTCTACGTAGTGAGTGGGAAGAGGCGTATGGATGCCTG
CCTGGAACTAGCTCCTAGCCAACCTTTTTGCCTGCTCTAAGGATCATGGGCTCCATGTTCCGGAGTGAAGAGGTGGCCTTGGTCCAGCTCCTGTTGCCCACAGCATCTGCCTACAACTGTGTGAGCCA
GCTGGGTGAGCTGGGCCTCGTGGAGTTTAGAGACCTCAACGAATCGGTGAGTGCCTTCCAGAGACGCTTCGTGGTAGAGGTCCGGCGCTGCGAGGAGCTGGAGAAGACCTTCACCTTCTTGCGGGAAG
AAGTGCAGCGGGCAGGCCTGACACTGACCCCACCCGAGGGGACACTGCCAGCACCACCTCCCCGAGACCTGCTGCGCATCCAGGAGGAAACGGACCGCTTGGCCCAGGAGCTTCGGGATGTTCGAGGC
AACCAACAGGCACTTCGGGCCCAGCTGCACCAGCTACAGCTCCACTCAGCCGTGCTGGGCCAGAGCCACGCCCCTCCGATGGCAGCTGTCCATACGGAGGGACCCACCACTGAGAGAACACCCCTGCT
TTCAGCCACCCCAGGGCCACATGCAGACCTGAAGGTCAATTTTGTGGCAGGTGCTGTGGAGCCTTGCAAGGCTGCAGCCCTGGAGCGCCTGCTTTGGAGAGCTTGCCGCGGCTTCCTCATTGCCAGCT
TTAAGGAGACTGAGGGGCAGCTGGAGGACCCGGTGACGGGTGAGCCTGCAACTTGGATGACCTTTGTCATCTCCTACTGGGGTGAGCAGATCGGACAGAAGGTTCGGAAGATCACAGACTGCTTTCAC
TGTCATGTCTTCCCGTACCTGGAGCAGGAGGAAGCCCGGCTCAGGACCTTGCAGCAGCTGCAGCAGCAGAGCCAGGAGCTTCAGGAGGTCCTGGGGGAGACAGAACGGTTCCTGAGCCAGGTGTTGGG
CCGGGTGCAGCAGCTGCTGCCCCCAGGGCAGGTGCAGATCCGGAAGATGAAGGCCGTGTACCTGACCCTCAACCAGTGCAGTGTGAACACCACACACAAGTGCCTCATTGCGGAGGTCTGGTGTGCCA
CGAGGGACCTTCCCACTGTACAGCAGGCGCTGCAGAGCGGCTCGAGTGAGGAAGGAGTGAGTGCTGTGGCTCACCGTATCCCTTGCCAGGACATGCCTCCAACTCTCATCAGGACCAACCGCTTCACC
TCCAGCTTCCAGGGCATTGTGGATGCCTATGGTGTGGGCCGATACAGGGAAGTCAACCCTGCTCCCTACACCATCATCACATTCCCCTTCCTCTTTGCTGTGATGTTTGGCGATGTGGGCCACGGACT
GCTCATGTTTCTCTTCGCCCTGGCTATGGTCCTCACTGAGAACCAACCAGCTGTAAAGACCACGCAAAATGAGATCTGGCAGACCTTCTTTGGGGGTCGCTACCTACTCCTGCTCATGGGTCTGTTCT
CCATCTACACGGGCTTCATCTACAACGAGTGCTTCAGCCGAGCCACCACTATTTTCCCCTCAGGCTGGAGTGTGGCTGCCATGGCCAACCAGTCAGGCTGGAGTGACGAGTATCTGTCCCAGCACCCC
ATGCTTACCCTGAACCCTAACATCACTGGTGTCTTCCTCGGACCTTATCCCTTCGGCATTGACCCGATCTGGAGCCTGGCCACCAACCACCTGAGCTTCCTCAACTCCTTCAAGATGAAGATGTCTGT
CATCCTTGGGGTCACACACATGGCCTTTGGGGTGTTCCTCAGCATCTTCAACCATGTGCACTTTGGCCAGGCCCACCGGCTACTGCTGGAGACCGTGCCTGAGCTCATCTTCCTGTTGGGCCTCTTTG
