Symbol:
Clock
Name:
clock circadian regulator
RGD ID:
620271
Description:
Predicted to enable DNA binding activity; DNA-binding transcription activator activity, RNA polymerase II-specific; and histone acetyltransferase activity. Involved in several processes, including entrainment of circadian clock; female pregnancy; and positive regulation of DNA-templated transcription. Located in perichromatin fibrils. Biomarker of cholestasis and hypertension. Human ortholog(s) of this gene implicated in Alzheimer's disease and alcohol use disorder. Orthologous to human CLOCK (clock circadian regulator); INTERACTS WITH 4,4'-diaminodiphenylmethane; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
circadian locomoter output cycles kaput; circadian locomoter output cycles protein kaput; clock homolog (mouse); rCLOCK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 32,262,747 - 32,346,872 (+) NCBI GRCr8 mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 31,908,566 - 31,990,400 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 32,275,041 - 32,358,981 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 33,582,937 - 33,666,873 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 32,068,051 - 32,151,990 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 34,418,226 - 34,502,218 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 34,446,616 - 34,502,218 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 34,233,721 - 34,289,468 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 34,218,472 - 34,258,054 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 34,218,471 - 34,258,054 (+) NCBI Celera 14 31,247,422 - 31,293,707 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clock Rat (+)-epicatechin-3-O-gallate multiple interactions ISO RGD:1348034 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the more ... CTD PMID:29061316 Clock Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1348034 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the more ... CTD PMID:22079256|PMID:29061316 Clock Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552430 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CLOCK mRNA CTD PMID:36331819 Clock Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552430 6480464 1,2-Dimethylhydrazine results in decreased expression of CLOCK mRNA CTD PMID:22206623 Clock Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552430 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLOCK mRNA CTD PMID:22206623 Clock Rat 1,3-dichloropropan-2-ol decreases expression ISO RGD:1552430 6480464 1,3-dichloro-2-propanol results in decreased expression of CLOCK protein CTD PMID:36805544 Clock Rat 17alpha-ethynylestradiol affects expression ISO RGD:1552430 6480464 Ethinyl Estradiol affects the expression of CLOCK mRNA CTD PMID:17555576 Clock Rat 17alpha-ethynylestradiol increases expression ISO RGD:1552430 6480464 Ethinyl Estradiol results in increased expression of CLOCK mRNA CTD PMID:17942748 Clock Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1552430 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLOCK mRNA CTD PMID:17942748 Clock Rat 17beta-estradiol increases expression ISO RGD:1552430 6480464 Estradiol results in increased expression of CLOCK mRNA CTD PMID:39298647 Clock Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases activity ISO RGD:1348034 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in increased activity of CLOCK protein CTD PMID:27589886 Clock Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1552430 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Clock Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:1348034 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of CLOCK mRNA CTD PMID:21703328 Clock Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1552430 6480464 Tetrachlorodibenzodioxin results in increased expression of CLOCK mRNA CTD PMID:17942748|PMID:24058054 Clock Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1552430 6480464 Tetrachlorodibenzodioxin results in decreased expression of CLOCK mRNA CTD PMID:18295293|PMID:28213091 Clock Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1552430 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:17942748|PMID:28433925 Clock Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552430 6480464 Tetrachlorodibenzodioxin affects the expression of CLOCK mRNA CTD PMID:21570461|PMID:28922406|PMID:36222588 Clock Rat 2-amino-2-deoxy-D-glucopyranose decreases expression ISO RGD:1552430 6480464 Glucosamine results in decreased expression of CLOCK mRNA; Glucosamine results in decreased expression of CLOCK more ... CTD PMID:24442997 Clock Rat 20-HETE affects abundance ISO RGD:1552430 6480464 CLOCK protein affects the abundance of 20-hydroxy-5,8,11,14-eicosatetraenoic acid CTD PMID:22440902 Clock Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1552430 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of CLOCK mRNA CTD PMID:26251327 Clock Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1552430 6480464 4,4'-diaminodiphenylmethane results in increased expression of CLOCK mRNA CTD PMID:18648102 Clock Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4,4'-diaminodiphenylmethane results in decreased expression of CLOCK mRNA CTD PMID:30723492 Clock Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1552430 6480464 bisphenol S results in increased expression of CLOCK mRNA CTD PMID:33297965|PMID:39298647 Clock Rat 4-nitro-m-cresol affects expression ISO RGD:1552430 6480464 4-nitro-3-cresol affects the expression of CLOCK mRNA CTD PMID:35654127 Clock Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CLOCK mRNA CTD PMID:30047161 Clock Rat acrolein multiple interactions ISO RGD:1348034 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Clock Rat aflatoxin B1 increases expression ISO RGD:1552430 6480464 Aflatoxin B1 results in increased expression of CLOCK mRNA CTD PMID:19770486 Clock Rat aldehydo-D-glucosamine decreases expression ISO RGD:1552430 6480464 Glucosamine results in decreased expression of CLOCK mRNA; Glucosamine results in decreased expression of CLOCK more ... CTD PMID:24442997 Clock Rat all-trans-retinoic acid multiple interactions ISO RGD:1552430 6480464 RARA protein inhibits the reaction [Tretinoin results in increased activity of [CLOCK protein binds to more ... CTD PMID:17069763 Clock Rat alpha-pinene multiple interactions ISO RGD:1348034 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Clock Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CLOCK mRNA CTD PMID:30047161 Clock Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLOCK mRNA CTD PMID:16483693 Clock Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CLOCK mRNA CTD PMID:30779732 Clock Rat aristolochic acid A decreases expression ISO RGD:1348034 6480464 aristolochic acid I results in decreased expression of CLOCK mRNA CTD PMID:33212167 Clock Rat Aroclor 1254 decreases expression ISO RGD:1552430 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CLOCK mRNA CTD PMID:23650126 Clock Rat benzo[a]pyrene increases expression ISO RGD:1348034 6480464 Benzo(a)pyrene results in increased expression of CLOCK mRNA CTD PMID:17879257 Clock Rat benzo[a]pyrene increases expression ISO RGD:1552430 6480464 Benzo(a)pyrene results in increased expression of CLOCK mRNA CTD PMID:20127859|PMID:22228805 Clock Rat benzo[a]pyrene multiple interactions ISO RGD:1552430 6480464 CLOCK gene mutant form inhibits the reaction [Benzo(a)pyrene results in increased expression of CYP1A1 mRNA] CTD PMID:21978865 Clock Rat benzo[b]fluoranthene