Symbol:
Agxt
Name:
alanine--glyoxylate aminotransferase
RGD ID:
2073
Description:
Enables L-serine-pyruvate transaminase activity; alanine-glyoxylate transaminase activity; and amino acid binding activity. Involved in carboxylic acid biosynthetic process; response to cAMP; and response to glucocorticoid. Located in mitochondrial matrix and peroxisome. Human ortholog(s) of this gene implicated in primary hyperoxaluria type 1. Orthologous to human AGXT (alanine--glyoxylate aminotransferase); PARTICIPATES IN alanine metabolic pathway; dihydropyrimidine dehydrogenase deficiency pathway; dimethylglycine dehydrogenase deficiency pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
AGT; alanine--glyoxylate and serine--pyruvate aminotransferase; alanine-glyoxylate aminotransferase; alanine-glyoxylate aminotransferase (serine-pyruvate aminotransferase); angiotensin receptor 2; serine--pyruvate aminotransferase; serine--pyruvate aminotransferase, mitochondrial; serine--pyruvate aminotransferase, peroxisomal; serine-pyruvate aminotransferase; serine:pyruvate aminotransferase SPT; serine:pyruvate aminotransferase, SPT,; serine:pyruvate/alanine:glyoxylate aminotransferase; Spat; SPT
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AGXT (alanine--glyoxylate aminotransferase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Agxt (alanine-glyoxylate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Agxt (alanine--glyoxylate and serine--pyruvate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AGXT (alanine--glyoxylate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AGXT (alanine--glyoxylate and serine--pyruvate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Agxt (alanine--glyoxylate and serine--pyruvate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AGXT (alanine--glyoxylate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AGXT (alanine--glyoxylate and serine--pyruvate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Agxt (alanine--glyoxylate and serine--pyruvate aminotransferase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
AGXT (alanine--glyoxylate aminotransferase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Agxt (alanine-glyoxylate aminotransferase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
agxtb (alanine--glyoxylate and serine--pyruvate aminotransferase b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
agxta (alanine--glyoxylate and serine--pyruvate aminotransferase a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
AGX1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Drosophila melanogaster (fruit fly):
Spat
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
agxt-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
agxt
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
Agxt_v1
Agxt_v2
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 101,122,793 - 101,132,746 (+) NCBI GRCr8 mRatBN7.2 9 93,675,384 - 93,685,337 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 93,675,384 - 93,685,336 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 102,110,940 - 102,120,893 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 107,246,884 - 107,256,803 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 105,603,034 - 105,612,953 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 100,281,339 - 100,291,292 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 100,281,339 - 100,291,291 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 99,939,444 - 99,949,397 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 92,412,128 - 92,422,075 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 92,616,896 - 92,626,844 (+) NCBI Celera 9 91,210,785 - 91,220,737 (+) NCBI Celera Cytogenetic Map 9 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Agxt Rat (1->4)-beta-D-glucan multiple interactions ISO Agxt (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AGXT mRNA CTD PMID:36331819 Agxt Rat 1,2-dimethylhydrazine decreases expression ISO Agxt (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of AGXT mRNA CTD PMID:22206623 Agxt Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of AGXT mRNA CTD PMID:30723492 Agxt Rat 17beta-estradiol decreases expression ISO AGXT (Homo sapiens) 6480464 Estradiol results in decreased expression of AGXT mRNA CTD PMID:20106945 Agxt Rat 17beta-estradiol increases expression ISO Agxt (Mus musculus) 6480464 Estradiol results in increased expression of AGXT mRNA CTD PMID:39298647 Agxt Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of AGXT protein CTD PMID:32145629 Agxt Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Agxt (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Agxt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Agxt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of AGXT mRNA CTD PMID:19770486 Agxt Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Agxt (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of AGXT mRNA