Symbol:
Oprd1
Name:
opioid receptor, delta 1
RGD ID:
3233
Description:
Enables G protein-coupled enkephalin receptor activity and receptor serine/threonine kinase binding activity. Involved in several processes, including eating behavior; response to ethanol; and response to nicotine. Located in several cellular components, including axon terminus; dendrite membrane; and postsynaptic membrane. Is active in secretory vesicle; spine apparatus; and synaptic membrane. Used to study alcohol use disorder and myocardial infarction. Biomarker of alcohol use disorder. Human ortholog(s) of this gene implicated in alcohol dependence; alcohol use disorder; drug dependence (multiple); opioid abuse; and withdrawal disorder. Orthologous to human OPRD1 (opioid receptor delta 1); INTERACTS WITH (D-Ala(2)-mephe(4)-gly-ol(5))enkephalin; (R)-noradrenaline; (R,R)-tramadol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
D-OR-1; delta-type opioid receptor; DOR-1; opioid receptor A; Opioid receptor delta 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OPRD1 (opioid receptor delta 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Oprd1 (opioid receptor, delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Oprd1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OPRD1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OPRD1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Oprd1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OPRD1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OPRD1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Oprd1 (opioid receptor delta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NAPSA (napsin A aspartic peptidase) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Oprd1 (opioid receptor, delta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OPRD1 (opioid receptor delta 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
oprd1a (opioid receptor, delta 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
oprd1b (opioid receptor, delta 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
AstC-R1
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
npr-16
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
npr-24
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
AstC-R2
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 149,590,244 - 149,624,999 (-) NCBI GRCr8 mRatBN7.2 5 144,306,188 - 144,340,960 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,306,188 - 144,340,960 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,005,532 - 147,040,056 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 148,775,378 - 148,809,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 148,764,406 - 148,799,337 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,288,126 - 150,323,063 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,288,126 - 150,323,063 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 153,962,767 - 153,997,858 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 150,979,252 - 151,014,066 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 150,989,290 - 151,024,105 (-) NCBI Celera 5 142,741,006 - 142,775,820 (-) NCBI Celera RH 3.4 Map 5 965.9 RGD Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Oprd1 Rat (D-Ala(2)-mephe(4)-gly-ol(5))enkephalin multiple interactions EXP 6480464 Magnesium promotes the reaction [Enkephalin more ... CTD PMID:2162496 Oprd1 Rat (D-Ala(2)-mephe(4)-gly-ol(5))enkephalin affects binding EXP 6480464 Enkephalin and Ala(2)-MePhe(4)-Gly(5)- binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat (R)-noradrenaline multiple interactions EXP 6480464 [dextrallorphan binds to OPRD1 protein] which results in decreased uptake of Norepinephrine more ... CTD PMID:7562497 Oprd1 Rat (R,R)-tramadol affects binding EXP 6480464 Tramadol binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat (R,R)-tramadol multiple interactions EXP 6480464 [Tramadol binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Tramadol binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat (S)-amphetamine affects expression EXP 6480464 Dextroamphetamine affects the expression of OPRD1 mRNA CTD PMID:12629526 Oprd1 Rat (S)-nicotine multiple interactions ISO Oprd1 (Mus musculus) 6480464 [naltrindole binds to and results in decreased activity of OPRD1 protein] which results in increased susceptibility to Nicotine CTD PMID:15778877 Oprd1 Rat 1,2-dichloroethane increases expression ISO Oprd1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of OPRD1 mRNA CTD PMID:28960355 Oprd1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of OPRD1 mRNA CTD PMID:15212814 Oprd1 Rat 17beta-estradiol increases expression ISO OPRD1 (Homo sapiens) 6480464 Estradiol results in increased expression of OPRD1 mRNA CTD PMID:31614463 Oprd1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Oprd1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Oprd1 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions EXP 6480464 Mesalamine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of OPRD1 mRNA] more ... CTD PMID:24637189 Oprd1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of OPRD1 mRNA and Trinitrobenzenesulfonic Acid results in increased expression of OPRD1 protein CTD PMID:24637189 Oprd1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Oprd1 (Mus musculus) 6480464 bisphenol S results in increased methylation of OPRD1 exon CTD PMID:33297965 Oprd1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Oprd1 (Mus musculus) 6480464 bisphenol S affects the methylation of OPRD1 gene CTD PMID:31683443 Oprd1 Rat 7-Hydroxymitragynine multiple interactions ISO Oprd1 (Mus musculus) 6480464 7-hydroxymitragynine binds to and affects the activity of OPRD1 protein CTD PMID:27192616 Oprd1 Rat 