decreases expression ISO RGD:1552430 6480464 benzo(b)fluoranthene results in decreased expression of CLOCK mRNA CTD PMID:26377693 Clock Rat beta-D-glucosamine decreases expression ISO RGD:1552430 6480464 Glucosamine results in decreased expression of CLOCK mRNA; Glucosamine results in decreased expression of CLOCK more ... CTD PMID:24442997 Clock Rat beta-naphthoflavone multiple interactions ISO RGD:1552430 6480464 beta-Naphthoflavone inhibits the reaction [CLOCK protein binds to BMAL1 protein]; beta-Naphthoflavone inhibits the reaction [CLOCK more ... CTD PMID:20106950 Clock Rat bezafibrate multiple interactions ISO RGD:1552430 6480464 [CLOCK protein binds to BMAL1 protein] promotes the reaction [Bezafibrate results in increased expression of more ... CTD PMID:20400680 Clock Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of CLOCK mRNA CTD PMID:28871463 Clock Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1552430 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Clock Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CLOCK mRNA CTD PMID:25181051 Clock Rat bisphenol A increases expression ISO RGD:1552430 6480464 bisphenol A results in increased expression of CLOCK mRNA CTD PMID:33221593 Clock Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CLOCK mRNA CTD PMID:30816183 Clock Rat bisphenol A affects methylation ISO RGD:1552430 6480464 bisphenol A affects the methylation of CLOCK promoter CTD PMID:27334623 Clock Rat bisphenol A multiple interactions ISO RGD:1552430 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Clock Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CLOCK gene CTD PMID:28505145 Clock Rat bisphenol F increases expression ISO RGD:1552430 6480464 bisphenol F results in increased expression of CLOCK mRNA CTD PMID:38685157 Clock Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of CLOCK mRNA CTD PMID:32479839 Clock Rat butanal decreases expression ISO RGD:1348034 6480464 butyraldehyde results in decreased expression of CLOCK mRNA CTD PMID:26079696 Clock Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of CLOCK; Cadmium Chloride affects the expression of CLOCK mRNA CTD PMID:21442002|PMID:23085516 Clock Rat cadmium dichloride multiple interactions EXP 6480464 Melatonin inhibits the reaction [Cadmium Chloride affects the expression of CLOCK] CTD PMID:23085516 Clock Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of CLOCK promoter CTD PMID:22457795 Clock Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CLOCK mRNA CTD PMID:20107868 Clock Rat caffeine decreases phosphorylation ISO RGD:1348034 6480464 Caffeine results in decreased phosphorylation of CLOCK protein CTD PMID:35688186 Clock Rat cannabidiol decreases expression ISO RGD:1552430 6480464 Cannabidiol results in decreased expression of CLOCK mRNA CTD PMID:30307084|PMID:33019509 Clock Rat cannabigerol decreases expression ISO RGD:1552430 6480464 cannabigerol results in decreased expression of CLOCK mRNA CTD PMID:33019509 Clock Rat carbon nanotube increases expression ISO RGD:1552430 6480464 Nanotubes, Carbon results in increased expression of CLOCK mRNA CTD PMID:25554681|PMID:25620056 Clock Rat CGS-21680 increases expression ISO RGD:1348034 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine results in increased expression of CLOCK mRNA CTD PMID:22923002 Clock Rat cisplatin decreases expression ISO RGD:1348034 6480464 Cisplatin results in decreased expression of CLOCK protein CTD PMID:21157427 Clock Rat clozapine affects response to substance ISO RGD:1348034 6480464 CLOCK gene SNP affects the susceptibility to Clozapine CTD PMID:15331141 Clock Rat cocaine increases expression ISO RGD:1552430 6480464 Cocaine results in increased expression of CLOCK mRNA CTD PMID:15994025 Clock Rat cocaine hydrochloride increases expression ISO RGD:1552430 405866348 cocaine hydrochloride increases expression of Clock mRNA in caudate-putamen RGD Clock Rat crocidolite asbestos decreases expression ISO RGD:1348034 6480464 Asbestos, Crocidolite results in decreased expression of CLOCK mRNA CTD PMID:29523930 Clock Rat DDE increases activity ISO RGD:1348034 6480464 Dichlorodiphenyl Dichloroethylene results in increased activity of CLOCK protein CTD PMID:27589886 Clock Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of CLOCK mRNA CTD PMID:23640034 Clock Rat deoxynivalenol decreases expression ISO RGD:1552430 6480464 deoxynivalenol results in decreased expression of CLOCK protein CTD PMID:36602574 Clock Rat deoxynivalenol multiple interactions ISO RGD:1552430 6480464 BMAL1 protein promotes the reaction [deoxynivalenol results in decreased expression of CLOCK protein]; deoxynivalenol inhibits more ... CTD PMID:36602574 Clock Rat dexamethasone affects expression ISO RGD:1348034 6480464 Dexamethasone affects the expression of CLOCK mRNA CTD PMID:23251369 Clock Rat dibenz[a,h]anthracene decreases expression ISO RGD:1552430 6480464 1,2,5,6-dibenzanthracene results in decreased expression of CLOCK mRNA CTD PMID:26377693 Clock Rat Dibutyl phosphate affects expression ISO RGD:1348034 6480464 di-n-butylphosphoric acid affects the expression of CLOCK mRNA CTD PMID:37042841 Clock Rat dichloromethane decreases expression ISO RGD:1552430 6480464 Methylene Chloride results in decreased expression of CLOCK mRNA CTD PMID:28392392 Clock Rat doxorubicin decreases expression ISO RGD:1348034 6480464 Doxorubicin results in decreased expression of CLOCK mRNA CTD PMID:29803840 Clock Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CLOCK mRNA CTD PMID:29391264 Clock Rat epoxiconazole affects expression ISO RGD:1552430 6480464 epoxiconazole affects the expression of CLOCK mRNA CTD PMID:35436446 Clock Rat ethanol increases expression ISO RGD:1348034 405866372 ethanol increases expression of CLOCK protein in intestinal cells RGD Clock Rat ethanol multiple interactions ISO RGD:1348034 405866372 N-acetylcysteamine inhibits the reaction [ethanol increases expression of CLOCK protein in intestinal cells] RGD Clock Rat fluoxetine increases expression ISO RGD:1552430 6480464 Fluoxetine results in increased expression of CLOCK mRNA CTD PMID:15994025 Clock Rat fluoxetine increases expression ISO RGD:1552430 405866348 fluoxetine increases expression of Clock mRNA in hippocampal formation RGD Clock Rat folic acid multiple interactions ISO RGD:1552430 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CLOCK mRNA CTD PMID:22206623 Clock Rat furan increases expression ISO RGD:1552430 6480464 furan results in increased expression of CLOCK mRNA CTD PMID:24183702 Clock Rat gallic acid multiple interactions ISO RGD:1348034 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the more ... CTD PMID:29061316 Clock Rat gallocatechin multiple interactions ISO RGD:1348034 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the more ... CTD PMID:29061316 Clock Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CLOCK mRNA CTD PMID:33387578 Clock Rat glyphosate decreases expression ISO RGD:1552430 6480464 Glyphosate results in decreased expression of CLOCK mRNA CTD PMID:36572786 Clock Rat hexadecanoic acid decreases expression ISO RGD:1552430 6480464 Palmitic Acid results in decreased expression of CLOCK mRNA; Palmitic Acid results in decreased expression more ... CTD PMID:24442997 Clock Rat hydrogen peroxide multiple interactions ISO RGD:1348034 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the more ... CTD PMID:29061316|PMID:30316844 Clock Rat hydrogen peroxide affects expression ISO RGD:1348034 6480464 Hydrogen Peroxide affects the expression of CLOCK