Symbol:
Rsad2
Name:
radical S-adenosyl methionine domain containing 2
RGD ID:
620495
Description:
Predicted to enable 4 iron, 4 sulfur cluster binding activity. Involved in ossification and regulation of ossification. Predicted to be located in several cellular components, including fibrillar center; lipid droplet; and mitochondrial membrane. Predicted to be active in endoplasmic reticulum and mitochondrion. Human ortholog(s) of this gene implicated in respiratory syncytial virus infectious disease. Orthologous to human RSAD2 (radical S-adenosyl methionine domain containing 2); PARTICIPATES IN influenza A pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Best5; bone-expressed sequence tag 5 protein; radical S-adenosyl methionine domain-containing protein 2; S-adenosylmethionine-dependent nucleotide dehydratase RSAD2; SAND; Vig1; viperin; virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RSAD2 (radical S-adenosyl methionine domain containing 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rsad2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rsad2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RSAD2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RSAD2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rsad2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RSAD2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RSAD2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rsad2 (radical S-adenosyl methionine domain containing 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZSCAN5A (zinc finger and SCAN domain containing 5A) HGNC
OMA
Homo sapiens (human):
ZSCAN5B (zinc finger and SCAN domain containing 5B) HGNC
OMA
Homo sapiens (human):
ZSCAN5C (zinc finger and SCAN domain containing 5C) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RSAD2 (radical S-adenosyl methionine domain containing 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rsad2 (radical S-adenosyl methionine domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rsad2 (radical S-adenosyl methionine domain containing 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rsad2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 48,774,985 - 48,788,245 (-) NCBI GRCr8 mRatBN7.2 6 43,046,514 - 43,059,737 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 43,047,658 - 43,059,699 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 43,359,103 - 43,372,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 43,673,963 - 43,687,086 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 43,107,103 - 43,120,223 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 45,655,947 - 45,669,083 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 45,655,954 - 45,669,148 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 54,375,724 - 54,388,860 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 44,100,775 - 44,113,910 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 44,103,900 - 44,117,036 (-) NCBI Celera 6 42,313,474 - 42,326,629 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rsad2 Rat (-)-alpha-phellandrene increases expression ISO RSAD2 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of RSAD2 mRNA CTD PMID:25075043 Rsad2 Rat (1->4)-beta-D-glucan multiple interactions ISO Rsad2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RSAD2 mRNA CTD PMID:36331819 Rsad2 Rat (S)-nicotine multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of RSAD2 mRNA CTD PMID:37951547 Rsad2 Rat 1,2-dichloroethane decreases expression ISO Rsad2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of RSAD2 mRNA CTD PMID:28960355 Rsad2 Rat 1,2-dimethylhydrazine affects expression ISO Rsad2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of RSAD2 mRNA CTD PMID:22206623 Rsad2 Rat 17beta-estradiol increases expression ISO RSAD2 (Homo sapiens) 6480464 Estradiol results in increased expression of RSAD2 mRNA CTD PMID:21185374 Rsad2 Rat 17beta-estradiol decreases expression ISO Rsad2 (Mus musculus) 6480464 Estradiol results in decreased expression of RSAD2 mRNA CTD PMID:39298647 Rsad2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO RSAD2 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Rsad2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RSAD2 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Rsad2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rsad2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rsad2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rsad2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RSAD2 mRNA CTD PMID:19770486 Rsad2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RSAD2 mRNA CTD PMID:19692669 more ... Rsad2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RSAD2 mRNA CTD PMID:22298810 Rsad2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of RSAD2 mRNA] CTD PMID:21215274 