Symbol:
Tjp2
Name:
tight junction protein 2
RGD ID:
619807
Description:
Enables transmembrane transporter binding activity. Predicted to be involved in several processes, including establishment of endothelial intestinal barrier; positive regulation of blood-brain barrier permeability; and protein localization to cell-cell junction. Predicted to act upstream of or within negative regulation of osteoclast development and negative regulation of tumor necrosis factor-mediated signaling pathway. Located in bicellular tight junction. Biomarker of hypertension. Human ortholog(s) of this gene implicated in disease of metabolism and progressive familial intrahepatic cholestasis 4. Orthologous to human TJP2 (tight junction protein 2); INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC108349129; MGC124724; tight junction protein ZO-2; uncharacterized LOC108349129; ZO-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TJP2 (tight junction protein 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Tjp2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tjp2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TJP2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TJP2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tjp2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TJP2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TJP2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tjp2 (tight junction protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TJP2 (tight junction protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tjp2 (tight junction protein 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tjp2a (tight junction protein 2a (zona occludens 2))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tjp2b (tight junction protein 2b (zona occludens 2))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
zoo-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
pyd
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tjp2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 231,136,218 - 231,264,750 (-) NCBI GRCr8 mRatBN7.2 1 221,709,745 - 221,838,291 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 221,709,745 - 221,838,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 230,159,462 - 230,287,384 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 237,089,516 - 237,217,442 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 229,907,552 - 230,035,465 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 241,945,816 - 242,084,044 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 241,945,841 - 242,083,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 227,475,386 - 227,574,457 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 227,639,414 - 227,668,771 (-) NCBI Celera 1 218,921,753 - 219,049,897 (-) NCBI Celera Cytogenetic Map 1 q51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tjp2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TJP2 mRNA] CTD PMID:31150632 Tjp2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TJP2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TJP2 mRNA CTD PMID:22079256 Tjp2 Rat 1,2-dichloroethane increases expression ISO Tjp2 (Mus musculus) 6480464 ethylene dichloride results in increased expression of TJP2 mRNA CTD PMID:28189721 and PMID:28960355 Tjp2 Rat 1,2-dimethylhydrazine affects expression ISO Tjp2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of TJP2 mRNA CTD PMID:22206623 Tjp2 Rat 1,2-dimethylhydrazine multiple interactions ISO Tjp2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TJP2 mRNA CTD PMID:22206623 Tjp2 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of TJP2 mRNA CTD PMID:21983209 Tjp2 Rat 17beta-estradiol multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of TJP2 mRNA CTD PMID:20660070 Tjp2 Rat 17beta-estradiol increases expression ISO Tjp2 (Mus musculus) 6480464 Estradiol results in increased expression of TJP2 mRNA CTD PMID:39298647 Tjp2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of TJP2 mRNA CTD PMID:26496021 Tjp2 Rat 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO TJP2 (Homo sapiens) 6480464 [2 more ... CTD PMID:22906770 Tjp2 Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO Tjp2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Tjp2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TJP2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TJP2 mRNA CTD PMID:17101203 and PMID:20106945 Tjp2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TJP2 mRNA CTD PMID:33387578 Tjp2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tjp2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TJP2 mRNA CTD PMID:21570461 Tjp2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tjp2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TJP2 mRNA CTD PMID:21354282 Tjp2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tjp2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TJP2 mRNA CTD PMID:19465110 Tjp2 Rat 2,4,6-tribromophenol decreases expression ISO TJP2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tjp2 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Tjp2 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of TJP2 mRNA CTD PMID:25307695 Tjp2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TJP2 mRNA CTD PMID:21346803 Tjp2 Rat 2,6-dimethoxyphenol multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Tjp2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TJP2 mRNA CTD PMID:21346803 Tjp2 Rat 2-amino-14,16-dimethyloctadecan-3-ol increases expression ISO TJP2 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in increased expression of TJP2 protein CTD PMID:32044396 Tjp2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO TJP2 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of TJP2 protein CTD PMID:31675489 Tjp2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Tjp2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TJP2 mRNA CTD PMID:20188158 Tjp2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Tjp2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TJP2 mRNA CTD PMID:18648102 Tjp2 Rat 4,4'-sulfonyldiphenol affects expression ISO Tjp2 (Mus musculus) 6480464 bisphenol S affects the expression of TJP2 mRNA CTD PMID:39298647 Tjp2 Rat 4,4'-sulfonyldiphenol increases expression ISO TJP2 (Homo sapiens) 6480464 bisphenol S results in increased expression of TJP2 protein CTD PMID:34186270 Tjp2 Rat 4-hydroxyphenyl retinamide increases expression ISO Tjp2 (Mus musculus) 6480464 Fenretinide results in increased expression of TJP2 mRNA CTD PMID:28973697 Tjp2 Rat 5-aza-2'-deoxycytidine affects expression ISO TJP2 (Homo sapiens) 6480464 Decitabine affects the expression of TJP2 mRNA CTD PMID:23300844 Tjp2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TJP2 mRNA CTD PMID:24780913 Tjp2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TJP2 mRNA CTD PMID:31881176 Tjp2 Rat acrolein multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of TJP2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of TJP2 mRNA CTD PMID:32699268 Tjp2 Rat aflatoxin B1 decreases methylation ISO TJP2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TJP2 gene CTD PMID:27153756 Tjp2 Rat Aflatoxin B2 alpha decreases methylation ISO TJP2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of TJP2 exon CTD PMID:30157460 Tjp2 Rat aldehydo-D-glucose decreases expression ISO Tjp2 (Mus musculus) 6480464 Glucose results in decreased expression of TJP2 protein CTD PMID:27783111 Tjp2 Rat aldehydo-D-glucose multiple interactions ISO Tjp2 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Glucose results in decreased expression of TJP2 protein] more ... CTD PMID:27783111 Tjp2 Rat all-trans-retinoic acid decreases expression ISO TJP2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TJP2 mRNA CTD PMID:23724009 Tjp2 Rat alpha-pinene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of TJP2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of TJP2 mRNA CTD PMID:32699268 Tjp2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TJP2 mRNA CTD PMID:16483693 Tjp2 Rat arsenite(3-) increases expression ISO Tjp2 (Mus musculus) 6480464 arsenite results in increased expression of TJP2 mRNA CTD PMID:18191166 Tjp2 Rat arsenite(3-) decreases expression ISO Tjp2 (Mus musculus) 6480464 arsenite results in decreased expression of TJP2 mRNA CTD PMID:37442281 Tjp2 Rat arsenous acid decreases expression ISO Tjp2 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TJP2 mRNA and Arsenic Trioxide results in decreased expression of TJP2 protein CTD PMID:30032600 more ... Tjp2 Rat arsenous acid decreases expression ISO TJP2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TJP2 mRNA CTD PMID:26705709 Tjp2 Rat Benzo[a]fluorene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat Benzo[a]fluorene increases expression ISO TJP2 (Homo sapiens) 6480464 benzo(a)fluorene results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat benzo[a]pyrene increases expression ISO TJP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TJP2 mRNA CTD PMID:17879257 Tjp2 Rat benzo[a]pyrene decreases methylation ISO Tjp2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TJP2 intron CTD PMID:27901495 Tjp2 Rat benzo[a]pyrene decreases methylation ISO TJP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TJP2 promoter CTD PMID:27901495 Tjp2 Rat benzo[a]pyrene increases methylation ISO TJP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TJP2 5' UTR CTD PMID:27901495 Tjp2 Rat benzo[a]pyrene decreases expression ISO TJP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TJP2 mRNA CTD PMID:21632981 and PMID:31255691 Tjp2 Rat benzo[a]pyrene increases expression ISO Tjp2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TJP2 mRNA CTD PMID:22228805 Tjp2 Rat benzo[a]pyrene decreases expression ISO Tjp2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TJP2 mRNA CTD PMID:19770486 Tjp2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TJP2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tjp2 Rat Benzo[b]fluorene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat Benzo[c]fluorene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat benzo[e]pyrene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat Benzo[ghi]perylene increases expression ISO TJP2 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat Benzo[ghi]perylene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO TJP2 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of TJP2 protein CTD PMID:19845377 Tjp2 Rat bis(2-ethylhexyl) phthalate increases expression ISO TJP2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of TJP2 mRNA CTD PMID:31163220 Tjp2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Tjp2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TJP2 mRNA CTD PMID:36209858 Tjp2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of TJP2 mRNA CTD PMID:26496021 Tjp2 Rat bisphenol A increases expression ISO Tjp2 (Mus musculus) 6480464 bisphenol A results in increased expression of TJP2 mRNA CTD PMID:32156529 Tjp2 Rat bisphenol A decreases expression ISO TJP2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TJP2 protein CTD PMID:31675489 and PMID:37567409 Tjp2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TJP2 gene CTD PMID:28505145 Tjp2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TJP2 mRNA CTD PMID:30816183 Tjp2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TJP2 mRNA CTD PMID:25181051 and PMID:32145629 Tjp2 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of TJP2 mRNA and Butyric Acid results in increased expression of TJP2 protein CTD PMID:15634758 Tjp2 Rat caffeine affects phosphorylation ISO TJP2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TJP2 protein CTD PMID:35688186 Tjp2 Rat calcitriol increases expression ISO TJP2 (Homo sapiens) 6480464 Calcitriol results in increased expression of TJP2 mRNA CTD PMID:26485663 Tjp2 Rat CGP 52608 multiple interactions ISO TJP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TJP2 gene] CTD PMID:28238834 Tjp2 Rat chenodeoxycholic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA more ... CTD PMID:33819548 Tjp2 Rat chlorpyrifos decreases expression ISO Tjp2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TJP2 mRNA CTD PMID:37019170 Tjp2 Rat cisplatin increases expression ISO TJP2 (Homo sapiens) 6480464 Cisplatin results in increased expression of TJP2 mRNA CTD PMID:27594783 Tjp2 Rat cisplatin decreases expression ISO TJP2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of TJP2 mRNA CTD PMID:27392435 Tjp2 Rat cisplatin affects expression ISO TJP2 (Homo sapiens) 6480464 Cisplatin affects the expression of TJP2 mRNA CTD PMID:23300844 Tjp2 Rat cisplatin multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of TJP2 mRNA and Cisplatin inhibits the reaction [Piroxicam results in increased expression of TJP2 mRNA] CTD PMID:21858171 and PMID:27392435 Tjp2 Rat cobalt dichloride decreases expression ISO TJP2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TJP2 mRNA CTD PMID:19320972 Tjp2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of TJP2 mRNA CTD PMID:20187946 Tjp2 Rat corn oil increases expression ISO Tjp2 (Mus musculus) 6480464 Corn Oil results in increased expression of TJP2 mRNA CTD PMID:33263755 Tjp2 Rat coumarin affects phosphorylation ISO TJP2 (Homo sapiens) 6480464 coumarin affects the phosphorylation of TJP2 protein CTD PMID:35688186 Tjp2 Rat cyclosporin A decreases expression ISO TJP2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TJP2 mRNA CTD PMID:20106945 Tjp2 Rat cyclosporin A multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in decreased expression of TJP2 mRNA CTD PMID:33819548 Tjp2 Rat D-glucose multiple interactions ISO Tjp2 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Glucose results in decreased expression of TJP2 protein] more ... CTD PMID:27783111 Tjp2 Rat D-glucose decreases expression ISO Tjp2 (Mus musculus) 6480464 Glucose results in decreased expression of TJP2 protein CTD PMID:27783111 Tjp2 Rat decabromodiphenyl ether decreases expression ISO TJP2 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of TJP2 protein CTD PMID:31675489 Tjp2 Rat deoxycholic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA more ... CTD PMID:33819548 Tjp2 Rat dexamethasone increases expression ISO TJP2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of TJP2 mRNA CTD PMID:25047013 Tjp2 Rat diarsenic trioxide decreases expression ISO Tjp2 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TJP2 mRNA and Arsenic Trioxide results in decreased expression of TJP2 protein CTD PMID:30032600 more ... Tjp2 Rat diarsenic trioxide decreases expression ISO TJP2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TJP2 mRNA CTD PMID:26705709 Tjp2 Rat dibenzo[a,l]pyrene decreases expression ISO TJP2 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in decreased expression of TJP2 mRNA CTD PMID:31255691 Tjp2 Rat Dibutyl phosphate affects expression ISO TJP2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TJP2 mRNA CTD PMID:37042841 Tjp2 Rat dioxygen increases expression ISO Tjp2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TJP2 mRNA CTD PMID:24205000 Tjp2 Rat dorsomorphin multiple interactions ISO TJP2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tjp2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TJP2 mRNA CTD PMID:29391264 and PMID:31464424 Tjp2 Rat ethanol increases expression ISO Tjp2 (Mus musculus) 6480464 Ethanol results in increased expression of TJP2 mRNA CTD PMID:30319688 Tjp2 Rat ethyl methanesulfonate decreases expression ISO TJP2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of TJP2 mRNA CTD PMID:23649840 Tjp2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of TJP2 mRNA CTD PMID:24136188 Tjp2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of TJP2 mRNA CTD PMID:18035473 Tjp2 Rat folic acid multiple interactions ISO Tjp2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TJP2 mRNA CTD PMID:22206623 Tjp2 Rat formaldehyde decreases expression ISO TJP2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TJP2 mRNA CTD PMID:20655997 Tjp2 Rat FR900359 affects phosphorylation ISO TJP2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TJP2 protein CTD PMID:37730182 Tjp2 Rat furfural multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Tjp2 Rat glucose multiple interactions ISO Tjp2 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Glucose results in decreased expression of TJP2 protein] more ... CTD PMID:27783111 Tjp2 Rat glucose decreases expression ISO Tjp2 (Mus musculus) 6480464 Glucose results in decreased expression of TJP2 protein CTD PMID:27783111 Tjp2 Rat glycochenodeoxycholic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA more ... CTD PMID:33819548 Tjp2 Rat glycocholic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA more ... CTD PMID:33819548 Tjp2 Rat glycodeoxycholic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA more ... CTD PMID:33819548 Tjp2 Rat glycyrrhizinic acid multiple interactions ISO Tjp2 (Mus musculus) 6480464 Glycyrrhizic Acid inhibits the reaction [Glucose results in decreased expression of TJP2 protein] and Glycyrrhizic Acid inhibits the reaction [Palmitic Acid results in decreased expression of TJP2 protein] CTD PMID:27689324 and PMID:27783111 Tjp2 Rat hexadecanoic acid multiple interactions ISO Tjp2 (Mus musculus) 6480464 CA 074 methyl ester inhibits the reaction [Palmitic Acid results in decreased expression of TJP2 protein] more ... CTD PMID:27689324 Tjp2 Rat hexadecanoic acid decreases expression ISO Tjp2 (Mus musculus) 6480464 Palmitic Acid results in decreased expression of TJP2 protein CTD PMID:27689324 Tjp2 Rat hydroquinone multiple interactions ISO TJP2 (Homo sapiens) 6480464 PARP1 protein affects the reaction [hydroquinone results in decreased expression of TJP2 mRNA] CTD PMID:28983606 Tjp2 Rat hydroquinone decreases expression ISO TJP2 (Homo sapiens) 6480464 hydroquinone results in decreased expression of TJP2 mRNA CTD PMID:28983606 Tjp2 Rat ivermectin decreases expression ISO TJP2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TJP2 protein CTD PMID:32959892 Tjp2 Rat lead(0) multiple interactions EXP 6480464 [malaoxon co-treated with Lead] results in decreased expression of TJP2 protein and [Malathion co-treated with Lead] results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of TJP2 mRNA CTD PMID:24136188 Tjp2 Rat lipopolysaccharide multiple interactions ISO TJP2 (Homo sapiens) 6480464 [2 more ... CTD PMID:22906770 and PMID:35811015 Tjp2 Rat lipopolysaccharide increases expression ISO TJP2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TJP2 mRNA CTD PMID:35811015 Tjp2 Rat malaoxon decreases expression EXP 6480464 malaoxon results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat malaoxon multiple interactions EXP 6480464 [malaoxon co-treated with Lead] results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat malathion multiple interactions EXP 6480464 [Malathion co-treated with Lead] results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat malathion decreases expression EXP 6480464 Malathion results in decreased expression of TJP2 protein CTD PMID:20970449 Tjp2 Rat menadione affects expression ISO TJP2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of TJP2 mRNA CTD PMID:20044591 Tjp2 Rat mercury dibromide increases expression ISO TJP2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of TJP2 mRNA CTD PMID:26272509 Tjp2 Rat mercury dibromide multiple interactions ISO TJP2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TJP2 mRNA CTD PMID:27188386 Tjp2 Rat methylmercury chloride increases expression ISO TJP2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TJP2 mRNA CTD PMID:28001369 Tjp2 Rat N-acetyl-L-cysteine multiple interactions ISO Tjp2 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Glucose results in decreased expression of TJP2 protein] CTD PMID:27783111 Tjp2 Rat nefazodone multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in decreased expression of TJP2 mRNA CTD PMID:33819548 Tjp2 Rat okadaic acid increases expression ISO TJP2 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of TJP2 mRNA CTD PMID:30926360 Tjp2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TJP2 mRNA CTD PMID:25729387 Tjp2 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of TJP2 mRNA CTD PMID:25729387 Tjp2 Rat ozone multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of TJP2 mRNA more ... CTD PMID:32699268 and PMID:35430440 Tjp2 Rat paracetamol affects expression ISO Tjp2 (Mus musculus) 6480464 Acetaminophen affects the expression of TJP2 mRNA CTD PMID:17562736 Tjp2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TJP2 mRNA CTD PMID:33387578 Tjp2 Rat paracetamol multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of TJP2 mRNA CTD PMID:33819548 Tjp2 Rat paracetamol increases expression ISO TJP2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TJP2 mRNA CTD PMID:21420995 Tjp2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TJP2 mRNA CTD PMID:32680482 Tjp2 Rat perfluorononanoic acid decreases expression ISO TJP2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of TJP2 mRNA CTD PMID:32588087 Tjp2 Rat phenylmercury acetate increases expression ISO TJP2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TJP2 mRNA CTD PMID:26272509 Tjp2 Rat phenylmercury acetate multiple interactions ISO TJP2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TJP2 mRNA CTD PMID:27188386 Tjp2 Rat pirinixic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TJP2 mRNA CTD PMID:19710929 Tjp2 Rat pirinixic acid increases expression ISO Tjp2 (Mus musculus) 6480464 pirinixic acid results in increased expression of TJP2 mRNA CTD PMID:18301758 Tjp2 Rat piroxicam multiple interactions ISO TJP2 (Homo sapiens) 6480464 Cisplatin inhibits the reaction [Piroxicam results in increased expression of TJP2 mRNA] CTD PMID:21858171 Tjp2 Rat piroxicam increases expression ISO TJP2 (Homo sapiens) 6480464 Piroxicam results in increased expression of TJP2 mRNA CTD PMID:21858171 Tjp2 Rat potassium chromate decreases expression ISO TJP2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TJP2 mRNA CTD PMID:22079256 Tjp2 Rat potassium chromate multiple interactions ISO TJP2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TJP2 mRNA CTD PMID:22079256 Tjp2 Rat progesterone multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of TJP2 mRNA CTD PMID:20660070 Tjp2 Rat propiconazole increases expression ISO Tjp2 (Mus musculus) 6480464 propiconazole results in increased expression of TJP2 mRNA CTD PMID:21278054 Tjp2 Rat quercetin decreases expression ISO TJP2 (Homo sapiens) 6480464 Quercetin results in decreased expression of TJP2 mRNA CTD PMID:21632981 Tjp2 Rat quercetin affects phosphorylation ISO TJP2 (Homo sapiens) 6480464 Quercetin affects the phosphorylation of TJP2 protein CTD PMID:35688186 Tjp2 Rat rifampicin decreases expression ISO Tjp2 (Mus musculus) 6480464 Rifampin results in decreased expression of TJP2 mRNA CTD PMID:19577586 Tjp2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TJP2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TJP2 mRNA CTD PMID:35811015 Tjp2 Rat SB 431542 increases expression ISO TJP2 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of TJP2 protein CTD PMID:25670856 Tjp2 Rat SB 431542 multiple interactions ISO TJP2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Tjp2 Rat silicon dioxide decreases expression ISO TJP2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of TJP2 mRNA CTD PMID:25895662 Tjp2 Rat sodium arsenite decreases expression ISO TJP2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TJP2 mRNA CTD PMID:34032870 Tjp2 Rat sodium chloride multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of TJP2 protein CTD PMID:38598786 Tjp2 Rat streptozocin multiple interactions ISO Tjp2 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in decreased expression of TJP2 protein and NLRP3 protein promotes the reaction [[Streptozocin co-treated with Dietary Fats] results in decreased expression of TJP2 protein] CTD PMID:27783111 Tjp2 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of TJP2 mRNA CTD PMID:24136188 Tjp2 Rat sunitinib increases expression ISO TJP2 (Homo sapiens) 6480464 Sunitinib results in increased expression of TJP2 mRNA CTD PMID:31533062 Tjp2 Rat Sunset Yellow FCF multiple interactions ISO TJP2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of TJP2 mRNA CTD PMID:33819548 Tjp2 Rat temozolomide decreases expression ISO TJP2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TJP2 mRNA CTD PMID:31758290 Tjp2 Rat tetrachloromethane increases expression ISO Tjp2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TJP2 mRNA CTD PMID:27339419 and PMID:31919559 Tjp2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TJP2 mRNA CTD PMID:31150632 Tjp2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TJP2 mRNA] CTD PMID:31150632 Tjp2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TJP2 mRNA CTD PMID:23411599 and PMID:34492290 Tjp2 Rat titanium dioxide decreases methylation ISO Tjp2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TJP2 gene CTD PMID:35295148 Tjp2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TJP2 mRNA CTD PMID:25729387 Tjp2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of TJP2 mRNA CTD PMID:25729387 Tjp2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TJP2 gene CTD PMID:27618143 Tjp2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TJP2 mRNA CTD PMID:33387578 Tjp2 Rat trichostatin A increases expression ISO TJP2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TJP2 mRNA CTD PMID:24935251 Tjp2 Rat triclosan increases expression ISO TJP2 (Homo sapiens) 6480464 Triclosan results in increased expression of TJP2 mRNA CTD PMID:34681664 Tjp2 Rat triphenylene multiple interactions ISO TJP2 (Homo sapiens) 6480464 [retene co-treated with benzo(a)fluorene co-treated with benzo(b)fluorene co-treated with benzo(c)fluorene co-treated with triphenylene co-treated with benzo(e)pyrene co-treated with 1 and 12-benzoperylene] results in increased expression of TJP2 mRNA CTD PMID:38673911 Tjp2 Rat valproic acid affects expression ISO TJP2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TJP2 mRNA CTD PMID:25979313 Tjp2 Rat valproic acid increases expression ISO TJP2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TJP2 mRNA CTD PMID:23179753 more ... Tjp2 Rat valproic acid multiple interactions ISO TJP2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TJP2 mRNA CTD PMID:27188386 Tjp2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TJP2 protein CTD PMID:31368504 Tjp2 Rat vorinostat increases expression EXP 6480464 Vorinostat results in increased expression of TJP2 protein CTD PMID:15634758
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) Benzo[a]fluorene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[b]fluorene (ISO) Benzo[c]fluorene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butyric acid (EXP) caffeine (ISO) calcitriol (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (EXP) corn oil (ISO) coumarin (ISO) cyclosporin A (ISO) D-glucose (ISO) decabromodiphenyl ether (ISO) deoxycholic acid (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) finasteride (EXP) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) glucose (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glycyrrhizinic acid (ISO) hexadecanoic acid (ISO) hydroquinone (ISO) ivermectin (ISO) lead(0) (EXP) levofloxacin (EXP) lipopolysaccharide (ISO) malaoxon (EXP) malathion (EXP) menadione (ISO) mercury dibromide (ISO) methylmercury chloride (ISO) N-acetyl-L-cysteine (ISO) nefazodone (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorononanoic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium chromate (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) rifampicin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) streptozocin (ISO) sulindac (EXP) sunitinib (ISO) Sunset Yellow FCF (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenylene (ISO) valproic acid (EXP,ISO) vorinostat (EXP)
1.
A systematic analysis of 40 random genes in cultured vascular smooth muscle subtypes reveals a heterogeneity of gene expression and identifies the tight junction gene zonula occludens 2 as a marker of epithelioid "pup" smooth muscle cells and a participant in carotid neointimal formation.
Adams LD, etal., Arterioscler Thromb Vasc Biol 1999 Nov;19(11):2600-8.
2.
Histone deacetylase inhibitors up-regulate the expression of tight junction proteins.
Bordin M, etal., Mol Cancer Res. 2004 Dec;2(12):692-701.
3.
Complex inheritance of familial hypercholanemia with associated mutations in TJP2 and BAAT.
Carlton VE, etal., Nat Genet 2003 May;34(1):91-6.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Comparative changes in the blood-brain barrier and cerebral infarction of SHR and WKY rats.
Hom S, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Jan 18;.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Connexin 43 interacts with zona occludens-1 and -2 proteins in a cell cycle stage-specific manner.
Singh D, etal., J Biol Chem. 2005 Aug 26;280(34):30416-21. Epub 2005 Jun 26.
Tjp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 231,136,218 - 231,264,750 (-) NCBI GRCr8 mRatBN7.2 1 221,709,745 - 221,838,291 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 221,709,745 - 221,838,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 230,159,462 - 230,287,384 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 237,089,516 - 237,217,442 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 229,907,552 - 230,035,465 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 241,945,816 - 242,084,044 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 241,945,841 - 242,083,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 227,475,386 - 227,574,457 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 227,639,414 - 227,668,771 (-) NCBI Celera 1 218,921,753 - 219,049,897 (-) NCBI Celera Cytogenetic Map 1 q51 NCBI
TJP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 69,121,264 - 69,255,208 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 69,121,264 - 69,274,615 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 71,736,180 - 71,870,124 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 70,978,909 - 71,059,940 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 69,018,642 - 69,099,672 NCBI Celera 9 42,332,221 - 42,460,614 (+) NCBI Celera Cytogenetic Map 9 q21.11 NCBI HuRef 9 41,580,602 - 41,709,784 (+) NCBI HuRef CHM1_1 9 71,882,855 - 72,016,570 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 81,294,639 - 81,423,094 (+) NCBI T2T-CHM13v2.0
Tjp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 24,071,860 - 24,202,492 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 24,071,869 - 24,202,394 (-) Ensembl GRCm39 Ensembl GRCm38 19 24,094,496 - 24,225,128 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 24,094,505 - 24,225,030 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 24,168,992 - 24,299,444 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 24,161,608 - 24,241,085 (-) NCBI MGSCv36 mm8 Celera 19 24,858,437 - 24,990,672 (-) NCBI Celera Cytogenetic Map 19 B NCBI cM Map 19 19.17 NCBI
Tjp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955434 3,781,113 - 3,923,391 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955434 3,781,368 - 3,923,240 (-) NCBI ChiLan1.0 ChiLan1.0
TJP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 68,311,183 - 68,465,150 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 68,317,161 - 68,471,088 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 55,536,627 - 55,690,472 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 67,865,958 - 68,020,569 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 67,886,421 - 68,021,189 (+) Ensembl panpan1.1 panPan2
TJP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 88,126,134 - 88,251,018 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 88,126,136 - 88,230,654 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 88,593,804 - 88,698,045 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 88,673,963 - 88,797,946 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 88,673,965 - 88,778,196 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 88,329,360 - 88,433,088 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 88,035,802 - 88,139,746 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 88,799,691 - 88,904,715 (-) NCBI UU_Cfam_GSD_1.0
Tjp2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 135,633,106 - 135,729,071 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936503 5,497,832 - 5,539,090 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936503 5,414,330 - 5,539,895 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TJP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 222,474,639 - 222,612,983 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 222,474,518 - 222,612,989 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 248,714,644 - 248,883,729 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TJP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 80,224,497 - 80,358,495 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 80,307,380 - 80,358,584 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 68,660,986 - 68,767,811 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tjp2
.
Predicted Target Of
Count of predictions: 118 Count of miRNA genes: 91 Interacting mature miRNAs: 112 Transcripts: ENSRNOT00000065921 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 5508828 Leukc3 Leukocyte quantity QTL 3 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 1 218108584 224054420 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634340 Hcar5 Hepatocarcinoma resistance QTL 5 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 214537555 226660468 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
RH132524
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 221,774,547 - 221,774,744 (+) MAPPER mRatBN7.2 Rnor_6.0 1 242,010,632 - 242,010,828 NCBI Rnor6.0 Rnor_5.0 1 249,289,500 - 249,289,696 UniSTS Rnor5.0 RGSC_v3.4 1 227,540,566 - 227,540,762 UniSTS RGSC3.4 Celera 1 218,986,555 - 218,986,751 UniSTS Cytogenetic Map 1 q51 UniSTS
RH132796
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 221,709,826 - 221,710,014 (+) MAPPER mRatBN7.2 Rnor_6.0 1 241,945,898 - 241,946,085 NCBI Rnor6.0 Rnor_5.0 1 249,224,672 - 249,224,859 UniSTS Rnor5.0 RGSC_v3.4 1 227,475,468 - 227,475,655 UniSTS RGSC3.4 Celera 1 218,921,835 - 218,922,022 UniSTS Cytogenetic Map 1 q51 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065921 ⟹ ENSRNOP00000062549
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 221,709,745 - 221,838,295 (-) Ensembl Rnor_6.0 Ensembl 1 241,945,841 - 242,083,484 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094702 ⟹ ENSRNOP00000095687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 221,709,745 - 221,838,295 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103927 ⟹ ENSRNOP00000096118
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 221,709,745 - 221,788,493 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104406 ⟹ ENSRNOP00000093930
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 221,709,745 - 221,807,388 (-) Ensembl
RefSeq Acc Id:
NM_001414504 ⟹ NP_001401433
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,264,750 (-) NCBI mRatBN7.2 1 221,709,745 - 221,838,291 (-) NCBI
RefSeq Acc Id:
NM_053773 ⟹ NP_446225
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,264,750 (-) NCBI mRatBN7.2 1 221,709,745 - 221,838,291 (-) NCBI Rnor_6.0 1 241,945,816 - 242,083,484 (-) NCBI Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI RGSC_v3.4 1 227,475,386 - 227,574,457 (-) RGD Celera 1 218,921,753 - 219,049,897 (-) RGD
Sequence:
GGTTGAGTCACAACAATACCCAGGAACGGCCGGTGGCGGAGGTCACTGGCTCCCGCCTGCTGGGGCAGCCCGCGGCACTCCGCCTCCGGACAGGCGCTGCTCGCGCTGTGCCGCCGGACGCCGGGGAC
hide sequence
RefSeq Acc Id:
XM_006231176 ⟹ XP_006231238
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,233,664 (-) NCBI mRatBN7.2 1 221,709,745 - 221,807,203 (-) NCBI Rnor_6.0 1 241,945,816 - 242,059,862 (-) NCBI Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI
Sequence:
AACAGAATTGTTTGCAATTAATTAGATTTTGTTGTTGGCCCAAGCAAGCAGTTCATAGCAGAGGTGTATTGCTATAAAATGGCACTGGAATTCCTTCCTTATTTGCCAAAGCTCAGCTTTCCGGGAGG
hide sequence
RefSeq Acc Id:
XM_006231177 ⟹ XP_006231239
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,186,273 (-) NCBI mRatBN7.2 1 221,709,745 - 221,756,516 (-) NCBI Rnor_6.0 1 241,945,816 - 241,992,901 (-) NCBI Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI
Sequence:
TTTTCATTCATGTGCATGTCAGTCTGTGTATGCCACTTGTATTCACGGAGACCTCTGATTCCCTGAACTGGAATCCTATAGGCAGCTGTGGGAATGTGAGTTCTGGAAGTCAAATGGCAGGTCTCTGA
hide sequence
RefSeq Acc Id:
XM_006231178 ⟹ XP_006231240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,214,912 (-) NCBI mRatBN7.2 1 221,709,745 - 221,788,426 (-) NCBI Rnor_6.0 1 241,945,816 - 242,026,725 (-) NCBI Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI
Sequence:
CCCCCCCAGACCGTAACACCATCTTCCCATAATACAACAGAGAGTTCTATATAAAAAAAACACT
hide sequence
RefSeq Acc Id:
XM_006231182 ⟹ XP_006231244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,186,279 (-) NCBI mRatBN7.2 1 221,709,745 - 221,756,522 (-) NCBI Rnor_6.0 1 241,945,816 - 241,992,902 (-) NCBI Rnor_5.0 1 249,224,590 - 249,358,779 (-) NCBI
Sequence:
ATTTTCATTCATGTGCATGTCAGTCTGTGTATGCCACTTGTATTCACGGAGACCTCTGATTCCCTGAACTGGAATCCTATAGGCAGCTGTGGGAATGTGAGTTCTGGAAGTCAAATGGCAGGTCTCTG
hide sequence
RefSeq Acc Id:
XM_039109067 ⟹ XP_038964995
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,214,840 (-) NCBI mRatBN7.2 1 221,709,745 - 221,788,411 (-) NCBI
RefSeq Acc Id:
XM_039109085 ⟹ XP_038965013
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 231,136,218 - 231,214,914 (-) NCBI mRatBN7.2 1 221,709,745 - 221,788,426 (-) NCBI
RefSeq Acc Id:
NP_446225 ⟸ NM_053773
- Peptide Label:
isoform 2
- UniProtKB:
Q3ZB99 (UniProtKB/TrEMBL), E9PTS1 (UniProtKB/TrEMBL), A0A8I6ALD4 (UniProtKB/TrEMBL)
- Sequence:
MEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLQGSPPLSHDDRGFEMMDEFDGRSF
hide sequence
RefSeq Acc Id:
XP_006231238 ⟸ XM_006231176
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6AP88 (UniProtKB/TrEMBL), A0A8I6ALD4 (UniProtKB/TrEMBL)
- Sequence:
MGLYTEKDKMRYKKYMAILEAAVGITPLNKRELLPESRRHVNLWQHPGARSPALLSSPCQWDWH
hide sequence
RefSeq Acc Id:
XP_006231240 ⟸ XM_006231178
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GLX8 (UniProtKB/TrEMBL), A6I0Q0 (UniProtKB/TrEMBL), A0A8I6ALD4 (UniProtKB/TrEMBL)
- Sequence:
MPVRGDRGFPLRRELSGWQRGPGMEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSI
hide sequence
RefSeq Acc Id:
XP_006231244 ⟸ XM_006231182
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6ALD4 (UniProtKB/TrEMBL)
- Sequence:
MRAAQVFQRMWIQAVKKLERWKGHGPGMEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQV
hide sequence
RefSeq Acc Id:
XP_006231239 ⟸ XM_006231177
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ALD4 (UniProtKB/TrEMBL)
- Sequence:
MRAAQVFQRMWIQAVKKLERWKGHGPGMEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENG
hide sequence
Ensembl Acc Id:
ENSRNOP00000062549 ⟸ ENSRNOT00000065921
RefSeq Acc Id:
XP_038965013 ⟸ XM_039109085
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6ALD4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038964995 ⟸ XM_039109067
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ALD4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096118 ⟸ ENSRNOT00000103927
Ensembl Acc Id:
ENSRNOP00000093930 ⟸ ENSRNOT00000104406
Ensembl Acc Id:
ENSRNOP00000095687 ⟸ ENSRNOT00000094702
RefSeq Acc Id:
NP_001401433 ⟸ NM_001414504
- Peptide Label:
isoform 1
- UniProtKB:
A0A8J8Y4W9 (UniProtKB/TrEMBL), A6I0Q1 (UniProtKB/TrEMBL), A0A8I6ALD4 (UniProtKB/TrEMBL)
RGD ID: 13690824 Promoter ID: EPDNEW_R1348 Type: initiation region Name: Tjp2_1 Description: tight junction protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 242,083,480 - 242,083,540 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Tjp2
tight junction protein 2
LOC108349129
uncharacterized LOC108349129
Data merged from RGD:11448097
737654 PROVISIONAL
2016-08-02
LOC108349129
uncharacterized LOC108349129
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-02-26
Tjp2
tight junction protein 2
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Tjp2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
differentially expressed following carotoid injury
631940