mRNA; Hydrogen Peroxide affects the expression of CLOCK more ... CTD PMID:29061316|PMID:30316844 Clock Rat lead(0) decreases expression ISO RGD:1348034 6480464 Lead results in decreased expression of CLOCK mRNA CTD PMID:19921347 Clock Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of CLOCK mRNA CTD PMID:28511934 Clock Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Cadmium Chloride affects the expression of CLOCK] CTD PMID:23085516 Clock Rat methidathion decreases expression ISO RGD:1552430 6480464 methidathion results in decreased expression of CLOCK mRNA CTD PMID:34813904 Clock Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CLOCK mRNA CTD PMID:30047161 Clock Rat methylmercury chloride decreases expression ISO RGD:1348034 6480464 methylmercuric chloride results in decreased expression of CLOCK mRNA CTD PMID:28001369 Clock Rat N-nitrosodiethylamine multiple interactions ISO RGD:1552430 6480464 CLOCK protein promotes the reaction [Diethylnitrosamine results in increased activity of CASP3 protein]; CLOCK protein more ... CTD PMID:17942915|PMID:21167249 Clock Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CLOCK mRNA CTD PMID:20360939 Clock Rat N-nitrosodiethylamine increases response to substance ISO RGD:1552430 6480464 CLOCK protein results in increased susceptibility to Diethylnitrosamine CTD PMID:21167249 Clock Rat N-nitrosodiethylamine increases expression ISO RGD:1552430 6480464 Diethylnitrosamine results in increased expression of CLOCK mRNA CTD PMID:17942915 Clock Rat ozone multiple interactions ISO RGD:1348034 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Clock Rat parathion decreases expression ISO RGD:1552430 6480464 Parathion results in decreased expression of CLOCK mRNA CTD PMID:34813904 Clock Rat pentanal decreases expression ISO RGD:1348034 6480464 pentanal results in decreased expression of CLOCK mRNA CTD PMID:26079696 Clock Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552430 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CLOCK mRNA CTD PMID:36331819 Clock Rat perfluorooctanoic acid increases expression ISO RGD:1348034 6480464 perfluorooctanoic acid results in increased expression of CLOCK mRNA CTD PMID:23146750 Clock Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CLOCK mRNA CTD PMID:20360939 Clock Rat phenobarbital decreases expression ISO RGD:1552430 6480464 Phenobarbital results in decreased expression of CLOCK mRNA CTD PMID:19270015 Clock Rat pirinixic acid increases expression ISO RGD:1552430 6480464 pirinixic acid results in increased expression of CLOCK mRNA CTD PMID:23811191 Clock Rat pirinixic acid multiple interactions ISO RGD:1552430 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Clock Rat potassium chromate decreases expression ISO RGD:1348034 6480464 potassium chromate(VI) results in decreased expression of CLOCK mRNA CTD PMID:22079256 Clock Rat potassium chromate multiple interactions ISO RGD:1348034 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CLOCK mRNA CTD PMID:22079256 Clock Rat resveratrol multiple interactions ISO RGD:1552430 6480464 Resveratrol inhibits the reaction [Sodium Fluoride results in decreased expression of CLOCK protein] CTD PMID:36063856 Clock Rat rotenone multiple interactions EXP 6480464 [lipopolysaccharide, Escherichia coli O111 B4 co-treated with Rotenone] results in decreased expression of CLOCK mRNA; more ... CTD PMID:30328585 Clock Rat sodium arsenate increases expression ISO RGD:1552430 6480464 sodium arsenate results in increased expression of CLOCK mRNA CTD PMID:21795629 Clock Rat sodium arsenite decreases expression ISO RGD:1552430 6480464 sodium arsenite results in decreased expression of CLOCK mRNA CTD PMID:30130555 Clock Rat sodium fluoride multiple interactions ISO RGD:1552430 6480464 Resveratrol inhibits the reaction [Sodium Fluoride results in decreased expression of CLOCK protein] CTD PMID:36063856 Clock Rat sodium fluoride decreases expression ISO RGD:1552430 6480464 Sodium Fluoride results in decreased expression of CLOCK mRNA; Sodium Fluoride results in decreased expression more ... CTD PMID:36063856 Clock Rat styrene decreases expression ISO RGD:1552430 6480464 Styrene results in decreased expression of CLOCK mRNA CTD PMID:28951217 Clock Rat sunitinib increases expression ISO RGD:1348034 6480464 Sunitinib results in increased expression of CLOCK mRNA CTD PMID:31533062 Clock Rat tamoxifen affects expression ISO RGD:1552430 6480464 Tamoxifen affects the expression of CLOCK mRNA CTD PMID:17555576 Clock Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CLOCK mRNA CTD PMID:31150632 Clock Rat tetraphene decreases expression ISO RGD:1552430 6480464 benz(a)anthracene results in decreased expression of CLOCK mRNA CTD PMID:26377693 Clock Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CLOCK mRNA CTD PMID:34492290 Clock Rat titanium dioxide decreases methylation ISO RGD:1552430 6480464 titanium dioxide results in decreased methylation of CLOCK promoter CTD PMID:35295148 Clock Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of CLOCK gene CTD PMID:27618143 Clock Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of CLOCK mRNA CTD PMID:30589522 Clock Rat triphenyl phosphate affects expression ISO RGD:1348034 6480464 triphenyl phosphate affects the expression of CLOCK mRNA CTD PMID:37042841 Clock Rat valproic acid decreases expression ISO RGD:1348034 6480464 Valproic Acid results in decreased expression of CLOCK mRNA CTD PMID:23179753|PMID:28001369 Clock Rat valproic acid decreases methylation ISO RGD:1348034 6480464 Valproic Acid results in decreased methylation of CLOCK gene CTD PMID:29154799 Clock Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CLOCK mRNA CTD PMID:23034163
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Clock Rat cellular response to ionizing radiation involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat cellular response to ionizing radiation involved_in ISO RGD:1348034 1624291 PMID:21659603 RGD PMID:21659603 Clock Rat chromatin remodeling involved_in IEA GO:0004402 1600115 GO_REF:0000108 GOC GO_REF:0000108 Clock Rat circadian regulation of gene expression involved_in ISO RGD:1552430 1624291 PMID:14672706, PMID:15147242, PMID:18316400, PMID:19141540, PMID:19299583, PMID:20430893, PMID:21768648, PMID:22653727, PMID:23785138, PMID:30012868 RGD PMID:14672706|PMID:15147242|PMID:18316400|PMID:19141540|PMID:19299583|PMID:20430893|PMID:21768648|PMID:22653727|PMID:23785138|PMID:30012868 Clock Rat circadian regulation of gene expression involved_in IBA FB:FBgn0023076|MGI:109232|MGI:99698|PANTHER:PTN001126940|UniProtKB:O15516|UniProtKB:Q5ZQU2|UniProtKB:Q8QGQ6|ZFIN:ZDB-GENE-990630-14 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clock Rat circadian regulation of gene expression involved_in IEA InterPro:IPR047230 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat circadian regulation of gene expression involved_in ISO RGD:1348034 1624291 PMID:10864977, PMID:21980503, PMID:23229515, PMID:24005054, PMID:28985504 RGD PMID:10864977|PMID:21980503|PMID:23229515|PMID:24005054|PMID:28985504 Clock Rat circadian regulation of gene expression involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat circadian regulation of gene expression involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat circadian regulation of gene expression involved_in ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat circadian regulation of gene expression involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat circadian rhythm NAS 632379 RGD Clock Rat circadian