Rsad2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RSAD2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of RSAD2 mRNA CTD PMID:22298810 Rsad2 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of RSAD2 mRNA CTD PMID:21346803 Rsad2 Rat 2,4-diaminotoluene increases expression ISO Rsad2 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of RSAD2 mRNA CTD PMID:20713471 Rsad2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Rsad2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Rsad2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RSAD2 mRNA CTD PMID:21346803 Rsad2 Rat 2-acetamidofluorene decreases expression ISO Rsad2 (Mus musculus) 6480464 2-Acetylaminofluorene results in decreased expression of RSAD2 mRNA CTD PMID:20713471 Rsad2 Rat 2-hydroxypropanoic acid increases expression ISO RSAD2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RSAD2 mRNA CTD PMID:30851411 Rsad2 Rat 2-nitrofluorene decreases expression EXP 6480464 2-nitrofluorene results in decreased expression of RSAD2 mRNA CTD PMID:22484513 Rsad2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:19692669 Rsad2 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Rsad2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of RSAD2 mRNA CTD PMID:27914987 Rsad2 Rat 3-methylcholanthrene decreases expression ISO Rsad2 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of RSAD2 mRNA CTD PMID:20713471 Rsad2 Rat 4,4'-sulfonyldiphenol increases expression ISO Rsad2 (Mus musculus) 6480464 bisphenol S results in increased expression of RSAD2 mRNA CTD PMID:30951980 Rsad2 Rat 4,4'-sulfonyldiphenol affects expression ISO Rsad2 (Mus musculus) 6480464 bisphenol S affects the expression of RSAD2 mRNA CTD PMID:39298647 Rsad2 Rat 4-hydroxynon-2-enal decreases expression ISO Rsad2 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of RSAD2 mRNA CTD PMID:19191707 Rsad2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RSAD2 mRNA CTD PMID:24780913 Rsad2 Rat 6alpha-methylprednisolone decreases expression ISO RSAD2 (Homo sapiens) 6480464 Methylprednisolone results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of RSAD2 mRNA CTD PMID:31881176 Rsad2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RSAD2 mRNA CTD PMID:28959563 Rsad2 Rat all-trans-retinoic acid decreases expression ISO Rsad2 (Mus musculus) 6480464 Tretinoin results in decreased expression of RSAD2 mRNA CTD PMID:16604517 Rsad2 Rat all-trans-retinoic acid increases expression ISO RSAD2 (Homo sapiens) 6480464 Tretinoin results in increased expression of RSAD2 mRNA CTD PMID:33167477 Rsad2 Rat alpha-phellandrene increases expression ISO RSAD2 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of RSAD2 mRNA CTD PMID:25075043 Rsad2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RSAD2 mRNA CTD PMID:16483693 Rsad2 Rat arsane decreases expression ISO Rsad2 (Mus musculus) 6480464 Arsenic results in decreased expression of RSAD2 mRNA CTD PMID:19654921 Rsad2 Rat arsenic atom decreases expression ISO Rsad2 (Mus musculus) 6480464 Arsenic results in decreased expression of RSAD2 mRNA CTD PMID:19654921 Rsad2 Rat arsenite(3-) decreases expression ISO Rsad2 (Mus musculus) 6480464 arsenite results in decreased expression of RSAD2 mRNA CTD PMID:18929588 Rsad2 Rat avobenzone increases expression ISO RSAD2 (Homo sapiens) 6480464 avobenzone results in increased expression of RSAD2 mRNA CTD PMID:31016361 Rsad2 Rat azathioprine decreases expression ISO RSAD2 (Homo sapiens) 6480464 Azathioprine results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat benazepril decreases expression EXP 6480464 benazepril results in decreased expression of RSAD2 mRNA CTD PMID:14871019 Rsad2 Rat benzo[a]pyrene increases expression ISO RSAD2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of RSAD2 mRNA CTD PMID:20064835 Rsad2 Rat benzo[a]pyrene affects methylation ISO RSAD2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RSAD2 exon and Benzo(a)pyrene affects the methylation of RSAD2 promoter CTD PMID:27901495 Rsad2 Rat benzo[a]pyrene decreases expression ISO Rsad2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RSAD2 mRNA CTD PMID:19770486 more ... Rsad2 Rat Benzo[ghi]perylene decreases expression ISO Rsad2 (Mus musculus) 6480464 1 and 12-benzoperylene results in decreased expression of RSAD2 mRNA CTD PMID:26377693 Rsad2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rsad2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RSAD2 mRNA CTD PMID:34319233 Rsad2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RSAD2 mRNA CTD PMID:25181051 Rsad2 Rat bisphenol A multiple interactions ISO Rsad2 (Mus musculus) 6480464 bisphenol A results in increased expression of and results in increased localization of RSAD2 protein and IFNB1 protein promotes the reaction [bisphenol A results in increased expression of RSAD2 protein] CTD