7-Hydroxymitragynine multiple interactions ISO OPRD1 (Homo sapiens) 6480464 7-hydroxymitragynine affects the reaction [Enkephalin more ... CTD PMID:27192616 Oprd1 Rat acetylmethadol multiple interactions EXP 6480464 [Methadyl Acetate binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Methadyl Acetate binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat acetylmethadol affects binding EXP 6480464 Methadyl Acetate binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat acrylamide decreases expression ISO OPRD1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of OPRD1 mRNA CTD PMID:37210002 Oprd1 Rat all-trans-retinoic acid multiple interactions ISO Oprd1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of OPRD1 mRNA CTD PMID:36189433 Oprd1 Rat aluminium atom multiple interactions EXP 6480464 [Enkephalin more ... CTD PMID:7477890 Oprd1 Rat aluminium(0) multiple interactions EXP 6480464 [Enkephalin more ... CTD PMID:7477890 Oprd1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of OPRD1 mRNA CTD PMID:16483693 Oprd1 Rat arsenite(3-) increases expression ISO Oprd1 (Mus musculus) 6480464 arsenite results in increased expression of OPRD1 mRNA CTD PMID:33053406 Oprd1 Rat Azoxymethane multiple interactions ISO Oprd1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OPRD1 mRNA CTD PMID:29950665 Oprd1 Rat benzo[a]pyrene affects expression ISO Oprd1 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of OPRD1 mRNA CTD PMID:20127859 Oprd1 Rat benzo[a]pyrene affects methylation ISO OPRD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of OPRD1 exon more ... CTD PMID:27901495 and PMID:30157460 Oprd1 Rat benzo[a]pyrene increases methylation ISO OPRD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of OPRD1 3' UTR CTD PMID:27901495 Oprd1 Rat bisphenol A decreases methylation ISO OPRD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of OPRD1 gene CTD PMID:31601247 Oprd1 Rat buprenorphine affects binding EXP 6480464 Buprenorphine binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat buprenorphine multiple interactions ISO OPRD1 (Homo sapiens) 6480464 Buprenorphine inhibits the reaction [Enkephalin more ... CTD PMID:21866885 Oprd1 Rat butorphanol affects activity EXP 6480464 Butorphanol affects the activity of OPRD1 protein CTD PMID:17909753 Oprd1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of OPRD1 mRNA CTD PMID:19167457 Oprd1 Rat cadmium atom multiple interactions EXP 6480464 Cadmium inhibits the reaction [enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein] CTD PMID:2162496 Oprd1 Rat cannabidiol multiple interactions EXP 6480464 Cannabidiol inhibits the reaction [naltrindole binds to and results in decreased activity of OPRD1 protein] CTD PMID:16489449 Oprd1 Rat CGP 52608 multiple interactions ISO OPRD1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to OPRD1 gene] CTD PMID:28238834 Oprd1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of OPRD1 mRNA CTD PMID:20682304 Oprd1 Rat clofibrate decreases expression ISO Oprd1 (Mus musculus) 6480464 Clofibrate results in decreased expression of OPRD1 mRNA CTD PMID:17585979 Oprd1 Rat cocaine affects localization EXP 6480464 Cocaine affects the localization of OPRD1 protein CTD PMID:18417105 Oprd1 Rat cocaine multiple interactions EXP 6480464 [Enkephalin more ... CTD PMID:19279569 Oprd1 Rat codeine affects binding EXP 6480464 Codeine binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat copper atom multiple interactions EXP 6480464 Copper inhibits the reaction [enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein] CTD PMID:2162496 Oprd1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of OPRD1 mRNA CTD PMID:26033743 Oprd1 Rat copper(0) multiple interactions EXP 6480464 Copper inhibits the reaction [enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein] CTD PMID:2162496 Oprd1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of OPRD1 mRNA CTD PMID:26033743 Oprd1 Rat Deltorphin B multiple interactions EXP 6480464 deltorphin II and Ala(2)- analog binds to and results in increased activity of OPRD1 protein CTD PMID:10753473 Oprd1 Rat dextran sulfate multiple interactions ISO Oprd1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OPRD1 mRNA CTD PMID:29950665 Oprd1 Rat dextromethorphan multiple interactions EXP 6480464 [Dextromethorphan binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Dextromethorphan binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat dextromethorphan affects binding EXP 6480464 Dextromethorphan binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat dextropropoxyphene multiple interactions EXP 6480464 [Dextropropoxyphene binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Dextropropoxyphene binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat dextropropoxyphene affects binding EXP 6480464 Dextropropoxyphene binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat dextrorphan affects binding EXP 6480464 Dextrorphan binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat dextrorphan multiple interactions EXP 6480464 [Dextrorphan binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Dextrorphan binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of OPRD1 mRNA CTD PMID:15620428 Oprd1 Rat DPDPE multiple interactions EXP 6480464 [Enkephalin more ... CTD PMID:19279569 and PMID:7477890 Oprd1 Rat DPDPE multiple interactions ISO OPRD1 (Homo sapiens) 6480464 7-hydroxymitragynine affects the reaction [Enkephalin more ... CTD PMID:21866885 and PMID:27192616 Oprd1 Rat DPDPE affects binding ISO OPRD1 (Homo sapiens) 6480464 Enkephalin more ... CTD PMID:21866885 Oprd1 Rat DPDPE affects binding EXP 6480464 Enkephalin more ... CTD PMID:7562497 Oprd1 Rat DPDPE increases expression EXP 6480464 Enkephalin