rhythm acts_upstream_of_or_within IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat circadian rhythm acts_upstream_of_or_within ISO RGD:1552430 1624291 MGI:1861634 PMID:12024206, PMID:12897057, PMID:8171325 RGD PMID:12024206|PMID:12897057|PMID:8171325 Clock Rat circadian rhythm involved_in ISO RGD:1552430 1624291 PMID:14645221 RGD PMID:14645221 Clock Rat circadian rhythm IEP 10401879 RGD Clock Rat DNA damage checkpoint signaling involved_in ISO RGD:1348034 1624291 PMID:21659603 RGD PMID:21659603 Clock Rat DNA damage checkpoint signaling involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA damage response involved_in IEA UniProtKB-KW:KW-0227 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clock Rat entrainment of circadian clock IEP 632379 RGD Clock Rat female pregnancy IEP 10401948 RGD Clock Rat negative regulation of DNA-templated transcription involved_in ISS UniProtKB:Q9WTL8 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat negative regulation of DNA-templated transcription involved_in ISO RGD:1552430 1624291 PMID:24378737 RGD PMID:24378737 Clock Rat negative regulation of DNA-templated transcription involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway involved_in ISO RGD:1552430 1624291 PMID:24378737 RGD PMID:24378737 Clock Rat negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of circadian rhythm involved_in ISO RGD:1552430 1624291 PMID:22653727 RGD PMID:22653727 Clock Rat positive regulation of circadian rhythm involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of circadian rhythm involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of circadian rhythm involved_in ISO RGD:1348034 1624291 PMID:12738229, PMID:23229515 RGD PMID:12738229|PMID:23229515 Clock Rat positive regulation of DNA-templated transcription involved_in IDA 8661632 PMID:22356123 UniProt Clock Rat positive regulation of DNA-templated transcription involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1552430 1624291 PMID:12397359, PMID:12738229, PMID:18316400, PMID:19299583, PMID:19605937, PMID:20430893, PMID:21768648, PMID:22653727, PMID:24089055, PMID:24736997, PMID:25961797 RGD PMID:12397359|PMID:12738229|PMID:18316400|PMID:19299583|PMID:19605937|PMID:20430893|PMID:21768648|PMID:22653727|PMID:24089055|PMID:24736997|PMID:25961797 Clock Rat positive regulation of DNA-templated transcription involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1348034 1624291 PMID:10864977, PMID:23229515, PMID:23785138 RGD PMID:10864977|PMID:23229515|PMID:23785138 Clock Rat positive regulation of DNA-templated transcription involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat positive regulation of inflammatory response involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of inflammatory response involved_in ISO RGD:1552430 1624291 PMID:22894897 RGD PMID:22894897 Clock Rat positive regulation of NF-kappaB transcription factor activity involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat positive regulation of NF-kappaB transcription factor activity involved_in ISO RGD:1552430 1624291 PMID:22895791 RGD PMID:22895791 Clock Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1552430 1624291 PMID:14672706, PMID:15147242, PMID:15193144 RGD PMID:14672706|PMID:15147242|PMID:15193144 Clock Rat positive regulation of transcription by RNA polymerase II acts_upstream_of_or_within IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat positive regulation of transcription by RNA polymerase II acts_upstream_of_or_within ISO RGD:1552430 1624291 MGI:1096381 PMID:16606840, PMID:19217292 RGD PMID:16606840|PMID:19217292 Clock Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in ISO RGD:1552430 1624291 PMID:23395176 RGD PMID:23395176 Clock Rat proteasome-mediated ubiquitin-dependent protein catabolic process involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat protein acetylation involved_in ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat protein acetylation involved_in ISO RGD:1552430 1624291 PMID:28985504 RGD PMID:28985504 Clock Rat protein acetylation involved_in ISO RGD:1348034 1624291 PMID:28985504 RGD PMID:28985504 Clock Rat regulation of circadian rhythm involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat regulation of circadian rhythm involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat regulation of circadian rhythm involved_in ISO RGD:1552430 1624291 PMID:30012868 RGD PMID:30012868 Clock Rat regulation of DNA-templated transcription involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat regulation of DNA-templated transcription acts_upstream_of_or_within IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat regulation of DNA-templated transcription involved_in IEA InterPro:IPR001067|InterPro:IPR013767 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat regulation of DNA-templated transcription acts_upstream_of_or_within ISO RGD:1552430 1624291 PMID:12024206 RGD PMID:12024206 Clock Rat regulation of DNA-templated transcription involved_in ISO RGD:1552430 1624291 PMID:22653727 RGD PMID:22653727 Clock Rat regulation of gene expression involved_in IEA ARBA:ARBA00028334 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Clock Rat regulation of hair cycle involved_in ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat regulation of hair cycle involved_in ISO RGD:1348034 1624291 PMID:24005054 RGD PMID:24005054 Clock Rat regulation of hair cycle involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat regulation of insulin secretion involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat regulation of insulin secretion involved_in ISO RGD:1552430 1624291 PMID:20562852 RGD PMID:20562852 Clock Rat regulation of insulin secretion involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat regulation of transcription by RNA polymerase II involved_in IEA GO:0000981 1600115 GO_REF:0000108 GOC GO_REF:0000108 Clock Rat regulation of transcription by RNA polymerase II involved_in IBA FB:FBgn0023076|MGI:99698|PANTHER:PTN001126940|ZFIN:ZDB-GENE-990630-14 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clock Rat regulation of type B pancreatic cell development involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat regulation of type B pancreatic cell development involved_in ISO RGD:1552430 1624291 PMID:20562852 RGD PMID:20562852 Clock Rat regulation of type B pancreatic cell development involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat response to light stimulus IEP 10401879 RGD Clock Rat response to redox state involved_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat response to redox state involved_in ISO RGD:1348034 1624291 PMID:11441146 RGD PMID:11441146 Clock Rat response to redox state involved_in ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat rhythmic process involved_in IEA UniProtKB-KW:KW-0090 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clock Rat spermatogenesis involved_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat spermatogenesis involved_in ISO RGD:1552430 1624291 PMID:22900038 RGD PMID:22900038 Clock Rat spermatogenesis involved_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Clock Rat chromatoid body located_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat chromatoid body located_in ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat chromatoid body located_in ISO RGD:1552430 1624291 PMID:22900038 RGD PMID:22900038 Clock Rat chromosome located_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat chromosome located_in ISO RGD:1348034 1624291 