CTD PMID:27562557 Agxt Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AGXT mRNA CTD PMID:16054898 more ... Agxt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO AGXT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of AGXT mRNA CTD PMID:20106945 and PMID:21632981 Agxt Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Agxt (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Agxt Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of AGXT mRNA CTD PMID:23358152 Agxt Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of AGXT mRNA CTD PMID:19162173 Agxt Rat 4,4'-sulfonyldiphenol decreases expression ISO Agxt (Mus musculus) 6480464 bisphenol S results in decreased expression of AGXT mRNA CTD PMID:39298647 Agxt Rat 4-hydroxyphenyl retinamide increases expression ISO AGXT (Homo sapiens) 6480464 Fenretinide results in increased expression of AGXT mRNA CTD PMID:16671099 Agxt Rat 7,12-dimethyltetraphene decreases expression ISO Agxt (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Agxt Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of AGXT mRNA CTD PMID:31881176 Agxt Rat aflatoxin B1 affects expression ISO AGXT (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of AGXT protein CTD PMID:20106945 Agxt Rat aflatoxin B1 decreases methylation ISO AGXT (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of AGXT exon CTD PMID:30157460 Agxt Rat aflatoxin B1 decreases expression ISO AGXT (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of AGXT mRNA CTD PMID:21641981 more ... Agxt Rat aflatoxin B1 decreases expression ISO Agxt (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of AGXT mRNA CTD PMID:19770486 Agxt Rat Allylamine affects expression EXP 6480464 Allylamine affects the expression of AGXT mRNA CTD PMID:15910882 Agxt Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AGXT mRNA CTD PMID:16483693 Agxt Rat Benoxacor decreases expression ISO Agxt (Mus musculus) 6480464 benoxacor results in decreased expression of AGXT mRNA CTD PMID:34850242 Agxt Rat benzo[a]pyrene decreases expression ISO AGXT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of AGXT mRNA CTD PMID:20106945 more ... Agxt Rat benzo[a]pyrene affects methylation ISO AGXT (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AGXT promoter CTD PMID:27901495 Agxt Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of AGXT mRNA CTD PMID:18164116 Agxt Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of AGXT mRNA CTD PMID:16648578 Agxt Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of AGXT gene CTD PMID:28505145 Agxt Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AGXT mRNA and bisphenol A results in increased expression of AGXT protein CTD PMID:32145629 Agxt Rat bisphenol A increases expression ISO Agxt (Mus musculus) 6480464 bisphenol A results in increased expression of AGXT mRNA CTD PMID:30245210 Agxt Rat bisphenol A affects expression ISO AGXT (Homo sapiens) 6480464 bisphenol A affects the expression of AGXT mRNA CTD PMID:30903817 Agxt Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AGXT mRNA CTD PMID:30903817 Agxt Rat buta-1,3-diene decreases expression ISO Agxt (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of AGXT mRNA CTD PMID:29038090 Agxt Rat carbaryl decreases activity EXP 6480464 Carbaryl results in decreased activity of AGXT protein CTD PMID:2119399 Agxt Rat CGP 52608 multiple interactions ISO AGXT (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to AGXT gene] CTD PMID:28238834 Agxt Rat choline multiple interactions ISO Agxt (Mus musculus) 6480464 [Dietary Fats co-treated with Choline deficiency] results in decreased expression of AGXT mRNA and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in decreased expression of AGXT mRNA] CTD PMID:29246445 Agxt Rat clofibrate multiple interactions ISO Agxt (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of AGXT mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of AGXT mRNA] CTD PMID:17585979 Agxt Rat clofibrate decreases expression ISO Agxt (Mus musculus) 6480464 Clofibrate results in decreased expression of AGXT mRNA CTD PMID:17585979 Agxt Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of AGXT mRNA CTD PMID:17602206 Agxt Rat cobalt dichloride decreases expression ISO Agxt (Mus musculus) 6480464 cobaltous chloride results in decreased expression of AGXT mRNA CTD PMID:21139344 Agxt Rat copper atom multiple interactions ISO AGXT (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of AGXT mRNA CTD PMID:24690739 Agxt Rat copper(0) multiple interactions ISO AGXT (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of AGXT mRNA CTD PMID:24690739 Agxt Rat copper(II) sulfate decreases expression ISO AGXT (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of AGXT mRNA CTD PMID:19549813 Agxt Rat cyclosporin A decreases expression ISO Agxt (Mus musculus) 6480464 Cyclosporine results in decreased expression of AGXT mRNA CTD PMID:23830897 Agxt Rat cyclosporin A