more ... CTD PMID:9302088 Oprd1 Rat DSLET multiple interactions EXP 6480464 Cadmium inhibits the reaction [enkephalin more ... CTD PMID:2162496 Oprd1 Rat DSLET affects binding EXP 6480464 enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein CTD PMID:2162496 Oprd1 Rat dynorphin A increases activity ISO OPRD1 (Homo sapiens) 6480464 Dynorphins results in increased activity of OPRD1 protein CTD PMID:26476280 Oprd1 Rat eluxadoline affects response to substance ISO Oprd1 (Mus musculus) 6480464 OPRD1 protein affects the susceptibility to eluxadoline CTD PMID:25261794 Oprd1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of OPRD1 mRNA CTD PMID:31464424 Oprd1 Rat ethanol increases expression ISO Oprd1 (Mus musculus) 6480464 Ethanol results in increased expression of OPRD1 mRNA CTD PMID:30319688 Oprd1 Rat ethylparaben decreases expression ISO OPRD1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of OPRD1 mRNA CTD PMID:37690743 Oprd1 Rat fentanyl affects binding EXP 6480464 Fentanyl binds to OPRD1 protein CTD PMID:35477798 Oprd1 Rat hydralazine multiple interactions ISO OPRD1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in decreased expression of OPRD1 mRNA CTD PMID:17183730 Oprd1 Rat hydrocodone affects binding EXP 6480464 Hydrocodone binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat Leu-enkephalin increases activity ISO OPRD1 (Homo sapiens) 6480464 Enkephalin and Leucine results in increased activity of OPRD1 protein CTD PMID:26476280 Oprd1 Rat Levallorphan affects binding EXP 6480464 Levallorphan binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat Levallorphan multiple interactions EXP 6480464 [Levallorphan binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Levallorphan binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat Levorphanol affects binding EXP 6480464 Levorphanol binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat Levorphanol multiple interactions EXP 6480464 [Levorphanol binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Levorphanol binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat lipopolysaccharide multiple interactions ISO OPRD1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of OPRD1 mRNA CTD PMID:35811015 Oprd1 Rat loperamide affects response to substance ISO Oprd1 (Mus musculus) 6480464 OPRD1 protein affects the susceptibility to Loperamide CTD PMID:25261794 Oprd1 Rat magnesium atom multiple interactions EXP 6480464 Magnesium promotes the reaction [Enkephalin more ... CTD PMID:2162496 Oprd1 Rat manganese atom multiple interactions EXP 6480464 Manganese promotes the reaction [Enkephalin more ... CTD PMID:2162496 Oprd1 Rat manganese(0) multiple interactions EXP 6480464 Manganese promotes the reaction [Enkephalin more ... CTD PMID:2162496 Oprd1 Rat mercury atom multiple interactions EXP 6480464 Mercury inhibits the reaction [enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein] CTD PMID:2162496 Oprd1 Rat mercury(0) multiple interactions EXP 6480464 Mercury inhibits the reaction [enkephalin and Ser(2), Leu(5), Thr(6)- binds to OPRD1 protein] CTD PMID:2162496 Oprd1 Rat mesalamine multiple interactions EXP 6480464 Mesalamine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of OPRD1 mRNA] and Mesalamine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of OPRD1 protein] CTD PMID:24637189 Oprd1 Rat methadone affects binding EXP 6480464 Methadone binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat methadone multiple interactions EXP 6480464 [Methadone binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Methadone binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat methylmercury chloride decreases expression ISO OPRD1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of OPRD1 mRNA CTD PMID:37210002 Oprd1 Rat Mitragynine affects binding ISO Oprd1 (Mus musculus) 6480464 mitragynine binds to OPRD1 protein CTD PMID:27192616 Oprd1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Oprd1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of OPRD1 mRNA CTD PMID:36189433 Oprd1 Rat morphine multiple interactions ISO OPRD1 (Homo sapiens) 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein] more ... CTD PMID:21600884 Oprd1 Rat morphine multiple interactions EXP 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein] more ... CTD PMID:21600884 Oprd1 Rat morphine affects binding EXP 6480464 Morphine binds to OPRD1 protein CTD PMID:35477798 and PMID:7562497 Oprd1 Rat morphine increases expression EXP 6480464 Morphine results in increased expression of OPRD1 protein CTD PMID:21600884 Oprd1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein]] CTD PMID:21600884 Oprd1 Rat naloxone affects binding EXP 6480464 Naloxone binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat naltrexone affects binding EXP 6480464 Naltrexone binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat Naltrindole multiple interactions EXP 6480464 [naltrindole binds to and results in decreased activity of OPRD1 protein] which results in decreased susceptibility to 3-(difluoromethyl)-1-(4-methoxyphenyl)-5-(4-(methylsulfinyl)phenyl)pyrazole more ... CTD PMID:12962910 more ... Oprd1 Rat Naltrindole multiple interactions ISO Oprd1 (Mus musculus) 6480464 [naltrindole binds to and results in decreased activity of OPRD1 protein] which results in increased susceptibility to Nicotine CTD PMID:15778877 Oprd1 Rat nicotine multiple interactions ISO Oprd1 (Mus musculus) 6480464 [naltrindole binds to and results in decreased activity of OPRD1 protein] which results in increased susceptibility to Nicotine CTD PMID:15778877 Oprd1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of OPRD1 mRNA CTD PMID:15620428 Oprd1 Rat oxycodone affects binding EXP 6480464 Oxycodone binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat paraquat decreases expression ISO OPRD1 (Homo sapiens) 6480464 Paraquat results in decreased expression of OPRD1 mRNA CTD PMID:26498265 Oprd1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of OPRD1 mRNA CTD PMID:30047161 Oprd1 Rat resveratrol multiple interactions ISO OPRD1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of OPRD1 mRNA CTD PMID:23557933 Oprd1 Rat rotenone decreases expression ISO Oprd1 (Mus musculus) 6480464 Rotenone results in decreased expression of OPRD1 mRNA CTD PMID:35919817 Oprd1 Rat rotenone decreases expression ISO OPRD1 (Homo sapiens) 6480464 Rotenone results in decreased expression of OPRD1 mRNA CTD PMID:37210002 Oprd1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO OPRD1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of OPRD1 mRNA CTD PMID:35811015 Oprd1 Rat serotonin multiple interactions EXP 6480464 [dextrallorphan binds to OPRD1 protein] which results in decreased uptake of Serotonin more ... CTD PMID:7562497 Oprd1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of OPRD1 mRNA CTD PMID:30047161 Oprd1 Rat tapentadol affects binding EXP 6480464 tapentadol binds to OPRD1 protein CTD PMID:17656655 Oprd1 Rat thioglycolic acid affects response to substance EXP 6480464 OPRD1 exon affects the susceptibility to 2-mercaptoacetate CTD PMID:10802031 Oprd1 Rat titanium dioxide multiple interactions ISO Oprd1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of OPRD1 mRNA CTD PMID:29950665 Oprd1 Rat titanium dioxide increases expression ISO Oprd1 (Mus musculus) 6480464 titanium dioxide results in increased expression of OPRD1 mRNA CTD PMID:35295148 Oprd1 Rat titanium dioxide decreases methylation ISO Oprd1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of OPRD1 gene CTD PMID:35295148 Oprd1 Rat tramadol affects binding EXP 6480464 Tramadol binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat tramadol multiple interactions EXP 6480464 [Tramadol binds to OPRD1 protein] which results in decreased uptake of Norepinephrine and [Tramadol binds to OPRD1 protein] which results in decreased uptake of Serotonin CTD PMID:7562497 Oprd1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of OPRD1 mRNA CTD PMID:33387578 Oprd1 Rat triptonide increases expression ISO Oprd1 (Mus musculus) 6480464 triptonide results in increased expression of OPRD1 mRNA CTD PMID:33045310 Oprd1 Rat U69593 affects binding EXP 6480464 U 69593 binds to OPRD1 protein CTD PMID:7562497 Oprd1 Rat valproic acid multiple interactions ISO OPRD1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in decreased expression of OPRD1 mRNA CTD PMID:17183730 Oprd1 Rat valproic acid increases methylation ISO OPRD1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of OPRD1 gene CTD PMID:29154799 Oprd1 Rat valproic acid affects expression ISO Oprd1 (Mus musculus) 6480464 Valproic Acid affects the expression of OPRD1 mRNA CTD PMID:17963808 Oprd1 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Magnesium promotes the reaction [Enkephalin more ... CTD PMID:2162496 Oprd1 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Magnesium promotes the reaction [Enkephalin more ... CTD PMID:2162496
(D-Ala(2)-mephe(4)-gly-ol(5))enkephalin (EXP) (R)-noradrenaline (EXP) (R,R)-tramadol (EXP) (S)-amphetamine (EXP) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 4,4'-sulfonyldiphenol (ISO) 7-Hydroxymitragynine (ISO) acetylmethadol (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) aluminium atom (EXP) aluminium(0) (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) buprenorphine (EXP,ISO) butorphanol (EXP) C60 fullerene (EXP) cadmium atom (EXP) cannabidiol (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) clofibrate (ISO) cocaine (EXP) codeine (EXP) copper atom (EXP) copper(0) (EXP) Deltorphin B (EXP) dextran sulfate (ISO) dextromethorphan (EXP) dextropropoxyphene (EXP) dextrorphan (EXP) dibutyl phthalate (EXP) DPDPE (EXP,ISO) DSLET (EXP) dynorphin A (ISO) eluxadoline (ISO) endosulfan (EXP) ethanol (ISO) ethylparaben (ISO) fentanyl (EXP) hydralazine (ISO) hydrocodone (EXP) Leu-enkephalin (ISO) Levallorphan (EXP) Levorphanol (EXP) lipopolysaccharide (ISO) loperamide (ISO) magnesium atom (EXP) manganese atom (EXP) manganese(0) (EXP) mercury atom (EXP) mercury(0) (EXP) mesalamine (EXP) methadone (EXP) methylmercury chloride (ISO) Mitragynine (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (EXP,ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) naloxone (EXP) naltrexone (EXP) Naltrindole (EXP,ISO) nicotine (ISO) Nonylphenol (EXP) oxycodone (EXP) paraquat (ISO) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) serotonin (EXP) sulfadimethoxine (EXP) tapentadol (EXP) thioglycolic acid (EXP) titanium dioxide (ISO) tramadol (EXP) trichloroethene (EXP) triptonide (ISO) U69593 (EXP) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP)
Biological Process
adenylate cyclase-activating dopamine receptor signaling pathway (ISO) adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO) adult locomotory behavior (IEA,ISO) cellular response to growth factor stimulus (IEP) cellular response to hypoxia (IEA,ISO) cellular response to toxic substance (IEA,ISO) eating behavior (IMP) G protein-coupled opioid receptor signaling pathway (IBA,IEA,ISO) G protein-coupled receptor signaling pathway (IEA,ISO) negative regulation of gene expression (IEA,ISO) negative regulation of protein-containing complex assembly (IEA,ISO) neuropeptide signaling pathway (IBA,IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IDA) regulation of calcium ion transport (IMP) regulation of mitochondrial membrane potential (IEA,ISO) response to ethanol (IEP) response to nicotine (IEP) signal transduction (IEA)
1.