PMID:38828519 Rsad2 Rat bisphenol A increases expression ISO Rsad2 (Mus musculus) 6480464 bisphenol A results in increased expression of RSAD2 mRNA CTD PMID:32156529 and PMID:38828519 Rsad2 Rat bisphenol A decreases expression ISO Rsad2 (Mus musculus) 6480464 bisphenol A results in decreased expression of RSAD2 mRNA CTD PMID:32370801 Rsad2 Rat bisphenol F increases expression ISO Rsad2 (Mus musculus) 6480464 bisphenol F results in increased expression of RSAD2 mRNA CTD PMID:38685157 Rsad2 Rat cadmium atom multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of RSAD2 mRNA CTD PMID:37325564 Rsad2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of RSAD2 mRNA CTD PMID:25993096 Rsad2 Rat cadmium dichloride multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of RSAD2 mRNA CTD PMID:37325564 Rsad2 Rat cadmium dichloride decreases expression ISO RSAD2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RSAD2 mRNA CTD PMID:38382870 Rsad2 Rat calciol increases expression ISO Rsad2 (Mus musculus) 6480464 Cholecalciferol results in increased expression of RSAD2 mRNA CTD PMID:16508948 Rsad2 Rat calcitriol decreases expression ISO RSAD2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of RSAD2 mRNA CTD PMID:16002434 Rsad2 Rat cannabidiol multiple interactions ISO Rsad2 (Mus musculus) 6480464 [lipopolysaccharide more ... CTD PMID:27256343 and PMID:30742662 Rsad2 Rat cannabidiol increases expression ISO Rsad2 (Mus musculus) 6480464 Cannabidiol results in increased expression of RSAD2 mRNA CTD PMID:30742662 Rsad2 Rat carbon nanotube decreases expression ISO Rsad2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Rsad2 Rat carbon nanotube increases expression ISO Rsad2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Rsad2 Rat chlordecone decreases expression ISO Rsad2 (Mus musculus) 6480464 Chlordecone results in decreased expression of RSAD2 mRNA CTD PMID:33711761 Rsad2 Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of RSAD2 mRNA CTD PMID:23125180 Rsad2 Rat chromium(6+) affects expression ISO Rsad2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of RSAD2 mRNA CTD PMID:28472532 Rsad2 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of RSAD2 mRNA CTD PMID:22023808 Rsad2 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of RSAD2 mRNA CTD PMID:24386269 Rsad2 Rat copper atom multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RSAD2 mRNA CTD PMID:24690739 Rsad2 Rat copper(0) multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RSAD2 mRNA CTD PMID:24690739 Rsad2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of RSAD2 mRNA CTD PMID:27523638 Rsad2 Rat cyclosporin A increases expression ISO Rsad2 (Mus musculus) 6480464 Cyclosporine results in increased expression of RSAD2 mRNA CTD PMID:19770486 Rsad2 Rat cyclosporin A increases expression ISO RSAD2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RSAD2 mRNA CTD PMID:27989131 Rsad2 Rat cyproconazole increases expression ISO Rsad2 (Mus musculus) 6480464 cyproconazole results in increased expression of RSAD2 mRNA CTD PMID:22334560 Rsad2 Rat DDT decreases expression ISO RSAD2 (Homo sapiens) 6480464 DDT results in decreased expression of RSAD2 mRNA CTD PMID:25014179 Rsad2 Rat dibutyl phthalate increases expression ISO Rsad2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RSAD2 mRNA CTD PMID:17361019 and PMID:21266533 Rsad2 Rat dichloroacetic acid decreases expression ISO Rsad2 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of RSAD2 mRNA CTD PMID:28962523 Rsad2 Rat diclofenac decreases expression ISO RSAD2 (Homo sapiens) 6480464 Diclofenac results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of RSAD2 mRNA CTD PMID:21161181 Rsad2 Rat dimethylarsinic acid increases expression ISO Rsad2 (Mus musculus) 6480464 Cacodylic Acid results in increased expression of RSAD2 mRNA CTD PMID:32052077 Rsad2 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of RSAD2 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of RSAD2 mRNA CTD PMID:33729688 Rsad2 Rat diquat decreases expression ISO Rsad2 (Mus musculus) 6480464 Diquat results in decreased expression of RSAD2 mRNA CTD PMID:36851058 Rsad2 Rat disulfiram multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RSAD2 mRNA CTD PMID:24690739 Rsad2 Rat doxorubicin increases expression ISO Rsad2 (Mus musculus) 6480464 Doxorubicin results in increased expression of RSAD2 mRNA CTD PMID:19277126 Rsad2 Rat doxorubicin decreases expression ISO RSAD2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RSAD2 mRNA CTD PMID:29803840 Rsad2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of RSAD2 mRNA CTD PMID:29391264 Rsad2 Rat epoxiconazole increases expression ISO Rsad2 (Mus musculus) 6480464 epoxiconazole results in increased expression of RSAD2 mRNA CTD PMID:22334560 Rsad2 Rat folic acid affects expression ISO Rsad2 (Mus musculus) 6480464 Folic Acid deficiency affects the expression of RSAD2 mRNA CTD PMID:32304770 Rsad2 Rat formaldehyde decreases expression ISO RSAD2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of RSAD2 mRNA CTD PMID:28937961 Rsad2 Rat formaldehyde increases expression ISO RSAD2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of RSAD2 mRNA CTD PMID:23649840 Rsad2 Rat gadodiamide hydrate increases expression ISO RSAD2 (Homo sapiens) 6480464 gadodiamide results in increased expression of RSAD2 mRNA CTD PMID:20959327 Rsad2 Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of RSAD2 mRNA CTD PMID:17785943 Rsad2 Rat Genipin multiple interactions ISO Rsad2 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of RSAD2 mRNA] CTD PMID:22687549 Rsad2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RSAD2 mRNA CTD PMID:22061828 and PMID:33387578 Rsad2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of RSAD2 mRNA CTD PMID:24915197 Rsad2 Rat GW 4064 decreases expression ISO Rsad2 (Mus musculus) 6480464 GW 4064 results in decreased expression of RSAD2 mRNA CTD PMID:26655953 Rsad2 Rat hydroxychloroquine increases expression ISO Rsad2 (Mus musculus) 6480464 Hydroxychloroquine results in increased expression of RSAD2 mRNA CTD PMID:25321315 Rsad2 Rat hydroxychloroquine increases expression ISO RSAD2 (Homo sapiens) 6480464 Hydroxychloroquine results in increased expression of RSAD2 mRNA CTD PMID:25321315 Rsad2 Rat iohexol decreases expression ISO RSAD2 (Homo sapiens) 6480464 Iohexol results in decreased expression of RSAD2 mRNA CTD PMID:29705293 Rsad2 Rat iopamidol decreases expression ISO RSAD2 (Homo sapiens) 6480464 Iopamidol results in decreased expression of RSAD2 mRNA CTD PMID:29705293 Rsad2 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of RSAD2 mRNA CTD PMID:35283115 Rsad2 Rat lipopolysaccharide multiple interactions ISO Rsad2 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of RSAD2 mRNA] and genipin inhibits the reaction [Lipopolysaccharides results in increased expression of RSAD2 mRNA] CTD PMID:22687549 and PMID:25890327 Rsad2 Rat lipopolysaccharide increases expression ISO RSAD2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of RSAD2 mRNA CTD PMID:35811015 Rsad2 Rat lipopolysaccharide multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Rsad2 Rat lipopolysaccharide increases expression ISO Rsad2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of RSAD2 mRNA CTD PMID:22687549 and PMID:25890327 Rsad2 Rat malathion increases expression ISO RSAD2 (Homo sapiens) 6480464 Malathion results in increased expression of RSAD2 mRNA CTD PMID:37047231 Rsad2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of RSAD2 mRNA CTD PMID:28801915 Rsad2 Rat mercury atom multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Mercuric Chloride results in increased abundance of Mercury] which results in increased expression of RSAD2 mRNA CTD PMID:28453771 Rsad2 Rat mercury dichloride multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Mercuric Chloride results in increased abundance of Mercury] which results in increased expression of RSAD2 mRNA CTD PMID:28453771 Rsad2 Rat mercury(0) multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Mercuric Chloride results in increased abundance of Mercury] which results in increased expression of RSAD2 mRNA CTD PMID:28453771 Rsad2 Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of RSAD2 mRNA CTD PMID:24136188 Rsad2 Rat methotrexate decreases expression ISO RSAD2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat Monobutylphthalate increases expression ISO Rsad2 (Mus musculus) 6480464 monobutyl phthalate results in increased expression of RSAD2 mRNA CTD PMID:35278568 Rsad2 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RSAD2 mRNA CTD PMID:28801915 Rsad2 Rat nickel atom increases expression ISO RSAD2 (Homo sapiens) 6480464 Nickel results in increased expression of RSAD2 mRNA CTD PMID:24768652 and PMID:25583101 Rsad2 Rat nickel dichloride multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of RSAD2 mRNA CTD PMID:37951547 Rsad2 Rat nicotine multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of RSAD2 mRNA CTD PMID:37951547 Rsad2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of RSAD2 mRNA CTD PMID:33484710 Rsad2 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of RSAD2 mRNA CTD PMID:22124623 Rsad2 Rat ozone multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of RSAD2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of RSAD2 mRNA CTD PMID:34911549 Rsad2 Rat paracetamol increases expression ISO RSAD2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of RSAD2 mRNA CTD PMID:21420995 Rsad2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RSAD2 mRNA CTD PMID:33387578 Rsad2 Rat pentachlorophenol increases expression ISO