decreases expression ISO AGXT (Homo sapiens) 6480464 Cyclosporine results in decreased expression of AGXT mRNA CTD PMID:20106945 more ... Agxt Rat diazinon increases methylation ISO AGXT (Homo sapiens) 6480464 Diazinon results in increased methylation of AGXT gene CTD PMID:22964155 Agxt Rat disulfiram multiple interactions ISO AGXT (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of AGXT mRNA CTD PMID:24690739 Agxt Rat doxorubicin increases expression ISO Agxt (Mus musculus) 6480464 Doxorubicin results in increased expression of AGXT mRNA CTD PMID:26873546 Agxt Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of AGXT mRNA CTD PMID:23962444 Agxt Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of AGXT mRNA CTD PMID:18035473 Agxt Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of AGXT mRNA CTD PMID:24793618 Agxt Rat folic acid decreases expression ISO Agxt (Mus musculus) 6480464 Folic Acid results in decreased expression of AGXT mRNA CTD PMID:25629700 Agxt Rat fumonisin B1 decreases expression ISO Agxt (Mus musculus) 6480464 fumonisin B1 results in decreased expression of AGXT mRNA CTD PMID:16221962 Agxt Rat furan increases methylation EXP 6480464 furan results in increased methylation of AGXT gene CTD PMID:22079235 Agxt Rat furan decreases expression EXP 6480464 furan results in decreased expression of AGXT mRNA CTD PMID:25539665 Agxt Rat Heliotrine decreases expression ISO AGXT (Homo sapiens) 6480464 heliotrine results in decreased expression of AGXT mRNA CTD PMID:26100227 Agxt Rat inulin multiple interactions ISO Agxt (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of AGXT mRNA CTD PMID:36331819 Agxt Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of AGXT mRNA CTD PMID:23358152 Agxt Rat mercury dichloride decreases expression ISO Agxt (Mus musculus) 6480464 Mercuric Chloride results in decreased expression of AGXT mRNA CTD PMID:37172713 Agxt Rat mercury dichloride decreases expression ISO AGXT (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of AGXT mRNA CTD PMID:37172713 Agxt Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of AGXT mRNA CTD PMID:21515302 Agxt Rat N-nitrosodiethylamine increases expression ISO Agxt (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of AGXT mRNA CTD PMID:17942915 Agxt Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of AGXT mRNA CTD PMID:19041683 Agxt Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of AGXT mRNA and [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of AGXT mRNA CTD PMID:18164116 and PMID:28943392 Agxt Rat N-nitrosodiethylamine multiple interactions ISO Agxt (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of AGXT mRNA and MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of AGXT mRNA] CTD PMID:17942915 and PMID:24535843 Agxt Rat N-Nitrosopyrrolidine decreases expression ISO AGXT (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of AGXT mRNA CTD PMID:32234424 Agxt Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of AGXT mRNA CTD PMID:24136188 Agxt Rat O-methyleugenol decreases expression ISO AGXT (Homo sapiens) 6480464 methyleugenol results in decreased expression of AGXT mRNA CTD PMID:32234424 Agxt Rat ozone increases expression EXP 6480464 Ozone results in increased expression of AGXT mRNA CTD PMID:35737395 Agxt Rat paracetamol multiple interactions ISO Agxt (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of AGXT mRNA more ... CTD PMID:17585979 and PMID:29246445 Agxt Rat paracetamol decreases expression ISO Agxt (Mus musculus) 6480464 Acetaminophen results in decreased expression of AGXT mRNA CTD PMID:29246445 Agxt Rat paracetamol decreases expression ISO AGXT (Homo sapiens) 6480464 Acetaminophen results in decreased expression of AGXT mRNA CTD PMID:25704631 and PMID:29067470 Agxt Rat paracetamol affects expression ISO Agxt (Mus musculus) 6480464 Acetaminophen affects the expression of AGXT mRNA CTD PMID:17562736 Agxt Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of AGXT mRNA CTD PMID:19162173 Agxt Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Agxt (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AGXT mRNA more ... CTD PMID:36331819 Agxt Rat perfluorooctanoic acid decreases expression ISO AGXT (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of AGXT protein CTD PMID:26879310 Agxt Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of AGXT protein CTD PMID:34958885 Agxt Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of AGXT mRNA CTD PMID:31324951 Agxt Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of AGXT mRNA CTD PMID:19162173 Agxt Rat phenobarbital multiple interactions ISO Agxt (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of AGXT mRNA CTD PMID:24535843 Agxt Rat pirinixic acid multiple interactions ISO Agxt (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of AGXT mRNA CTD PMID:19710929 Agxt Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of AGXT mRNA CTD PMID:17164430 and