Characterization of a delta opioid receptor in rat pheochromocytoma cells.
Abood ME and Tao Q, J Pharmacol Exp Ther. 1995 Sep;274(3):1566-73.
2.
Molecular cloning and expression of a delta-opioid receptor from rat brain.
Abood ME, etal., J Neurosci Res. 1994 Apr 15;37(6):714-9.
3.
delta opioid receptor modulation of several voltage-dependent Ca(2+) currents in rat sensory neurons.
Acosta CG and Lopez HS, J Neurosci. 1999 Oct 1;19(19):8337-48.
4.
Association of polymorphisms in pharmacogenetic candidate genes (OPRD1, GAL, ABCB1, OPRM1) with opioid dependence in European population: a case-control study.
Beer B, etal., PLoS One. 2013 Sep 25;8(9):e75359. doi: 10.1371/journal.pone.0075359. eCollection 2013.
5.
Identification of a signaling cascade that maintains constitutive d-opioid receptor incompetence in peripheral sensory neurons.
Brackley AD, etal., J Biol Chem. 2017 May 26;292(21):8762-8772. doi: 10.1074/jbc.M117.776799. Epub 2017 Apr 5.
6.
Coexpression of delta-opioid receptors with micro receptors in GH3 cells changes the functional response to micro agonists from inhibitory to excitatory.
Charles AC, etal., Mol Pharmacol 2003 Jan;63(1):89-95.
7.
Ultrastructural immunolabeling shows prominent presynaptic vesicular localization of delta-opioid receptor within both enkephalin- and nonenkephalin-containing axon terminals in the superficial layers of the rat cervical spinal cord.
Cheng PY, etal., J Neurosci. 1995 Sep;15(9):5976-88.
8.
Genetic variation in OPRD1 and the response to treatment for opioid dependence with buprenorphine in European-American females.
Clarke TK, etal., Pharmacogenomics J. 2014 Jun;14(3):303-8. doi: 10.1038/tpj.2013.30. Epub 2013 Oct 15.
9.
Case-control association analysis of polymorphisms in the δ-opioid receptor, OPRD1, with cocaine and opioid addicted populations.
Crist RC, etal., Drug Alcohol Depend. 2013 Jan 1;127(1-3):122-8. doi: 10.1016/j.drugalcdep.2012.06.023. Epub 2012 Jul 12.
10.
A delta-opioid receptor genetic variant is associated with abstinence prior to and during cocaine dependence treatment.
Crist RC, etal., Drug Alcohol Depend. 2016 Sep 1;166:268-71. doi: 10.1016/j.drugalcdep.2016.07.008. Epub 2016 Jul 14.
11.
An intronic variant in OPRD1 predicts treatment outcome for opioid dependence in African-Americans.
Crist RC, etal., Neuropsychopharmacology. 2013 Sep;38(10):2003-10. doi: 10.1038/npp.2013.99. Epub 2013 Apr 23.
12.
Genetic polymorphisms in the opioid receptor delta 1 (OPRD1) gene are associated with methadone dose in methadone maintenance treatment for heroin dependence.
Fang CP, etal., J Hum Genet. 2020 Apr;65(4):381-386. doi: 10.1038/s10038-019-0718-x. Epub 2020 Jan 7.
13.
Opioid-induced cardioprotection against myocardial infarction and arrhythmias: mitochondrial versus sarcolemmal ATP-sensitive potassium channels.
Fryer RM, etal., J Pharmacol Exp Ther. 2000 Aug;294(2):451-7.
14.
Primary structures and expression from cDNAs of rat opioid receptor delta- and mu-subtypes.
Fukuda K, etal., FEBS Lett 1993 Aug 2;327(3):311-4.
15.
Contribution of Genetic Polymorphisms and Haplotypes in DRD2, BDNF, and Opioid Receptors to Heroin Dependence and Endophenotypes Among the Han Chinese.
Gao X, etal., OMICS. 2017 Jul;21(7):404-412. doi: 10.1089/omi.2017.0057.
16.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
17.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
18.
The expression of opioid genes in non-classical reward areas depends on early life conditions and ethanol intake.
Granholm L, etal., Brain Res. 2017 Aug 1;1668:36-45. doi: 10.1016/j.brainres.2017.05.006. Epub 2017 May 13.
19.
Ovarian hormones ameliorate memory impairment, cholinergic deficit, neuronal apoptosis and astrogliosis in a rat model of Alzheimer's disease.
Hu Z, etal., Exp Ther Med. 2016 Jan;11(1):89-97. doi: 10.3892/etm.2015.2868. Epub 2015 Nov 13.
20.