Rsad2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of RSAD2 mRNA CTD PMID:23892564 Rsad2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rsad2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RSAD2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of RSAD2 mRNA CTD PMID:36331819 Rsad2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of RSAD2 mRNA CTD PMID:19162173 Rsad2 Rat phenobarbital multiple interactions ISO Rsad2 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of RSAD2 mRNA] CTD PMID:19482888 Rsad2 Rat phenobarbital affects expression ISO Rsad2 (Mus musculus) 6480464 Phenobarbital affects the expression of RSAD2 mRNA CTD PMID:23091169 Rsad2 Rat phenobarbital increases expression ISO Rsad2 (Mus musculus) 6480464 Phenobarbital results in increased expression of RSAD2 mRNA CTD PMID:19482888 Rsad2 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of RSAD2 mRNA CTD PMID:19162173 Rsad2 Rat pirinixic acid decreases expression ISO Rsad2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RSAD2 mRNA CTD PMID:23811191 Rsad2 Rat piroxicam decreases expression ISO RSAD2 (Homo sapiens) 6480464 Piroxicam results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat prednisolone decreases expression ISO RSAD2 (Homo sapiens) 6480464 Prednisolone results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat propiconazole increases expression ISO Rsad2 (Mus musculus) 6480464 propiconazole results in increased expression of RSAD2 mRNA CTD PMID:21278054 and PMID:22334560 Rsad2 Rat quercetin decreases expression ISO RSAD2 (Homo sapiens) 6480464 Quercetin results in decreased expression of RSAD2 mRNA CTD PMID:19729006 Rsad2 Rat rac-lactic acid increases expression ISO RSAD2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RSAD2 mRNA CTD PMID:30851411 Rsad2 Rat resveratrol increases expression ISO RSAD2 (Homo sapiens) 6480464 resveratrol results in increased expression of RSAD2 mRNA CTD PMID:17257620 Rsad2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RSAD2 mRNA CTD PMID:28374803 Rsad2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Rsad2 Rat senecionine increases expression ISO Rsad2 (Mus musculus) 6480464 senecionine results in increased expression of RSAD2 protein CTD PMID:35357534 Rsad2 Rat serpentine asbestos increases expression ISO RSAD2 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of RSAD2 mRNA CTD PMID:24160326 Rsad2 Rat silicon dioxide increases expression ISO Rsad2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of RSAD2 mRNA CTD PMID:23221170 Rsad2 Rat silicon dioxide increases expression ISO RSAD2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of RSAD2 mRNA CTD PMID:22300531 and PMID:25351596 Rsad2 Rat silver atom decreases expression ISO Rsad2 (Mus musculus) 6480464 Silver results in decreased expression of RSAD2 mRNA CTD PMID:27131904 Rsad2 Rat silver(0) decreases expression ISO Rsad2 (Mus musculus) 6480464 Silver results in decreased expression of RSAD2 mRNA CTD PMID:27131904 Rsad2 Rat sodium arsenite decreases expression ISO RSAD2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RSAD2 mRNA CTD PMID:28595984 Rsad2 Rat sodium arsenite increases expression ISO RSAD2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RSAD2 mRNA CTD PMID:34032870 Rsad2 Rat sodium arsenite multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [sodium arsenite affects the acetylation of H3-4 protein] which affects the methylation of RSAD2 promoter CTD PMID:18448484 Rsad2 Rat sodium aurothiomalate decreases expression ISO RSAD2 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in decreased expression of RSAD2 mRNA CTD PMID:19192274 Rsad2 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of RSAD2 mRNA CTD PMID:22561333 Rsad2 Rat succimer multiple interactions ISO Rsad2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of RSAD2 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of RSAD2 mRNA CTD PMID:21641980 and PMID:26378955 Rsad2 Rat succimer multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of RSAD2 mRNA CTD PMID:26378955 Rsad2 Rat tamoxifen decreases expression ISO Rsad2 (Mus musculus) 6480464 Tamoxifen results in decreased expression of RSAD2 mRNA CTD PMID:25123088 Rsad2 Rat tamoxifen affects expression ISO Rsad2 (Mus musculus) 6480464 Tamoxifen affects the expression of RSAD2 mRNA CTD PMID:20937368 Rsad2 Rat tamoxifen increases expression ISO RSAD2 (Homo sapiens) 6480464 Tamoxifen results in increased expression of RSAD2 mRNA CTD PMID:19155303 Rsad2 Rat temozolomide increases expression ISO RSAD2 (Homo sapiens) 6480464 Temozolomide results in increased expression of RSAD2 mRNA CTD PMID:31758290 Rsad2 Rat tert-butyl hydroperoxide increases expression ISO Rsad2 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of RSAD2 mRNA CTD PMID:14729362 and PMID:15003993 Rsad2 Rat tert-butyl hydroperoxide decreases expression ISO RSAD2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of RSAD2 mRNA CTD PMID:15336504 Rsad2 Rat testosterone enanthate affects expression ISO RSAD2 (Homo sapiens) 6480464 testosterone enanthate affects the expression of RSAD2 mRNA CTD PMID:17440010 Rsad2 Rat tetrachloromethane affects expression ISO Rsad2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of RSAD2 mRNA CTD PMID:17484886 Rsad2 Rat tetrachloromethane increases expression ISO Rsad2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RSAD2 mRNA CTD PMID:25270620 more ... Rsad2 Rat tetraphene decreases expression ISO Rsad2 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of RSAD2 mRNA CTD PMID:26377693 Rsad2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RSAD2 mRNA CTD PMID:34492290 Rsad2 Rat thiram increases expression ISO RSAD2 (Homo sapiens) 6480464 Thiram results in increased expression of RSAD2 mRNA CTD PMID:38568856 Rsad2 Rat titanium dioxide increases expression ISO Rsad2 (Mus musculus) 6480464 titanium dioxide results in increased expression of RSAD2 mRNA CTD PMID:23557971 Rsad2 Rat tofacitinib decreases expression ISO RSAD2 (Homo sapiens) 6480464 tofacitinib results in decreased expression of RSAD2 mRNA CTD PMID:25487280 Rsad2 Rat tremolite asbestos increases expression ISO Rsad2 (Mus musculus) 6480464 tremolite results in increased expression of RSAD2 mRNA CTD PMID:29279043 Rsad2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of RSAD2 mRNA CTD PMID:33387578 Rsad2 Rat triclosan increases expression EXP 6480464 Triclosan results in increased expression of RSAD2 mRNA CTD PMID:30447264 Rsad2 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of RSAD2 mRNA CTD PMID:30589522 Rsad2 Rat trovafloxacin increases expression ISO Rsad2 (Mus musculus) 6480464 trovafloxacin results in increased expression of RSAD2 mRNA CTD PMID:35537566 Rsad2 Rat tungsten decreases expression ISO Rsad2 (Mus musculus) 6480464 Tungsten results in decreased expression of RSAD2 mRNA CTD PMID:30912803 Rsad2 Rat tunicamycin increases expression ISO RSAD2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of RSAD2 mRNA CTD PMID:33545341 and PMID:38498338 Rsad2 Rat valproic acid increases expression ISO RSAD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RSAD2 mRNA CTD PMID:29154799 Rsad2 Rat zidovudine multiple interactions ISO RSAD2 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of RSAD2 mRNA CTD PMID:20370541
Imported Annotations - KEGG (archival)
(-)-alpha-phellandrene (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-diaminotoluene (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (ISO) 2-hydroxypropanoic acid (ISO) 2-nitrofluorene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) 6alpha-methylprednisolone (ISO) acetamide (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) avobenzone (ISO) azathioprine (ISO) benazepril (EXP) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calciol (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (EXP) chromium(6+) (ISO) cisplatin (EXP) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyproconazole (ISO) DDT (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diclofenac (ISO) diethyl maleate (EXP) dimethylarsinic acid (ISO) dioxygen (EXP) diquat (ISO) disulfiram (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) folic acid (ISO) formaldehyde (ISO) gadodiamide hydrate (ISO) gamma-hexachlorocyclohexane (EXP) Genipin (ISO) gentamycin (EXP) glycidol (EXP) GW 4064 (ISO) hydroxychloroquine (ISO) iohexol (ISO) iopamidol (ISO) lidocaine (EXP) lipopolysaccharide (ISO) malathion (ISO) manganese(II) chloride (EXP) mercury atom (ISO) mercury dichloride (ISO) mercury(0) (ISO) methotrexate (EXP,ISO) Monobutylphthalate (ISO) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nickel dichloride (ISO) nicotine (ISO) nitrofen (EXP) ochratoxin A (EXP) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) prednisolone (ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) senecionine (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) sodium dichromate (EXP) succimer (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tofacitinib (ISO) tremolite asbestos (ISO) trichloroethene (EXP) triclosan (EXP) triphenyl phosphate (EXP) trovafloxacin (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) zidovudine (ISO)
Biological Process
CD4-positive, alpha-beta T cell activation (IEA,ISO,ISS) CD4-positive, alpha-beta T cell differentiation (IEA,ISO,ISS) defense response to virus (IBA,IEA,ISO,ISS) immune system process (IEA) innate immune response (IEA) negative regulation of protein secretion (IEA,ISO,ISS) negative regulation of viral genome replication (IEA,ISO) ossification (IDA) positive regulation of immune response (IBA) positive regulation of T-helper 2 cell cytokine production (IEA,ISO,ISS) positive regulation of toll-like receptor 7 signaling pathway (IEA,ISO,ISS) positive regulation of toll-like receptor 9 signaling pathway (IEA,ISO,ISS) regulation of ossification (IDA) response to virus (IEA,ISO,ISS)
Cellular Component
endoplasmic reticulum (IBA,IEA,ISO,ISS) endoplasmic reticulum membrane (IEA,ISO,ISS) fibrillar center (IEA,ISO) Golgi apparatus (IEA) lipid droplet (IEA,ISO,ISS) membrane (IEA) mitochondrial inner membrane (IEA,ISO) mitochondrial outer membrane (IEA,ISO) mitochondrion (IBA,IEA,ISO)
Rsad2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 48,774,985 - 48,788,245 (-) NCBI GRCr8 mRatBN7.2 6 43,046,514 - 43,059,737 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 43,047,658 - 43,059,699 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 43,359,103 - 43,372,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 43,673,963 - 43,687,086 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 43,107,103 - 43,120,223 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 45,655,947 - 45,669,083 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 45,655,954 - 45,669,148 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 54,375,724 - 54,388,860 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 44,100,775 - 44,113,910 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 44,103,900 - 44,117,036 (-) NCBI Celera 6 42,313,474 - 42,326,629 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
RSAD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 6,865,885 - 6,898,239 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 6,865,557 - 6,898,239 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 7,006,016 - 7,038,370 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 6,935,247 - 6,955,814 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 6,968,505 - 6,988,515 NCBI Celera 2 6,930,748 - 6,951,316 (+) NCBI Celera Cytogenetic Map 2 p25.2 NCBI HuRef 2 6,865,409 - 6,885,974 (+) NCBI HuRef CHM1_1 2 6,947,350 - 6,967,911 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 6,887,387 - 6,919,736 (+) NCBI T2T-CHM13v2.0
Rsad2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 26,492,742 - 26,506,451 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 26,492,745 - 26,506,451 (-) Ensembl GRCm39 Ensembl GRCm38 12 26,442,743 - 26,456,452 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 26,442,746 - 26,456,452 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 27,127,608 - 27,141,317 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 27,029,021 - 27,042,699 (-) NCBI MGSCv36 mm8 Celera 12 27,901,184 - 27,914,822 (-) NCBI Celera Cytogenetic Map 12 A2 NCBI cM Map 12 9.69 NCBI
Rsad2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955487 1,987,405 - 2,001,731 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955487 1,988,226 - 2,001,731 (-) NCBI ChiLan1.0 ChiLan1.0
RSAD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 119,613,920 - 119,646,167 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 119,617,895 - 119,650,127 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 6,873,821 - 6,906,087 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 7,010,762 - 7,042,500 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 7,021,937 - 7,042,961 (+) Ensembl panpan1.1 panPan2
RSAD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 4,488,202 - 4,508,705 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 4,487,957 - 4,507,181 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 4,413,914 - 4,434,446 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 4,590,443 - 4,611,109 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 4,590,447 - 4,611,103 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 4,478,041 - 4,498,585 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 4,486,485 - 4,506,800 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 4,500,286 - 4,520,826 (+) NCBI UU_Cfam_GSD_1.0
Rsad2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 49,163,650 - 49,180,994 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936532 3,921,807 - 3,936,042 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936532 3,921,824 - 3,936,027 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RSAD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 128,877,186 - 128,897,815 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 128,880,853 - 128,897,809 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 137,666,404 - 137,683,529 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RSAD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 100,778,801 - 100,804,205 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 100,778,302 - 100,798,044 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 11,543,806 - 11,563,560 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rsad2
.
Predicted Target Of
Count of predictions: 540 Count of miRNA genes: 245 Interacting mature miRNAs: 298 Transcripts: ENSRNOT00000010092 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
RH130993
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 43,046,750 - 43,046,969 (+) MAPPER mRatBN7.2 Rnor_6.0 6 45,656,184 - 45,656,402 NCBI Rnor6.0 Rnor_5.0 6 54,375,961 - 54,376,179 UniSTS Rnor5.0 RGSC_v3.4 6 44,101,012 - 44,101,230 UniSTS RGSC3.4 Celera 6 42,313,711 - 42,313,929 UniSTS RH 3.4 Map 6 257.8 UniSTS Cytogenetic Map 6 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
91
90
59
25
59
6
216
95
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010092 ⟹ ENSRNOP00000010092
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 43,047,658 - 43,059,699 (-) Ensembl Rnor_6.0 Ensembl 6 45,655,954 - 45,669,148 (-) Ensembl
RefSeq Acc Id:
NM_138881 ⟹ NP_620236
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 48,774,985 - 48,788,120 (-) NCBI mRatBN7.2 6 43,046,514 - 43,059,651 (-) NCBI Rnor_6.0 6 45,655,947 - 45,669,083 (-) NCBI Rnor_5.0 6 54,375,724 - 54,388,860 (-) NCBI RGSC_v3.4 6 44,100,775 - 44,113,910 (-) RGD Celera 6 42,313,474 - 42,326,629 (-) RGD
Sequence:
TGGGGATGCTAGTGCCTACTGCGCTGGCTGCTCGGCTGCTGAGCCTGTTCCAGCAACAGCTGGGTTCCCTCTGGAGTGGCCTGGCCATGCTGTTCTGCTGGCTGAGAATAGCATTGGGGTGGCCAGAT
hide sequence
RefSeq Acc Id:
XM_039112917 ⟹ XP_038968845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 48,777,688 - 48,788,245 (-) NCBI mRatBN7.2 6 43,050,064 - 43,059,737 (-) NCBI
RefSeq Acc Id:
NP_620236 ⟸ NM_138881
- UniProtKB:
O70600 (UniProtKB/Swiss-Prot), A0A0H2UHF4 (UniProtKB/TrEMBL), A6HAZ9 (UniProtKB/TrEMBL)
- Sequence:
MLVPTALAARLLSLFQQQLGSLWSGLAMLFCWLRIALGWPDPGKGQPRVRGEPKETQETHEDPGSAQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGMEKINFSGGEPFL
hide sequence
Ensembl Acc Id:
ENSRNOP00000010092 ⟸ ENSRNOT00000010092
RefSeq Acc Id:
XP_038968845 ⟸ XM_039112917
- Peptide Label:
isoform X1
- UniProtKB:
A0A0H2UHF4 (UniProtKB/TrEMBL), A6HAZ9 (UniProtKB/TrEMBL)
RGD ID: 13694528 Promoter ID: EPDNEW_R5051 Type: single initiation site Name: Rsad2_1 Description: radical S-adenosyl methionine domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 45,669,096 - 45,669,156 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-22
Rsad2
radical S-adenosyl methionine domain containing 2
Best5
Best5 protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-08-07
Best5
Best5 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
mRNA expression is induced by interferon-alpha (IFN-alpha) or IFN-gamma in osteoblast cultures
631877