GCTACCTTGTTTTCCTCATTGTCTACAAGTGGCTCTACGTCTCAGCTGCCAGCGCCTCCTCGGCCCCCAGTATCCTCATTCACTTCATCAATATGTTCCTCTTCTCCCAAAACCCCACCAATCGGCTG
CTCTTCCACGGGCAGGTAGTGGTACAGTATGCGCTGGTGGTCCTGGCTTTGGCCACAGTTCCTATCCTGCTGCTGGGCACACCCTTGTACCTTCTGCGCCAGCACCACCGAAGAAACACTCAGAGAAG
GCCTACAGCAGGCAGACAGGATGAGGACAGTGACAAGCTTCTGGCCTCCCCGGATGCTTCCACCTTGGAGAACAGCTGGAGCCCTGATGAGGAGAAGGCTGGGAGCTCAGGAGATGAAGAAGCTGAGT
TTGTCCCTTCGGAGATCTTCATGCACCAAGCCATCCACACCATTGAGTTCTGCCTGGGCTGCATCTCCAACACAGCCTCCTACTTGCGTCTCTGGGCCCTGAGCCTGGCTCATGCTCAGCTGTCTGAG
GTCCTGTGGGCCATGGTGATGCGCATAGGCCTAGGCATGGGCCGAGAGATTGGTGTGGCATCTGTGGTGCTGGTCCCTGTGTTTGCTGCCTTTGCTGTGTTGACTGTGGCCATCTTGCTAGTGATGGA
GGGGCTCTCAGCCTTCCTACATGCCCTGCGGTTGCACTGGGTGGAGTTCCAGAACAAGTTCTATTCAGGGACCGGCTACAAGCTCAGCCCCTTCGCCTTCACTGTGGACAGTGACTAGCACCTACTTC
GATTCCTGCTTCTTCAAAATGGGACAGGAATAAAAAGCTGGCTGGCCCAGGAACTCTGCCTTTGTCCTCTCTGGGGTACCAGGGTTAGACTGACACTTTACTGGTCACAGCTCTAGATTCTGAAGATG
ACATCTACTTAGACCATCCTTCAAGGGAGGTAGAGGGTAGGAGGCACTGTTTTAGGATCTGAGCCTTTAGAAATTGCTGGGATAGCTGTGTTAAAAATCTGCAGACTCTTGGGGGACAAAAGGGACAG
TTAGTTTCGTGAGAGTGGATTCCAGTCAGGTGGGAGGAGGTTCCCACTTTTGAGGTGTGCAACTGGCTTTGACTTCAGGCTTTGTCTCCCTGAAGTCCTTATTAAGGTCCTCCATGCTTGGTTGAGGT
AGGCGTGGCCTCTTTCACTCCCTCTGGCTGGGAGGCATATACATAGCCAGTGCATGTCAGAGGCCAGAGGCTCAAGTTTTCCAAGTTACAAAGTAGTTCTTGCAGCTGAAGGCCCCAGCAACAAAGGC
TGCTTTGAGGCCAGAGCTGCTCTGGGCATAGCGAGCCACAATGACCCTGGCCAAGTTGCTGGGAGGGTTGTAGACTGTCCTGCTGAAGACACTGAATGCAGGGTTGGAAATAATAGTGCCTTTCAGGC
ACTTTCACATGCTTGGCAGACTAAGCTAAGAGAAACATTACAGAGCTGGGCAGATGAGTGCAGAGAATCCCCAAGGAGTTAGCAGGCCTGTCCGAACTCTGAAGCTTGCCGTCCTAGACTGGCTATTT
CAGTTGCCATGGGAACAGCATACCATAACACCAACAAGCTCTGTCCTGGCAGTGATGACCACTTACAGGTGTGACTGATCAGACCAAGATGGATCTGATCCCCACTCATTTGAGCAGGAAATAACTGT
CACAAATGGGAAGCTATGGAAAAGCAGGTGGTGGGTGAGTGAGAGAGGGCTCAGTGACCTTAAGAGCCTAGACTACTCTTGCAGAGGGCCTGGGTTTGTTTCCCAGCACTCACTGGGCCATTCACACT
GGCCTATGATTCCGCTCCACAGCACCCTACTCCTCTGGACTTCTGGACTCGTGTAAAAACAATAAAAACGCTTAAGAGAA