OPRD1 gene affects disease vulnerability and environmental stress in patients with heroin dependence in Han Chinese.
Huang CC, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2019 Mar 8;89:109-116. doi: 10.1016/j.pnpbp.2018.08.028. Epub 2018 Aug 30.
21.
Cholesterol reduction by methyl-beta-cyclodextrin attenuates the delta opioid receptor-mediated signaling in neuronal cells but enhances it in non-neuronal cells.
Huang P, etal., Biochem Pharmacol. 2007 Feb 15;73(4):534-49. Epub 2006 Nov 3.
22.
Spinal pharmacology of antinociception produced by microinjection of mu or delta opioid receptor agonists in the ventromedial medulla of the rat.
Hurley RW, etal., Neuroscience. 2003;118(3):789-96.
23.
NPY-induced feeding: pharmacological characterization using selective opioid antagonists and antisense probes in rats.
Israel Y, etal., Peptides. 2005 Jul;26(7):1167-75. Epub 2005 Feb 26.
24.
kappa -opioid receptor agonists modulate visceral nociception at a novel, peripheral site of action.
Joshi SK, etal., J Neurosci. 2000 Aug 1;20(15):5874-9.
25.
OPRD1 rs569356 polymorphism has an effect on plasma norbuprenorphine levels and dose/kg-normalized norbuprenorphine values in individuals with opioid use disorder.
Kaya-Akyüzlü D, etal., Environ Toxicol Pharmacol. 2023 Jun;100:104143. doi: 10.1016/j.etap.2023.104143. Epub 2023 May 3.
26.
The delta 2-opioid receptor antagonist naltriben selectively attenuates alcohol intake in rats bred for alcohol preference.
Krishnan-Sarin S, etal., Pharmacol Biochem Behav. 1995 Sep;52(1):153-9. doi: 10.1016/0091-3057(95)00080-g.
27.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
28.
[Contribution of delta1-opioid receptors in regulation of cardiac resistance to ischemia-reperfusion]
Lasukova TV, etal., Ross Fiziol Zh Im I M Sechenova. 2002 May;88(5):568-80.
29.
Morphine withdrawal precipitated by specific mu, delta or kappa opioid receptor antagonists: a c-Fos protein study in the rat central nervous system.
Le Guen S, etal., Eur J Neurosci. 2003 Jun;17(11):2425-37. doi: 10.1046/j.1460-9568.2003.02678.x.
30.
Differential coupling of mu-, delta-, and kappa-opioid receptors to G alpha16-mediated stimulation of phospholipase C.
Lee JW, etal., J Neurochem. 1998 May;70(5):2203-11.
31.
Morphine-6beta-glucuronide-induced hyperphagia: characterization of opioid action by selective antagonists and antisense mapping in rats.
Leventhal L, etal., J Pharmacol Exp Ther. 1998 Nov;287(2):538-44.
32.
OPRD1 SNPs associated with opioid addiction are cis-eQTLs for the phosphatase and actin regulator 4 gene, PHACTR4, a mediator of cytoskeletal dynamics.
Levran O, etal., Transl Psychiatry. 2021 May 25;11(1):316. doi: 10.1038/s41398-021-01439-y.
33.
Analyzing Interaction of μ-, δ- and κ-opioid Receptor Gene Variants on Alcohol or Drug Dependence Using a Pattern Discovery-based Method.
Li Z and Zhang H, J Addict Res Ther. 2013 May 14;Suppl 7:007.
34.
Impact of SNP-SNP interaction among ABCB1, ARRB2, DRD1 and OPRD1 on methadone dosage requirement in Han Chinese patients.
Luo R, etal., Pharmacogenomics. 2017 Dec;18(18):1659-1670. doi: 10.2217/pgs-2017-0072. Epub 2017 Nov 27.
35.
Activation of peripheral delta opioid receptors eliminates cardiac electrical instability in a rat model of post-infarction cardiosclerosis via mitochondrial ATP-dependent K+ channels.
Maslov LN, etal., Life Sci. 2003 Jul 4;73(7):947-52.
36.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
37.
An analysis of genetic association in opioid dependence susceptibility.
Nagaya D, etal., J Clin Pharm Ther. 2018 Feb;43(1):80-86. doi: 10.1111/jcpt.12585. Epub 2017 Jun 27.
38.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
39.
Association of OPRD1 polymorphisms with heroin dependence in a large case-control series.
Nelson EC, etal., Addict Biol. 2014 Jan;19(1):111-21. doi: 10.1111/j.1369-1600.2012.00445.x. Epub 2012 Apr 13.
40.
Bradykinin-induced functional competence and trafficking of the delta-opioid receptor in trigeminal nociceptors.
Patwardhan AM, etal., J Neurosci. 2005 Sep 28;25(39):8825-32.
41.
Effect of exogenous kappa-opioid receptor activation in rat model of myocardial infarction.
Peart JN, etal., J Cardiovasc Pharmacol. 2004 Mar;43(3):410-5.
42.
Predictors of treatment retention and survival among methadone-maintained patients: A possible role for a functional delta opioid receptor gene variant.
Peles E, etal., Drug Alcohol Depend. 2023 Sep 1;250:110903. doi: 10.1016/j.drugalcdep.2023.110903. Epub 2023 Jul 22.