PMID:21659603 RGD PMID:21659603 Clock Rat CLOCK-BMAL transcription complex part_of ISO RGD:1348034 1624291 PMID:10864977, PMID:23229515 RGD PMID:10864977|PMID:23229515 Clock Rat CLOCK-BMAL transcription complex part_of IBA FB:FBgn0023076|MGI:99698|PANTHER:PTN001126940|UniProtKB:O15516|ZFIN:ZDB-GENE-990630-14 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clock Rat CLOCK-BMAL transcription complex part_of ISO RGD:1552430 1624291 PMID:22653727, PMID:25961797 RGD PMID:22653727|PMID:25961797 Clock Rat CLOCK-BMAL transcription complex part_of IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat CLOCK-BMAL transcription complex part_of IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat cytoplasm located_in ISO RGD:1552430 1624291 PMID:12897057, PMID:20861012, PMID:22208286 RGD PMID:12897057|PMID:20861012|PMID:22208286 Clock Rat cytoplasm located_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat cytoplasm located_in IEA UniProtKB-KW:KW-0963 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clock Rat cytoplasm located_in IEA InterPro:IPR001067 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Clock Rat cytosol located_in IEA UniProtKB-SubCell:SL-0091 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Clock Rat cytosol located_in ISO RGD:1348034 1624291 PMID:28985504 RGD PMID:28985504 Clock Rat cytosol located_in ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat cytosol located_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat nucleoplasm located_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat nucleoplasm located_in ISO RGD:1348034 1624291 RGD GO_REF:0000052 Clock Rat nucleus located_in ISO RGD:1348034 1624291 PMID:12738229, PMID:14645221, PMID:23229515, PMID:28985504 RGD PMID:12738229|PMID:14645221|PMID:23229515|PMID:28985504 Clock Rat nucleus located_in IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat nucleus located_in IEA UniProtKB-KW:KW-0539 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clock Rat nucleus located_in IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Clock Rat nucleus located_in IEA InterPro:IPR001067 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat nucleus located_in IDA 8661632 PMID:22356123 UniProt Clock Rat nucleus located_in ISO RGD:1552430 1624291 PMID:12897057, PMID:17310242, PMID:18662546, PMID:20861012, PMID:22653727, PMID:25961797 RGD PMID:12897057|PMID:17310242|PMID:18662546|PMID:20861012|PMID:22653727|PMID:25961797 Clock Rat perichromatin fibrils IDA 10401943 RGD Clock Rat transcription regulator complex part_of IEA InterPro:IPR001067 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat transcription regulator complex part_of IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat transcription regulator complex part_of ISO RGD:1552430 1624291 PMID:16606840, PMID:22653727 RGD PMID:16606840|PMID:22653727 Clock Rat transcription regulator complex part_of ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Clock Rat chromatin DNA binding enables ISO RGD:1552430 1624291 PMID:24610784 RGD PMID:24610784 Clock Rat chromatin DNA binding enables ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat chromatin DNA binding enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA binding enables IEA UniProtKB-KW:KW-0238 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Clock Rat DNA binding enables IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA binding enables ISO RGD:1348034 1624291 PMID:11441146 RGD PMID:11441146 Clock Rat DNA binding enables ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO RGD:1552430 1624291 PMID:15560782 RGD PMID:15560782 Clock Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA-binding transcription factor activity enables ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat DNA-binding transcription factor activity enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA-binding transcription factor activity enables ISO RGD:1552430 1624291 PMID:12024206, PMID:22653727 RGD PMID:12024206|PMID:22653727 Clock Rat DNA-binding transcription factor activity enables IEA InterPro:IPR001067 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IBA MGI:99698|PANTHER:PTN001126940|ZFIN:ZDB-GENE-990630-14 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clock Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables ISO RGD:1552430 1624291 PMID:15147242 RGD PMID:15147242 Clock Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IEA InterPro:IPR047230 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat E-box binding enables ISO RGD:1348034 1624291 PMID:18411297, PMID:23785138 RGD PMID:18411297|PMID:23785138 Clock Rat E-box binding enables ISO RGD:1552430 1624291 PMID:12738229, PMID:19605937, PMID:20106950, PMID:20430893, PMID:30012868 RGD PMID:12738229|PMID:19605937|PMID:20106950|PMID:20430893|PMID:30012868 Clock Rat E-box binding enables IBA MGI:99698|PANTHER:PTN002917757|UniProtKB:O15516 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Clock Rat E-box binding enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat E-box binding enables IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat E-box binding enables ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat histone acetyltransferase activity enables ISO RGD:1552430 1624291 PMID:19141540 RGD PMID:19141540 Clock Rat histone acetyltransferase activity enables IEA EC:2.3.1.48 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Clock Rat histone acetyltransferase activity enables ISO RGD:1348034 1624291 PMID:21980503, PMID:28985504 RGD PMID:21980503|PMID:28985504 Clock Rat histone acetyltransferase activity enables ISS UniProtKB:O15516 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat histone acetyltransferase activity enables IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat histone acetyltransferase activity enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat protein binding enables ISO RGD:1348034 1624291 UniProtKB:O00327|UniProtKB:O00327-8|UniProtKB:P00966|UniProtKB:P04150|UniProtKB:P12268|UniProtKB:P29375|UniProtKB:P41235|UniProtKB:Q02363|UniProtKB:Q09472|UniProtKB:Q16795|UniProtKB:Q8TC59|UniProtKB:Q8WYA1|UniProtKB:Q8WYA1-3|UniProtKB:Q92793|UniProtKB:Q92831 PMID:11018023, PMID:14645221, PMID:20861012, PMID:21960634, PMID:21980503, PMID:28388406, PMID:28514442, PMID:28903391, PMID:28985504, PMID:30530698, PMID:31515488, PMID:32296183, PMID:33961781 RGD PMID:11018023|PMID:14645221|PMID:20861012|PMID:21960634|PMID:21980503|PMID:28388406|PMID:28514442|PMID:28903391|PMID:28985504|PMID:30530698|PMID:31515488|PMID:32296183|PMID:33961781 Clock Rat protein binding enables ISO RGD:1552430 1624291 PR:P45481|UniProtKB:O35973|UniProtKB:O54943|UniProtKB:P04150|UniProtKB:P16460|UniProtKB:P20444|UniProtKB:P30154|UniProtKB:P36873|UniProtKB:P41134|UniProtKB:P51449|UniProtKB:P55200|UniProtKB:P62136|UniProtKB:P62140|UniProtKB:P63073|UniProtKB:P67870|UniProtKB:P97784|UniProtKB:Q02363|UniProtKB:Q02535|UniProtKB:Q03164|UniProtKB:Q04207|UniProtKB:Q14738|UniProtKB:Q14995|UniProtKB:Q3U1J4|UniProtKB:Q3UXZ9|UniProtKB:Q569Z6|UniProtKB:Q61026|UniProtKB:Q61188|UniProtKB:Q61496|UniProtKB:Q7TPV4|UniProtKB:Q8CDG1|UniProtKB:Q8K4B0|UniProtKB:Q8R0W1|UniProtKB:Q923E4|UniProtKB:Q925J9|UniProtKB:Q92753|UniProtKB:Q9JMB7|UniProtKB:Q9JMK2|UniProtKB:Q9R194|UniProtKB:Q9WTL8|UniProtKB:Q9WTL8-2|UniProtKB:Q9WTL8-4 PMID:14701732, PMID:16606840, PMID:16717091, PMID:16777965, PMID:17310242, PMID:17347670, PMID:18075593, PMID:18430226, PMID:18662546, PMID:18662547, PMID:19129230, PMID:19141540, PMID:20211142, more ... RGD