hide sequence

RefSeq Acc Id:

XM_039108180 ⟹ XP_038964108

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,556,270 - 210,565,775 (-)	NCBI
mRatBN7.2	1	201,127,034 - 201,136,541 (-)	NCBI

RefSeq Acc Id:

XM_039108190 ⟹ XP_038964118

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	210,557,283 - 210,568,021 (-)	NCBI
mRatBN7.2	1	201,128,047 - 201,138,787 (-)	NCBI


Protein RefSeqs	NP_954520	(Get FASTA)	NCBI Sequence Viewer
	XP_006230790	(Get FASTA)	NCBI Sequence Viewer
	XP_008758319	(Get FASTA)	NCBI Sequence Viewer
	XP_038964108	(Get FASTA)	NCBI Sequence Viewer
	XP_038964118	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61859	(Get FASTA)	NCBI Sequence Viewer
	ABB91445	(Get FASTA)	NCBI Sequence Viewer
	EDM12314	(Get FASTA)	NCBI Sequence Viewer
	EDM12315	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023425
	ENSRNOP00000023425.5
	ENSRNOP00000074537.1
	ENSRNOP00000079519
	ENSRNOP00000079519.1

RefSeq Acc Id:

NP_954520 ⟸ NM_199089

- UniProtKB:

A6HYM9 (UniProtKB/TrEMBL), Q2I6B0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGSMFRSEEVALVQLLLPTASAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVEVRRCEELEKTFTFLREEVQRAGLTLTPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRAQLHQLQLH
SAVLGQSHAPPMAAVHTEGPTTERTPLLSATPGPHADLKVNFVAGAVEPCKAAALERLLWRACRGFLIASFKETEGQLEDPVTGEPATWMTFVISYWGEQIGQKVRKITDCFHCHVFPYLEQEEARLR
TLQQLQQQSQELQEVLGETERFLSQVLGRVQQLLPPGQVQIRKMKAVHLTLNQCSVNTTHKCLIAEVWCATRDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRY
REVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLTENQPAVKTTQNEIWQTFFGGRYLPLLMGLFSIYTGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHPMLTLNPNITGVFLGP
YPFGIDPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETVPELIFLLGLFGYLVFLIVYKWLYVSAASASSAPSILIHFINMFLFSQNPTNRLLFHGQVVVQYALVVL
ALATVPILLLGTPLYLLRQHHRRNTQRRPTAGRQDEDSDKLLASPDASTLENSWSPDEEKAGSSGDEEAEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGR
EIGVASVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFAFTVDSD

hide sequence

RefSeq Acc Id:	XP_006230790 ⟸ XM_006230728
- Peptide Label:	isoform X2
- UniProtKB:	Q2I6B0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAVHTEGPTTERTPLLSATPGPHADLKVNFVAGAVEPCKAAALERLLWRACRGFLIASFKETEGQLEDPVTGEPATWMTFVISYWGEQIGQKVRKITDCFHCHVFPYLEQEEARLRTLQQLQQQSQE LQEVLGETERFLSQVLGRVQQLLPPGQVQIRKMKAVYLTLNQCSVNTTHKCLIAEVWCATRDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTII TFPFLFAVMFGDVGHGLLMFLFALAMVLTENQPAVKTTQNEIWQTFFGGRYLLLLMGLFSIYTGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHPMLTLNPNITGVFLGPYPFGIDPIWSL ATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETVPELIFLLGLFGYLVFLIVYKWLYVSAASASSAPSILIHFINMFLFSQNPTNRLLFHGQVVVQYALVVLALATVPILLLG TPLYLLRQHHRRNTQRRPTAGRQDEDSDKLLASPDASTLENSWSPDEEKAGSSGDEEAEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVASVVLVP VFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFAFTVDSD hide sequence