43.
GOA pipeline
RGD automated data pipeline
44.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
45.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
46.
Association of OPRD1 Gene Variants with Opioid Dependence in Addicted Male Individuals Undergoing Methadone Treatment in the North of Iran.
Sharafshah A, etal., J Psychoactive Drugs. 2017 Jul-Aug;49(3):242-251. doi: 10.1080/02791072.2017.1290303. Epub 2017 Mar 1.
47.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
48.
The OPRD1 rs678849 variant influences outcome of disulfiram treatment for cocaine dependency in methadone-maintained patients.
Thomas PS, etal., Psychiatr Genet. 2021 Jun 1;31(3):88-94. doi: 10.1097/YPG.0000000000000279.
49.
Chronic nicotine-induced changes in gene expression of delta and kappa-opioid receptors and their endogenous ligands in the mesocorticolimbic system of the rat.
Ugur M, etal., Synapse. 2017 Sep;71(9). doi: 10.1002/syn.21985. Epub 2017 May 29.
50.
Expression of material mRNA in the hypothalamus and frontal cortex in a rat model of fatal hypothermia.
Umehara T, etal., Leg Med (Tokyo). 2011 Jul;13(4):165-70. doi: 10.1016/j.legalmed.2011.01.005. Epub 2011 Mar 5.
51.
Variations in opioid receptor genes in neonatal abstinence syndrome.
Wachman EM, etal., Drug Alcohol Depend. 2015 Oct 1;155:253-9. doi: 10.1016/j.drugalcdep.2015.07.001. Epub 2015 Jul 8.
52.
Preferential cytoplasmic localization of delta-opioid receptors in rat striatal patches: comparison with plasmalemmal mu-opioid receptors.
Wang H and Pickel VM, J Neurosci. 2001 May 1;21(9):3242-50.
53.
cDNA cloning of an orphan opiate receptor gene family member and its splice variant.
Wang JB, etal., FEBS Lett 1994 Jul 4;348(1):75-9.
54.
Ultrastructural localization of delta-1 opioid receptor in the dorsal raphe nucleus of the rat.
Wang QP, etal., Synapse. 1997 Jul;26(3):243-53.
55.
Methylation and expression quantitative trait loci rs1799971 in the OPRM1 gene and rs4654327 in the OPRD1 gene are associated with opioid use disorder.
Yu J, etal., Neurosci Lett. 2023 Sep 25;814:137468. doi: 10.1016/j.neulet.2023.137468. Epub 2023 Sep 1.
56.
The OPRD1 and OPRK1 loci in alcohol or drug dependence: OPRD1 variation modulates substance dependence risk.
Zhang H, etal., Mol Psychiatry. 2008 May;13(5):531-43. doi: 10.1038/sj.mp.4002035. Epub 2007 Jul 10.
57.
Chronic Oxycodone Self-administration Altered Reward-related Genes in the Ventral and Dorsal Striatum of C57BL/6J Mice: An RNA-seq Analysis.
Zhang Y, etal., Neuroscience. 2018 Nov 21;393:333-349. doi: 10.1016/j.neuroscience.2018.07.032. Epub 2018 Jul 29.
Oprd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 149,590,244 - 149,624,999 (-) NCBI GRCr8 mRatBN7.2 5 144,306,188 - 144,340,960 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,306,188 - 144,340,960 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,005,532 - 147,040,056 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 148,775,378 - 148,809,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 148,764,406 - 148,799,337 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,288,126 - 150,323,063 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,288,126 - 150,323,063 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 153,962,767 - 153,997,858 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 150,979,252 - 151,014,066 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 150,989,290 - 151,024,105 (-) NCBI Celera 5 142,741,006 - 142,775,820 (-) NCBI Celera RH 3.4 Map 5 965.9 RGD Cytogenetic Map 5 q36 NCBI
OPRD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 28,812,170 - 28,871,267 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 28,812,170 - 28,871,267 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 29,138,682 - 29,197,779 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 29,011,241 - 29,062,795 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 28,959,269 - 29,010,821 NCBI Celera 1 27,534,800 - 27,586,335 (+) NCBI Celera Cytogenetic Map 1 p35.3 NCBI HuRef 1 27,391,067 - 27,442,611 (+) NCBI HuRef CHM1_1 1 29,254,016 - 29,305,583 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 28,654,162 - 28,713,229 (+) NCBI T2T-CHM13v2.0
Oprd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 131,834,980 - 131,872,042 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 131,838,037 - 131,871,797 (-) Ensembl GRCm39 Ensembl GRCm38 4 132,110,188 - 132,144,486 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 132,110,726 - 132,144,486 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 131,666,641 - 131,700,401 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 131,382,802 - 131,416,562 (-) NCBI MGSCv36 mm8 Celera 4 130,271,660 - 130,305,734 (-) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 64.78 NCBI
Oprd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 7,866,758 - 7,913,399 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 7,866,790 - 7,913,399 (+) NCBI ChiLan1.0 ChiLan1.0
OPRD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 197,970,746 - 198,030,027 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 197,090,112 - 197,149,063 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 28,068,053 - 28,143,053 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 29,112,328 - 29,163,464 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 29,112,152 - 29,163,464 (+) Ensembl panpan1.1 panPan2
OPRD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 71,685,129 - 71,721,692 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 71,689,084 - 71,721,875 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 68,264,922 - 68,297,415 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 72,248,368 - 72,280,856 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 72,247,773 - 72,281,077 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 69,077,265 - 69,109,751 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 70,084,707 - 70,117,198 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 71,082,831 - 71,115,319 (-) NCBI UU_Cfam_GSD_1.0
Oprd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 47,035,433 - 47,078,632 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 12,860,293 - 12,903,466 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 12,860,293 - 12,902,389 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OPRD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 85,785,276 - 85,830,877 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 85,775,576 - 85,827,170 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 79,611,950 - 79,662,042 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OPRD1
Oprd1
.
Predicted Target Of
Count of predictions: 142 Count of miRNA genes: 100 Interacting mature miRNAs: 116 Transcripts: ENSRNOT00000014084 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Mgh21
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 149,661,912 - 149,662,130 (+) Marker Load Pipeline mRatBN7.2 5 144,377,876 - 144,378,094 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,360,936 - 150,361,153 NCBI Rnor6.0 Rnor_5.0 5 154,034,053 - 154,034,270 UniSTS Rnor5.0 RGSC_v3.4 5 151,060,403 - 151,060,621 RGD RGSC3.4 RGSC_v3.4 5 151,060,404 - 151,060,621 UniSTS RGSC3.4 RGSC_v3.1 5 151,070,442 - 151,070,660 RGD Celera 5 142,812,193 - 142,812,410 UniSTS RH 3.4 Map 5 988.6 UniSTS RH 3.4 Map 5 988.6 RGD RH 2.0 Map 5 157.0 RGD Cytogenetic Map 5 q36 UniSTS
D5Rat103
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 149,642,129 - 149,642,320 (+) Marker Load Pipeline mRatBN7.2 5 144,358,090 - 144,358,281 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,340,838 - 150,341,028 NCBI Rnor6.0 Rnor_5.0 5 154,014,163 - 154,014,353 UniSTS Rnor5.0 RGSC_v3.4 5 151,039,766 - 151,039,956 UniSTS RGSC3.4 RGSC_v3.4 5 151,039,725 - 151,039,965 RGD RGSC3.4 RGSC_v3.1 5 151,049,805 - 151,049,995 RGD Celera 5 142,792,480 - 142,792,670 UniSTS RH 3.4 Map 5 964.21 UniSTS RH 3.4 Map 5 964.21 RGD SHRSP x BN Map 5 80.7699 RGD SHRSP x BN Map 5 80.7699 UniSTS Cytogenetic Map 5 q36 UniSTS
RH94603
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 149,590,274 - 149,590,427 (+) Marker Load Pipeline mRatBN7.2 5 144,306,218 - 144,306,372 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,288,157 - 150,288,309 NCBI Rnor6.0 Rnor_5.0 5 153,962,798 - 153,962,950 UniSTS Rnor5.0 RGSC_v3.4 5 150,979,283 - 150,979,435 UniSTS RGSC3.4 Celera 5 142,741,037 - 142,741,188 UniSTS RH 3.4 Map 5 965.9 UniSTS Cytogenetic Map 5 q36 UniSTS
BE119486
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 144,316,650 - 144,316,823 (+) MAPPER mRatBN7.2 Rnor_6.0 5 150,298,478 - 150,298,650 NCBI Rnor6.0 Rnor_5.0 5 153,973,040 - 153,973,212 UniSTS Rnor5.0 RGSC_v3.4 5 150,990,090 - 150,990,262 UniSTS RGSC3.4 Celera 5 142,751,643 - 142,751,815 UniSTS RH 3.4 Map 5 965.41 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
5
30
102
30
23
10
4
10
6
107
50
87
34
48
13
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014084 ⟹ ENSRNOP00000014084
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 144,306,188 - 144,340,960 (-) Ensembl Rnor_6.0 Ensembl 5 150,288,126 - 150,323,063 (-) Ensembl
RefSeq Acc Id:
NM_012617 ⟹ NP_036749
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 149,590,244 - 149,624,999 (-) NCBI mRatBN7.2 5 144,306,188 - 144,340,960 (-) NCBI Rnor_6.0 5 150,288,126 - 150,323,063 (-) NCBI Rnor_5.0 5 153,962,767 - 153,997,858 (-) NCBI RGSC_v3.4 5 150,979,252 - 151,014,066 (-) RGD Celera 5 142,741,006 - 142,775,820 (-) RGD
Sequence:
GAGCGCTGCAGCCTGCGACGTCGGGGCCGTGGCCTCCGTTTTCCGCGCGCCACTCGCTGGGTCCCTGCGCCCAGGGCGCACGGTGGAGACGGACGCGGAGGCGCCATGGAGCCGGTGCCTTCTGCCCG
hide sequence
RefSeq Acc Id:
NP_036749 ⟸ NM_012617
- UniProtKB:
P33533 (UniProtKB/Swiss-Prot)
- Sequence:
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSID
hide sequence
Ensembl Acc Id:
ENSRNOP00000014084 ⟸ ENSRNOT00000014084
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Oprd1
Opioid receptor delta 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_physical_interaction
may interact with micro-opioid receptors to effect action potentials in GH3 cells
729249