PMID:14701732|PMID:16606840|PMID:16717091|PMID:16777965|PMID:17310242|PMID:17347670|PMID:18075593|PMID:18430226|PMID:18662546|PMID:18662547|PMID:19129230|PMID:19141540|PMID:20211142|PMID:20832105|PMID:20840750|PMID:20861012|PMID:21113167|PMID:21613214|PMID:21680841|PMID:21960634|PMID:22441692|PMID:22653727|PMID:22895791|PMID:22900038|PMID:23555304|PMID:23735699|PMID:24043798|PMID:24089055|PMID:24154698|PMID:24529706|PMID:24737000|PMID:25961797|PMID:26323038|PMID:26562092|PMID:28388406|PMID:28903391|PMID:28985504|PMID:9704006 Clock Rat protein dimerization activity enables IEA InterPro:IPR011598|InterPro:IPR036638 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Clock Rat protein-lysine-acetyltransferase activity enables IEA RHEA:45948 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Clock Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1348034 1624291 PMID:18411297 RGD PMID:18411297 Clock Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1552430 1624291 PMID:15147242, PMID:19299583, PMID:21113167, PMID:21768648, PMID:22894897, PMID:24043798, PMID:24051492, PMID:24089055, PMID:24385426 RGD PMID:15147242|PMID:19299583|PMID:21113167|PMID:21768648|PMID:22894897|PMID:24043798|PMID:24051492|PMID:24089055|PMID:24385426 Clock Rat sequence-specific DNA binding enables ISO RGD:1552430 1624291 PMID:21613214 RGD PMID:21613214 Clock Rat sequence-specific DNA binding enables IEA UniProtKB:O08785|ensembl:ENSMUSP00000143939 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat sequence-specific DNA binding enables ISS UniProtKB:O08785 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Clock Rat sequence-specific double-stranded DNA binding enables ISO RGD:1348034 1624291 PMID:28473536 RGD PMID:28473536 Clock Rat sequence-specific double-stranded DNA binding enables IEA UniProtKB:O15516|ensembl:ENSP00000426983 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Clock Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
(+)-epicatechin-3-O-gallate (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dichloropropan-2-ol (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 20-HETE (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-nitro-m-cresol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) aldehydo-D-glucosamine (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-D-glucosamine (ISO) beta-naphthoflavone (ISO) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) cadmium dichloride (EXP) caffeine (ISO) cannabidiol (ISO) cannabigerol (ISO) carbon nanotube (ISO) CGS-21680 (ISO) cisplatin (ISO) clozapine (ISO) cocaine (ISO) cocaine hydrochloride (ISO) crocidolite asbestos (ISO) DDE (ISO) decabromodiphenyl ether (EXP) deoxynivalenol (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) dichloromethane (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fluoxetine (ISO) folic acid (ISO) furan (ISO) gallic acid (ISO) gallocatechin (ISO) gentamycin (EXP) glyphosate (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) lead(0) (ISO) manganese(II) chloride (EXP) melatonin (EXP) methidathion (ISO) methimazole (EXP) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP,ISO) ozone (ISO) parathion (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (EXP) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (ISO) styrene (ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (EXP) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
cellular response to ionizing radiation (IEA,ISO) chromatin remodeling (IEA) circadian regulation of gene expression (IBA,IEA,ISO,ISS) circadian rhythm (IEA,IEP,ISO,NAS) DNA damage checkpoint signaling (IEA,ISO) DNA damage response (IEA) entrainment of circadian clock (IEP) female pregnancy (IEP) negative regulation of DNA-templated transcription (IEA,ISO,ISS) negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway (IEA,ISO,ISS) positive regulation of circadian rhythm (IEA,ISO) positive regulation of DNA-templated transcription (IDA,IEA,ISO,ISS) positive regulation of inflammatory response (IEA,ISO) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of transcription by RNA polymerase II (IEA,ISO) proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO,ISS) protein acetylation (ISO,ISS) regulation of circadian rhythm (IEA,ISO,ISS) regulation of DNA-templated transcription (IEA,ISO,ISS) regulation of gene expression (IEA) regulation of hair cycle (IEA,ISO,ISS) regulation of insulin secretion (IEA,ISO,ISS) regulation of transcription by RNA polymerase II (IBA,IEA) regulation of type B pancreatic cell development (IEA,ISO,ISS) response to light stimulus (IEP) response to redox state (IEA,ISO,ISS) rhythmic process (IEA) spermatogenesis (IEA,ISO,ISS)
Cellular Component
chromatoid body (IEA,ISO,ISS) chromosome (IEA,ISO) CLOCK-BMAL transcription complex (IBA,IEA,ISO) cytoplasm (IEA,ISO) cytosol (IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IDA,IEA,ISO) perichromatin fibrils (IDA) transcription regulator complex (IEA,ISO,ISS)
Molecular Function
chromatin DNA binding (IEA,ISO,ISS) DNA binding (IEA,ISO,ISS) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO,ISS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) E-box binding (IBA,IEA,ISO,ISS) histone acetyltransferase activity (IEA,ISO,ISS) protein binding (ISO) protein dimerization activity (IEA) protein-lysine-acetyltransferase activity (IEA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO,ISS) sequence-specific DNA binding (IEA,ISO,ISS) sequence-specific double-stranded DNA binding (IEA,ISO) transferase activity (IEA)
1.
Phase-dependent induction by light of rat Clock gene expression in the suprachiasmatic nucleus.
Abe H, etal., Brain Res Mol Brain Res 1999 Mar 20;66(1-2):104-10.
2.
Polymorphism of CLOCK gene rs 4580704 C > G is associated with susceptibility of Alzheimer's disease in a Chinese population.
Chen HF, etal., Arch Med Res. 2013 Apr;44(3):203-7. doi: 10.1016/j.arcmed.2013.01.002. Epub 2013 Jan 26.
3.
Functional CLOCK gene rs1554483 G/C polymorphism is associated with susceptibility to Alzheimer's disease in the Chinese population.
Chen Q, etal., J Int Med Res. 2013 Apr;41(2):340-6. doi: 10.1177/0300060513476430.
4.
Deficiency of circadian protein CLOCK reduces lifespan and increases age-related cataract development in mice.
Dubrovsky YV, etal., Aging (Albany NY). 2010 Dec;2(12):936-44.
5.
Role for intestinal CYP2E1 in alcohol-induced circadian gene-mediated intestinal hyperpermeability.
Forsyth CB, etal., Am J Physiol Gastrointest Liver Physiol. 2013 Jul 15;305(2):G185-95. doi: 10.1152/ajpgi.00354.2012. Epub 2013 May 9.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Cross-talk between hypoxic and circadian pathways: cooperative roles for hypoxia-inducible factor 1alpha and CLOCK in transcriptional activation of the vasopressin gene.
Ghorbel MT, etal., Mol Cell Neurosci 2003 Mar;22(3):396-404.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Reduced expression of circadian clock genes in male alcoholic patients.
Huang MC, etal., Alcohol Clin Exp Res. 2010 Nov;34(11):1899-904. doi: 10.1111/j.1530-0277.2010.01278.x. Epub 2010 Aug 24.
10.
[Changes of biological clock protein in neonatal rats with hypoxic-ischemic brain damage].
Li YF, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2013 Jan;15(1):62-6.
11.
Aging affects the distribution of the circadian CLOCK protein in rat hepatocytes.
Malatesta M, etal., Microsc Res Tech. 2005 Sep;68(1):45-50.
12.
Thyroid transcription factor 1, a homeodomain containing transcription factor, contributes to regulating periodic oscillations in GnRH gene expression.