RefSeq Acc Id:	XP_008758319 ⟸ XM_008760097
- Peptide Label:	isoform X1
- UniProtKB:	A6HYM9 (UniProtKB/TrEMBL), Q2I6B0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSMFRSEEVALVQLLLPTASAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVEVRRCEELEKT FTFLREEVQRAGLTLTPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRAQLHQLQLHSAVLGQSHAPPMAAVHTEGPTTERTPLLSATPGPHADLKVNFVAGAVEPCKAAALERLLWRACR GFLIASFKETEGQLEDPVTGEPATWMTFVISYWGEQIGQKVRKITDCFHCHVFPYLEQEEARLRTLQQLQQQSQELQEVLGETERFLSQVLGRVQQLLPPGQVQIRKMKAVYLTLNQCSVNTTHKCLI AEVWCATRDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLTENQPAVKTTQNEIWQTFFGGRYLL LLMGLFSIYTGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHPMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETVPELI FLLGLFGYLVFLIVYKWLYVSAASASSAPSILIHFINMFLFSQNPTNRLLFHGQVVVQYALVVLALATVPILLLGTPLYLLRQHHRRNTQRRPTAGRQDEDSDKLLASPDASTLENSWSPDEEKAGSS GDEEAEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVASVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFAFTVD SD hide sequence

Ensembl Acc Id:

ENSRNOP00000074537 ⟸ ENSRNOT00000089107

Ensembl Acc Id:

ENSRNOP00000023425 ⟸ ENSRNOT00000023425

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V887-F1-model_v2	AlphaFold	G3V887	1-834	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13690602

Promoter ID:

EPDNEW_R1126

Type:

initiation region

Name:

Tcirg1_1

Description:

T-cell immune regulator 1, ATPase H+ transporting V0 subunitA3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	219,139,403 - 219,139,463	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56799	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000017220	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023425	ENTREZGENE
	ENSRNOT00000023425.7	UniProtKB/TrEMBL
	ENSRNOT00000089107.2	UniProtKB/TrEMBL
	ENSRNOT00000104991	ENTREZGENE
	ENSRNOT00000104991.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598499	IMAGE-MGC_LOAD
InterPro	ATPase_V0/A0-cplx_116kDa_su	UniProtKB/TrEMBL
	V-type_ATPase_116kDa_su_euka	UniProtKB/TrEMBL
KEGG Report	rno:293650	UniProtKB/TrEMBL
MGC_CLONE	MGC:72583	IMAGE-MGC_LOAD
NCBI Gene	293650	ENTREZGENE
PANTHER	ATPase_V0/A0_116	UniProtKB/TrEMBL
	V-TYPE PROTON ATPASE 116 KDA SUBUNIT A3	UniProtKB/TrEMBL
Pfam	V_ATPase_I	UniProtKB/TrEMBL
PhenoGen	Tcirg1	PhenoGen
PIRSF	ATP6V0A1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017220	RatGTEx
UniProt	A0A8I5ZND3_RAT	UniProtKB/TrEMBL
	A6HYM9	ENTREZGENE, UniProtKB/TrEMBL
	G3V887_RAT	UniProtKB/TrEMBL
	Q2I6B0	ENTREZGENE, UniProtKB/TrEMBL
	Q6P735_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Tcirg1	T-cell immune regulator 1, ATPase H+ transporting V0 subunit A3	Tcirg1	T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Tcirg1	T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3	Tcirg1	T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Tcirg1	T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3	Tcirg1	T-cell, immune regulator 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Tcirg1	T-cell, immune regulator 1		T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a isoform 3	Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways