Symbol:
Preb
Name:
prolactin regulatory element binding
RGD ID:
61929
Description:
Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in COPII vesicle coating and positive regulation of transcription by RNA polymerase II. Is active in endoplasmic reticulum membrane. Orthologous to human PREB (prolactin regulatory element binding); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
guanine nucleotide-exchange factor SEC12; mammalian guanine nucleotide exchange factor mSec12; mammalian guanine nucleotide exchange factor Sec12; mSec12; prolactin regulatory element-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 31,138,757 - 31,142,544 (+) NCBI GRCr8 mRatBN7.2 6 25,418,805 - 25,422,594 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 25,418,776 - 25,422,590 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 25,719,124 - 25,722,909 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 26,034,988 - 26,038,773 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 25,514,185 - 25,517,956 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 26,784,088 - 26,787,875 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 26,784,088 - 26,787,874 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 36,599,703 - 36,603,490 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 25,401,759 - 25,405,561 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 25,404,792 - 25,408,499 (+) NCBI Celera 6 24,909,529 - 24,913,316 (+) NCBI Celera Cytogenetic Map 6 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Preb Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PREB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PREB mRNA CTD PMID:22079256 Preb Rat 1,2-dichloroethane increases expression ISO Preb (Mus musculus) 6480464 ethylene dichloride results in increased expression of PREB mRNA CTD PMID:28960355 Preb Rat 1,2-dimethylhydrazine increases expression ISO Preb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PREB mRNA CTD PMID:22206623 Preb Rat 1,2-dimethylhydrazine multiple interactions ISO Preb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PREB mRNA] CTD PMID:22206623 Preb Rat 17alpha-ethynylestradiol increases expression ISO Preb (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PREB mRNA CTD PMID:17942748 Preb Rat 17alpha-ethynylestradiol multiple interactions ISO Preb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PREB mRNA CTD PMID:17942748 Preb Rat 17beta-estradiol increases expression ISO Preb (Mus musculus) 6480464 Estradiol results in increased expression of PREB mRNA CTD PMID:39298647 Preb Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PREB (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PREB mRNA CTD PMID:29581250 Preb Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Preb (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Preb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Preb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PREB mRNA CTD PMID:21570461 and PMID:24058054 Preb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PREB mRNA CTD PMID:33387578 Preb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Preb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PREB mRNA CTD PMID:19770486 Preb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Preb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PREB mRNA CTD PMID:17942748 Preb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PREB mRNA CTD PMID:21346803 Preb Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PREB mRNA CTD PMID:21346803 Preb Rat 2-methylcholine affects expression ISO PREB (Homo sapiens) 6480464 beta-methylcholine affects the expression of PREB mRNA CTD PMID:21179406 Preb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PREB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PREB mRNA CTD PMID:28628672 Preb Rat 4,4'-sulfonyldiphenol multiple interactions ISO PREB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PREB mRNA CTD PMID:28628672 Preb Rat 4,4'-sulfonyldiphenol increases expression ISO Preb (Mus musculus) 6480464 bisphenol S results in increased expression of PREB mRNA CTD PMID:39298647 Preb Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of PREB mRNA CTD PMID:17011747 Preb Rat acrolein multiple interactions ISO PREB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PREB mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PREB mRNA CTD PMID:32699268 Preb Rat acrylamide increases expression ISO Preb (Mus musculus) 6480464 Acrylamide results in increased expression of PREB mRNA CTD PMID:30807115 Preb Rat aflatoxin B1 increases expression ISO Preb (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PREB mRNA CTD PMID:19770486 Preb Rat alpha-pinene multiple interactions ISO PREB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PREB mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PREB mRNA CTD PMID:32699268 Preb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PREB mRNA CTD PMID:16483693 Preb Rat benzo[a]pyrene decreases expression ISO Preb (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PREB mRNA CTD PMID:20127859 Preb Rat bis(2-ethylhexyl) phthalate increases expression ISO Preb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PREB mRNA CTD PMID:34319233 Preb Rat bisphenol A decreases expression ISO PREB (Homo sapiens) 6480464 bisphenol A results in decreased expression of PREB mRNA CTD PMID:25047013 Preb Rat bisphenol A affects expression ISO PREB (Homo sapiens) 6480464 bisphenol A affects the expression of PREB mRNA CTD PMID:30903817 Preb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PREB gene CTD PMID:28505145 Preb Rat Bisphenol B increases expression ISO PREB (Homo sapiens) 6480464 bisphenol B results in increased expression of PREB protein CTD PMID:34186270 Preb Rat bisphenol F increases expression ISO PREB (Homo sapiens) 6480464 bisphenol F results in increased expression of PREB protein CTD PMID:34186270 Preb Rat cadmium atom multiple interactions ISO PREB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PREB mRNA CTD PMID:35301059 Preb Rat cadmium dichloride multiple interactions ISO PREB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PREB mRNA CTD PMID:35301059 Preb Rat chlorpyrifos increases expression ISO Preb (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PREB mRNA CTD PMID:37019170 Preb Rat copper(II) sulfate decreases expression ISO PREB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PREB mRNA CTD PMID:19549813 Preb Rat cyclosporin A increases expression ISO Preb (Mus musculus) 6480464 Cyclosporine results in increased expression of PREB mRNA CTD PMID:19770486 Preb Rat cyclosporin A increases expression ISO PREB (Homo sapiens) 6480464 Cyclosporine results in increased expression of PREB mRNA CTD PMID:20106945 more ... Preb Rat dexamethasone increases expression ISO Preb (Mus musculus) 6480464 Dexamethasone results in increased expression of PREB mRNA CTD PMID:22733784 Preb Rat dexamethasone multiple interactions ISO PREB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PREB mRNA CTD PMID:28628672 Preb Rat Dibutyl phosphate affects expression ISO PREB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PREB mRNA CTD PMID:37042841 Preb Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of PREB mRNA CTD PMID:17011747 Preb Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PREB mRNA CTD PMID:17011747 Preb Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of PREB mRNA CTD PMID:16122865 Preb Rat doxorubicin affects expression ISO PREB (Homo sapiens) 6480464 Doxorubicin affects the expression of PREB mRNA CTD PMID:29803840 Preb Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of PREB mRNA CTD PMID:31464424 Preb Rat epoxiconazole decreases expression ISO Preb (Mus musculus) 6480464 epoxiconazole results in decreased expression of PREB mRNA CTD PMID:35436446 Preb Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PREB mRNA CTD PMID:24136188 Preb Rat folic acid multiple interactions ISO Preb (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PREB mRNA] CTD PMID:22206623 Preb Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PREB mRNA CTD PMID:33387578 Preb Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of PREB mRNA CTD PMID:24136188 Preb Rat indometacin multiple interactions ISO PREB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PREB mRNA CTD PMID:28628672 Preb Rat ivermectin decreases expression ISO PREB (Homo sapiens) 6480464 Ivermectin results in decreased expression of PREB protein CTD PMID:32959892 Preb Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of PREB mRNA CTD PMID:16415329 Preb Rat lipopolysaccharide multiple interactions EXP 6480464 Ranitidine inhibits the reaction [Lipopolysaccharides results in increased expression of PREB mRNA] CTD PMID:16415329 Preb Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 Ranitidine inhibits the reaction [Lipopolysaccharides results in increased expression of PREB mRNA] CTD PMID:16415329 Preb Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PREB mRNA CTD PMID:24136188 Preb Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PREB mRNA CTD PMID:24136188 Preb Rat nitrates multiple interactions ISO Preb (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PREB mRNA CTD PMID:35964746 Preb Rat ochratoxin A decreases expression ISO PREB (Homo sapiens) 6480464 ochratoxin A results in decreased expression of PREB mRNA CTD PMID:19287073 Preb Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PREB mRNA CTD PMID:22124623 Preb Rat ozone multiple interactions ISO PREB (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PREB mRNA more ... CTD PMID:32699268 and