Matagne V, etal., J Neuroendocrinol. 2012 Jun;24(6):916-29. doi: 10.1111/j.1365-2826.2012.02302.x.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Age-associated disruption of molecular clock expression in skeletal muscle of the spontaneously hypertensive rat.
Miyazaki M, etal., PLoS One. 2011;6(11):e27168. doi: 10.1371/journal.pone.0027168. Epub 2011 Nov 4.
15.
Increased choline kinase activity and elevated phosphocholine levels in human colon cancer.
Nakagami K, etal., Jpn J Cancer Res. 1999 Apr;90(4):419-24.
16.
Circadian rhythms and light responsiveness of mammalian clock gene, Clock and BMAL1, transcripts in the rat retina.
Namihira M, etal., Neurosci Lett. 1999 Aug 13;271(1):1-4.
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
The role of clock in ethanol-related behaviors.
Ozburn AR, etal., Neuropsychopharmacology. 2013 Nov;38(12):2393-400. doi: 10.1038/npp.2013.138. Epub 2013 May 31.
19.
Melatonin inhibits cholangiocyte hyperplasia in cholestatic rats by interaction with MT1 but not MT2 melatonin receptors.
Renzi A, etal., Am J Physiol Gastrointest Liver Physiol. 2011 Oct;301(4):G634-43. doi: 10.1152/ajpgi.00206.2011. Epub 2011 Jul 14.
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Effect of fluoxetine and cocaine on the expression of clock genes in the mouse hippocampus and striatum.
Uz T, etal., Neuroscience. 2005;134(4):1309-16. doi: 10.1016/j.neuroscience.2005.05.003.
22.
Circadian variation in placental and hepatic clock genes in rat pregnancy.
Wharfe MD, etal., Endocrinology. 2011 Sep;152(9):3552-60. doi: 10.1210/en.2011-0081. Epub 2011 Jul 19.
23.
The polymorphism of CLOCK gene 3111T/C C>T is associated with susceptibility of Alzheimer disease in Chinese population.
Yang YK, etal., J Investig Med. 2013 Oct;61(7):1084-7. doi: 10.231/JIM.0b013e31829f91c0.
Clock Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 32,262,747 - 32,346,872 (+) NCBI GRCr8 mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 31,908,566 - 31,990,400 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 32,275,041 - 32,358,981 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 33,582,937 - 33,666,873 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 32,068,051 - 32,151,990 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 34,418,226 - 34,502,218 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 34,446,616 - 34,502,218 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 34,233,721 - 34,289,468 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 34,218,472 - 34,258,054 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 34,218,471 - 34,258,054 (+) NCBI Celera 14 31,247,422 - 31,293,707 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
CLOCK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 55,427,903 - 55,546,909 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 55,427,903 - 55,546,909 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 56,294,070 - 56,413,076 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 55,993,417 - 56,107,754 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 56,139,587 - 56,253,925 NCBI Celera 4 53,800,517 - 53,915,033 (-) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 52,243,062 - 52,362,368 (-) NCBI HuRef CHM1_1 4 56,329,197 - 56,448,202 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 58,916,047 - 59,035,037 (-) NCBI T2T-CHM13v2.0
Clock Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 76,357,715 - 76,452,675 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 76,357,715 - 76,452,639 (-) Ensembl GRCm39 Ensembl GRCm38 5 76,209,868 - 76,305,603 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 76,209,868 - 76,304,792 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 76,641,202 - 76,733,573 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 77,286,952 - 77,379,323 (-) NCBI MGSCv36 mm8 Celera 5 73,483,631 - 73,569,902 (-) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 40.63 NCBI
Clock Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 15,454,630 - 15,530,906 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 15,394,496 - 15,537,969 (+) NCBI ChiLan1.0 ChiLan1.0
CLOCK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 74,247,308 - 74,364,328 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 74,449,508 - 74,568,336 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 68,391,310 - 68,509,813 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 74,954,284 - 75,071,210 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 75,018,898 - 75,066,726 (+) Ensembl panpan1.1 panPan2
CLOCK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 47,684,409 - 47,825,733 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 47,691,709 - 47,758,784 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 47,641,539 - 47,782,815 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 48,295,259 - 48,436,678 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 48,297,870 - 48,436,440 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 47,970,216 - 48,111,463 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 47,498,942 - 47,640,139 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 48,447,647 - 48,588,918 (-) NCBI UU_Cfam_GSD_1.0
Clock Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 28,397,879 - 28,511,737 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 17,794,134 - 17,845,303 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 17,789,834 - 17,900,371 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CLOCK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 54,793,342 - 54,877,777 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 54,793,323 - 54,910,192 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 58,659,297 - 58,720,896 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLOCK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 13,015,198 - 13,134,741 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 13,051,454 - 13,127,240 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666066 13,771,823 - 13,891,249 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Clock
.
Predicted Target Of
Count of predictions: 136 Count of miRNA genes: 97 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000002976, ENSRNOT00000002981 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
RH137478
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,974,120 - 31,974,333 (+) MAPPER mRatBN7.2 Rnor_6.0 14 34,483,667 - 34,483,879 NCBI Rnor6.0 Rnor_5.0 14 34,270,917 - 34,271,129 UniSTS Rnor5.0 RGSC_v3.4 14 34,246,205 - 34,246,417 UniSTS RGSC3.4 Celera 14 31,275,155 - 31,275,367 UniSTS Cytogenetic Map 14 p11 UniSTS
D14S292
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,977,395 - 31,978,459 (+) MAPPER mRatBN7.2 Rnor_6.0 14 34,486,941 - 34,488,004 NCBI Rnor6.0 Rnor_5.0 14 34,319,777 - 34,320,840 UniSTS Rnor5.0 Rnor_5.0 14 34,274,191 - 34,275,254 UniSTS Rnor5.0 RGSC_v3.4 14 34,249,479 - 34,250,542 UniSTS RGSC3.4 Celera 14 31,278,428 - 31,279,493 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002976 ⟹ ENSRNOP00000002976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 14 34,446,616 - 34,495,713 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000002981 ⟹ ENSRNOP00000002981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 31,908,566 - 31,990,400 (+) Ensembl Rnor_6.0 Ensembl 14 34,455,934 - 34,502,218 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085991 ⟹ ENSRNOP00000074670
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 31,908,566 - 31,990,400 (+) Ensembl Rnor_6.0 Ensembl 14 34,455,934 - 34,502,218 (+) Ensembl
RefSeq Acc Id:
NM_001289832 ⟹ NP_001276761
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,300,545 - 32,346,872 (+) NCBI mRatBN7.2 14 31,946,340 - 31,992,673 (+) NCBI Rnor_6.0 14 34,455,934 - 34,502,218 (+) NCBI Celera 14 31,247,422 - 31,293,707 (+) NCBI
Sequence:
ATGTTGTTTACCGTAAGCTGTAGTAAAATGAGCTCAATTGTTGACAGAGATGACAGTAGTATTTTTGATGGATTGGTGGAAGAAGATGACAAGGACAAAGCAAAAAGAGTATCTAGAAACAAATCAGA
hide sequence
RefSeq Acc Id:
NM_001389254 ⟹ NP_001376183
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,750 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,546 - 31,992,673 (+) NCBI
RefSeq Acc Id:
NM_021856 ⟹ NP_068628
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,300,545 - 32,346,872 (+) NCBI mRatBN7.2 14 31,946,340 - 31,992,673 (+) NCBI Rnor_6.0 14 34,455,934 - 34,502,218 (+) NCBI Rnor_5.0 14 34,233,721 - 34,289,468 (+) NCBI RGSC_v3.4 14 34,218,472 - 34,258,054 (+) RGD Celera 14 31,247,422 - 31,293,707 (+) NCBI
Sequence:
ATGTTGTTTACCGTAAGCTGTAGTAAAATGAGCTCAATTGTTGACAGAGATGACAGTAGTATTTTTGATGGATTGGTGGAAGAAGATGACAAGGACAAAGCAAAAAGAGTATCTAGAAACAAATCAGA
hide sequence
RefSeq Acc Id:
XM_017599361 ⟹ XP_017454850
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI Rnor_6.0 14 34,418,226 - 34,502,215 (+) NCBI
Sequence:
AGGGAGCGCAATCACGGACTGGGCTGGCGGCTACCGGCTGGAGAGAGGAAATCCCGGACGGCGAGAGCGCGAAGGAAATCTGGCCGCCGCCGCGCGCGCGCTCCCGTGAACGAAAAGCACAAGAAGAA
hide sequence
RefSeq Acc Id:
XM_017599363 ⟹ XP_017454852
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI Rnor_6.0 14 34,418,226 - 34,502,215 (+) NCBI
Sequence:
AGGGAGCGCAATCACGGACTGGGCTGGCGGCTACCGGCTGGAGAGAGGAAATCCCGGACGGCGA
hide sequence
RefSeq Acc Id:
XM_017599364 ⟹ XP_017454853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI Rnor_6.0 14 34,418,226 - 34,502,215 (+) NCBI
Sequence:
AGGGAGCGCAATCACGGACTGGGCTGGCGGCTACCGGCTGGAGAGAGGAAATCCCGGACGGCGA
hide sequence
RefSeq Acc Id:
XM_039092371 ⟹ XP_038948299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,838 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092372 ⟹ XP_038948300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,838 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092373 ⟹ XP_038948301
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092374 ⟹ XP_038948302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,838 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092375 ⟹ XP_038948303
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092376 ⟹ XP_038948304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092377 ⟹ XP_038948305
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092378 ⟹ XP_038948306
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,288,087 - 32,346,872 (+) NCBI mRatBN7.2 14 31,933,883 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092379 ⟹ XP_038948307
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092380 ⟹ XP_038948308
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092382 ⟹ XP_038948310
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,298,390 - 32,346,872 (+) NCBI mRatBN7.2 14 31,945,969 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092383 ⟹ XP_038948311
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092385 ⟹ XP_038948313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI mRatBN7.2 14 31,908,542 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_039092387 ⟹ XP_038948315
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,304,337 - 32,346,872 (+) NCBI mRatBN7.2 14 31,950,133 - 31,992,673 (+) NCBI
RefSeq Acc Id:
XM_063273555 ⟹ XP_063129625
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273556 ⟹ XP_063129626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273557 ⟹ XP_063129627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273558 ⟹ XP_063129628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273559 ⟹ XP_063129629
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273560 ⟹ XP_063129630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,787 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273562 ⟹ XP_063129632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273563 ⟹ XP_063129633
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273564 ⟹ XP_063129634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273565 ⟹ XP_063129635
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,263,040 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273567 ⟹ XP_063129637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273568 ⟹ XP_063129638
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
XM_063273569 ⟹ XP_063129639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 32,262,747 - 32,346,872 (+) NCBI
RefSeq Acc Id:
NP_068628 ⟸ NM_021856
- Peptide Label:
isoform 1
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY7 (UniProtKB/TrEMBL)
- Sequence:
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTD
hide sequence
RefSeq Acc Id:
NP_001276761 ⟸ NM_001289832
- Peptide Label:
isoform S
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY8 (UniProtKB/TrEMBL)
- Sequence:
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTD
hide sequence
RefSeq Acc Id:
XP_017454853 ⟸ XM_017599364
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
- Sequence:
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGN
hide sequence
RefSeq Acc Id:
XP_017454852 ⟸ XM_017599363
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
- Sequence:
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGN
hide sequence
RefSeq Acc Id:
XP_017454850 ⟸ XM_017599361
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
- Sequence:
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGN
hide sequence
Ensembl Acc Id:
ENSRNOP00000002981 ⟸ ENSRNOT00000002981
Ensembl Acc Id:
ENSRNOP00000002976 ⟸ ENSRNOT00000002976
Ensembl Acc Id:
ENSRNOP00000074670 ⟸ ENSRNOT00000085991
RefSeq Acc Id:
XP_038948308 ⟸ XM_039092380
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948301 ⟸ XM_039092373
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948307 ⟸ XM_039092379
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948304 ⟸ XM_039092376
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948303 ⟸ XM_039092375
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948305 ⟸ XM_039092377
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948311 ⟸ XM_039092383
- Peptide Label:
isoform X2
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948313 ⟸ XM_039092385
- Peptide Label:
isoform X4
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001376183 ⟸ NM_001389254
- Peptide Label:
isoform 3
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948302 ⟸ XM_039092374
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948300 ⟸ XM_039092372
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948299 ⟸ XM_039092371
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948306 ⟸ XM_039092378
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948310 ⟸ XM_039092382
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8N0 (UniProtKB/TrEMBL), D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948315 ⟸ XM_039092387
- Peptide Label:
isoform X6
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129627 ⟸ XM_063273557
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129628 ⟸ XM_063273558
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129626 ⟸ XM_063273556
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129633 ⟸ XM_063273563
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129632 ⟸ XM_063273562
- Peptide Label:
isoform X2
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129638 ⟸ XM_063273568
- Peptide Label:
isoform X4
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129639 ⟸ XM_063273569
- Peptide Label:
isoform X5
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129637 ⟸ XM_063273567
- Peptide Label:
isoform X3
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129630 ⟸ XM_063273560
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129634 ⟸ XM_063273564
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129625 ⟸ XM_063273555
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129629 ⟸ XM_063273559
- Peptide Label:
isoform X1
- UniProtKB:
D4A4R8 (UniProtKB/TrEMBL), A0A0G2K8N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129635 ⟸ XM_063273565
- Peptide Label:
isoform X2
- UniProtKB:
Q9WVS9 (UniProtKB/Swiss-Prot), Q920Y1 (UniProtKB/Swiss-Prot), A6JCY7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-12-18
Clock
clock circadian regulator
Clock
clock homolog (mouse)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Clock
clock homolog (mouse)
Clock
circadian locomoter output cycles kaput
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Clock
circadian locomoter output cycles kaput
Clock
clock homolog (mouse)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Clock
clock homolog (mouse)
circadian locomoter output cycles kaput
Name updated
1299863 APPROVED
2004-12-07
circadian locomoter output cycles kaput
Clock
clock gene
Name updated
1299863 APPROVED
2002-08-07
Clock
clock gene
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in the suprachiasmatic nucleus
632379
gene_regulation
mRNA level increased by light exposure in a phase dependent manner
632379