PMID:35430440 Preb Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of PREB mRNA CTD PMID:17011747 Preb Rat paracetamol affects expression ISO Preb (Mus musculus) 6480464 Acetaminophen affects the expression of PREB mRNA CTD PMID:17562736 Preb Rat paracetamol decreases expression ISO PREB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PREB mRNA CTD PMID:21420995 Preb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Preb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PREB mRNA CTD PMID:36331819 Preb Rat phenobarbital affects expression ISO Preb (Mus musculus) 6480464 Phenobarbital affects the expression of PREB mRNA CTD PMID:23091169 Preb Rat pirinixic acid multiple interactions ISO PREB (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of PREB mRNA CTD PMID:19710929 Preb Rat potassium chromate decreases expression ISO PREB (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PREB mRNA CTD PMID:22079256 Preb Rat potassium chromate multiple interactions ISO PREB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PREB mRNA CTD PMID:22079256 Preb Rat propiconazole increases expression ISO Preb (Mus musculus) 6480464 propiconazole results in increased expression of PREB mRNA CTD PMID:21278054 Preb Rat ranitidine multiple interactions EXP 6480464 Ranitidine inhibits the reaction [Lipopolysaccharides results in increased expression of PREB mRNA] CTD PMID:16415329 Preb Rat resveratrol increases expression ISO Preb (Mus musculus) 6480464 resveratrol results in increased expression of PREB protein CTD PMID:25505154 Preb Rat silicon dioxide increases expression ISO Preb (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PREB mRNA CTD PMID:23221170 Preb Rat sodium fluoride decreases expression ISO Preb (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PREB protein CTD PMID:28918527 Preb Rat sunitinib increases expression ISO PREB (Homo sapiens) 6480464 Sunitinib results in increased expression of PREB mRNA CTD PMID:31533062 Preb Rat testosterone multiple interactions ISO Preb (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Preb Rat testosterone decreases expression ISO Preb (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of PREB mRNA CTD PMID:33848595 Preb Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PREB mRNA CTD PMID:31150632 Preb Rat tetrachloromethane increases expression ISO Preb (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PREB mRNA CTD PMID:31919559 Preb Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PREB protein CTD PMID:35544339 Preb Rat titanium dioxide increases expression ISO Preb (Mus musculus) 6480464 titanium dioxide results in increased expression of PREB mRNA CTD PMID:23131501 Preb Rat titanium dioxide decreases methylation ISO Preb (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PREB gene CTD PMID:35295148 Preb Rat triptonide affects expression ISO Preb (Mus musculus) 6480464 triptonide affects the expression of PREB mRNA CTD PMID:33045310 Preb Rat trovafloxacin multiple interactions ISO Preb (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of PREB mRNA CTD PMID:18930950 Preb Rat tunicamycin increases expression ISO PREB (Homo sapiens) 6480464 Tunicamycin results in increased expression of PREB mRNA CTD PMID:22378314 Preb Rat valproic acid increases methylation ISO PREB (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PREB gene CTD PMID:29154799 Preb Rat valproic acid increases expression ISO PREB (Homo sapiens) 6480464 Valproic Acid results in increased expression of PREB mRNA CTD PMID:28001369 Preb Rat valproic acid affects expression ISO Preb (Mus musculus) 6480464 Valproic Acid affects the expression of PREB mRNA CTD PMID:17292431 Preb Rat valproic acid affects expression ISO PREB (Homo sapiens) 6480464 Valproic Acid affects the expression of PREB mRNA CTD PMID:25979313 Preb Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PREB mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-tert-Octylphenol (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) ammonium chloride (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP) dimethylarsinic acid (EXP) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) glafenine (EXP) indometacin (ISO) ivermectin (ISO) lipopolysaccharide (EXP) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) ochratoxin A (EXP,ISO) ozone (ISO) p-tert-Amylphenol (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (ISO) ranitidine (EXP) resveratrol (ISO) silicon dioxide (ISO) sodium fluoride (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP) titanium dioxide (ISO) triptonide (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
A functional activating protein 1 (AP-1) site regulates matrix metalloproteinase 2 (MMP-2) transcription by cardiac cells through interactions with JunB-Fra1 and JunB-FosB heterodimers.
Bergman MR, etal., Biochem J 2003 Feb 1;369(Pt 3):485-96.
2.
Expression cloning and characterization of PREB (prolactin regulatory element binding), a novel WD motif DNA-binding protein with a capacity to regulate prolactin promoter activity.
Fliss MS, etal., Mol Endocrinol 1999 Apr;13(4):644-57.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
10.
The mammalian guanine nucleotide exchange factor mSec12 is essential for activation of the Sar1 GTPase directing endoplasmic reticulum export.
Weissman JT, etal., Traffic. 2001 Jul;2(7):465-75.
Preb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 31,138,757 - 31,142,544 (+) NCBI GRCr8 mRatBN7.2 6 25,418,805 - 25,422,594 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 25,418,776 - 25,422,590 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 25,719,124 - 25,722,909 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 26,034,988 - 26,038,773 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 25,514,185 - 25,517,956 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 26,784,088 - 26,787,875 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 26,784,088 - 26,787,874 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 36,599,703 - 36,603,490 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 25,401,759 - 25,405,561 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 25,404,792 - 25,408,499 (+) NCBI Celera 6 24,909,529 - 24,913,316 (+) NCBI Celera Cytogenetic Map 6 q14 NCBI
PREB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 27,130,756 - 27,134,636 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 27,130,756 - 27,134,666 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 27,353,624 - 27,357,504 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 27,207,128 - 27,211,046 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 27,265,277 - 27,269,193 NCBI Celera 2 27,199,929 - 27,203,847 (-) NCBI Celera Cytogenetic Map 2 p23.3 NCBI HuRef 2 27,095,474 - 27,099,392 (-) NCBI HuRef CHM1_1 2 27,283,548 - 27,287,466 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 27,172,401 - 27,176,281 (-) NCBI T2T-CHM13v2.0
Preb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 31,109,011 - 31,117,700 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 31,108,197 - 31,117,705 (-) Ensembl GRCm39 Ensembl GRCm38 5 30,951,667 - 30,960,356 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 30,950,853 - 30,960,361 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 31,254,040 - 31,262,734 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 31,231,629 - 31,236,816 (-) NCBI MGSCv36 mm8 Celera 5 28,431,460 - 28,439,754 (-) NCBI Celera Cytogenetic Map 5 B1 NCBI cM Map 5 16.9 NCBI
Preb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955469 9,098,124 - 9,101,408 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955469 9,097,579 - 9,101,361 (-) NCBI ChiLan1.0 ChiLan1.0
PREB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 99,380,869 - 99,384,810 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 99,384,837 - 99,388,771 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 27,129,731 - 27,133,645 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 27,218,957 - 27,222,876 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 27,218,957 - 27,222,876 (-) Ensembl panpan1.1 panPan2
PREB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 21,116,427 - 21,120,250 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 21,117,020 - 21,120,031 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 21,008,243 - 21,012,112 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 21,437,125 - 21,440,994 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 21,437,139 - 21,440,962 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 21,123,848 - 21,127,717 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 21,134,959 - 21,138,828 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 21,181,808 - 21,185,678 (-) NCBI UU_Cfam_GSD_1.0
Preb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 65,419,425 - 65,423,263 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936493 5,415,971 - 5,420,138 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936493 5,416,302 - 5,420,138 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PREB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 111,992,391 - 111,996,559 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 111,992,364 - 111,996,194 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 118,990,851 - 118,994,672 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PREB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 80,485,178 - 80,489,081 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 80,485,252 - 80,488,438 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 31,650,124 - 31,654,028 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Preb
.
Predicted Target Of
Count of predictions: 107 Count of miRNA genes: 87 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000009565 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1359023 Bp272 Blood pressure QTL 272 2.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 16536140 27261739 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat
RH136976
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 25,422,403 - 25,422,554 (+) MAPPER mRatBN7.2 Rnor_6.0 6 26,787,685 - 26,787,835 NCBI Rnor6.0 Rnor_5.0 6 36,603,300 - 36,603,450 UniSTS Rnor5.0 RGSC_v3.4 6 25,405,371 - 25,405,521 UniSTS RGSC3.4 Celera 6 24,913,126 - 24,913,276 UniSTS RH 3.4 Map 6 92.7 UniSTS Cytogenetic Map 6 q14 UniSTS
AI547393
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 25,419,413 - 25,419,504 (+) MAPPER mRatBN7.2 Rnor_6.0 6 26,784,697 - 26,784,787 NCBI Rnor6.0 Rnor_5.0 6 36,600,312 - 36,600,402 UniSTS Rnor5.0 RGSC_v3.4 6 25,402,383 - 25,402,473 UniSTS RGSC3.4 Celera 6 24,910,138 - 24,910,228 UniSTS
MARC_49992-49993:1124119588:2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 31,141,236 - 31,141,595 (+) Marker Load Pipeline mRatBN7.2 6 25,421,284 - 25,421,642 (+) MAPPER mRatBN7.2 Rnor_6.0 6 26,786,568 - 26,786,925 NCBI Rnor6.0 Rnor_5.0 6 36,602,183 - 36,602,540 UniSTS Rnor5.0 RGSC_v3.4 6 25,404,254 - 25,404,611 UniSTS RGSC3.4 Celera 6 24,912,009 - 24,912,366 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
38
94
64
60
48
6
48
6
144
56
82
34
49
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009565 ⟹ ENSRNOP00000009566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 25,418,776 - 25,422,590 (+) Ensembl Rnor_6.0 Ensembl 6 26,784,088 - 26,787,874 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095902 ⟹ ENSRNOP00000084097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 25,418,776 - 25,422,590 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114417 ⟹ ENSRNOP00000087994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 25,418,776 - 25,421,985 (+) Ensembl
RefSeq Acc Id:
NM_001170708 ⟹ NP_001164179
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 31,138,757 - 31,142,544 (+) NCBI mRatBN7.2 6 25,418,805 - 25,422,594 (+) NCBI Rnor_6.0 6 26,784,088 - 26,787,875 (+) NCBI Rnor_5.0 6 36,599,703 - 36,603,490 (+) NCBI Celera 6 24,909,529 - 24,913,316 (+) NCBI
Sequence:
CGCGCGAGCGCAGATCGGCTACCTGCGGTGATTAGAGTGGTGGCAAATCCACAGTGCTGAGAGGGGTCGCCAGTCTTCCGGGAAACTGTAGCACCAAGTTCCGCAGCTTTTGGAGGCGGGGCGCGGCA
hide sequence
RefSeq Acc Id:
NP_001164179 ⟸ NM_001170708
- UniProtKB:
Q6AYS1 (UniProtKB/Swiss-Prot), Q9WTV0 (UniProtKB/Swiss-Prot), A6HAA1 (UniProtKB/TrEMBL), G3V6W2 (UniProtKB/TrEMBL)
- Sequence:
MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEQISGCLSASLLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQIHQQKGSKAEKSGSKEQGPRQRKGAAPAEKKS
hide sequence
Ensembl Acc Id:
ENSRNOP00000009566 ⟸ ENSRNOT00000009565
Ensembl Acc Id:
ENSRNOP00000087994 ⟸ ENSRNOT00000114417
Ensembl Acc Id:
ENSRNOP00000084097 ⟸ ENSRNOT00000095902
RGD ID: 13694452 Promoter ID: EPDNEW_R4974 Type: initiation region Name: Preb_1 Description: prolactin regulatory element binding SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 26,784,097 - 26,784,157 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Preb
prolactin regulatory element binding
prolactin regulatory element binding
Name updated
1299863 APPROVED
2002-06-10
Preb
prolactin regulatory element binding
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
contains three WD repeats
61705
gene_process
mediates both basal and PKA-activated expression of the prolactin (PRL) promoter in pituitary cells
61705
gene_protein
417 amino acids
61705