PMID:19162173 Agxt Rat pirinixic acid decreases expression ISO Agxt (Mus musculus) 6480464 pirinixic acid results in decreased expression of AGXT mRNA CTD PMID:16221962 Agxt Rat pirinixic acid multiple interactions ISO AGXT (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of AGXT mRNA CTD PMID:19710929 Agxt Rat potassium dichromate decreases expression ISO Agxt (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of AGXT mRNA CTD PMID:23608068 Agxt Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of AGXT mRNA CTD PMID:19162173 Agxt Rat propiconazole decreases expression ISO Agxt (Mus musculus) 6480464 propiconazole results in decreased expression of AGXT mRNA CTD PMID:21278054 Agxt Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of AGXT mRNA CTD PMID:23358152 Agxt Rat quercetin increases expression ISO Agxt (Mus musculus) 6480464 Quercetin results in increased expression of AGXT mRNA CTD PMID:16455785 Agxt Rat quercetin affects expression ISO AGXT (Homo sapiens) 6480464 Quercetin affects the expression of AGXT mRNA CTD PMID:21632981 Agxt Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of AGXT mRNA CTD PMID:28374803 Agxt Rat senecionine decreases expression ISO AGXT (Homo sapiens) 6480464 senecionine results in decreased expression of AGXT mRNA CTD PMID:26100227 Agxt Rat Senkirkine decreases expression ISO AGXT (Homo sapiens) 6480464 senkirkine results in decreased expression of AGXT mRNA CTD PMID:26100227 Agxt Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of AGXT protein CTD PMID:29459688 Agxt Rat sodium arsenite increases expression ISO AGXT (Homo sapiens) 6480464 sodium arsenite results in increased expression of AGXT mRNA CTD PMID:38568856 Agxt Rat sodium arsenite decreases expression ISO AGXT (Homo sapiens) 6480464 sodium arsenite results in decreased expression of AGXT mRNA CTD PMID:29301061 Agxt Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of AGXT mRNA CTD PMID:21515302 Agxt Rat tetrachloromethane decreases expression ISO Agxt (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of AGXT mRNA CTD PMID:27339419 and PMID:31919559 Agxt Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of AGXT mRNA CTD PMID:31150632 Agxt Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of AGXT mRNA CTD PMID:23411599 and PMID:34492290 Agxt Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of AGXT mRNA CTD PMID:28943392 Agxt Rat titanium dioxide decreases expression ISO Agxt (Mus musculus) 6480464 titanium dioxide results in decreased expression of AGXT mRNA CTD PMID:23557971 Agxt Rat topiramate increases expression EXP 6480464 topiramate results in increased expression of AGXT mRNA CTD PMID:16979414 Agxt Rat trichloroethene increases expression ISO Agxt (Mus musculus) 6480464 Trichloroethylene results in increased expression of AGXT mRNA CTD PMID:19254012 Agxt Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of AGXT mRNA CTD PMID:30589522 Agxt Rat urethane decreases expression ISO AGXT (Homo sapiens) 6480464 Urethane results in decreased expression of AGXT mRNA CTD PMID:28818685 Agxt Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of AGXT mRNA CTD PMID:24136188 Agxt Rat valproic acid decreases expression ISO AGXT (Homo sapiens) 6480464 Valproic Acid results in decreased expression of AGXT mRNA CTD PMID:29154799 and PMID:29501571 Agxt Rat zinc atom decreases expression ISO AGXT (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of AGXT mRNA CTD PMID:18356318 Agxt Rat zinc(0) decreases expression ISO AGXT (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of AGXT mRNA CTD PMID:18356318
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,7-dihydropurine-6-thione (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (ISO) acetamide (EXP) aflatoxin B1 (ISO) Allylamine (EXP) ammonium chloride (EXP) Benoxacor (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bexarotene (EXP) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) carbaryl (EXP) CGP 52608 (ISO) choline (ISO) clofibrate (ISO) clofibric acid (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diazinon (ISO) disulfiram (ISO) doxorubicin (ISO) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) fumonisin B1 (ISO) furan (EXP) Heliotrine (ISO) inulin (ISO) mercaptopurine (EXP) mercury dichloride (ISO) Muraglitazar (EXP) N-nitrosodiethylamine (EXP,ISO) N-Nitrosopyrrolidine (ISO) nimesulide (EXP) O-methyleugenol (ISO) ozone (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) phenformin (EXP) phenobarbital (EXP,ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) purine-6-thiol (EXP) quercetin (ISO) rotenone (EXP) senecionine (ISO) Senkirkine (ISO) sodium arsenite (EXP,ISO) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topiramate (EXP) trichloroethene (ISO) triphenyl phosphate (EXP) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Enzymological and mutational analysis of a complex primary hyperoxaluria type 1 phenotype involving alanine:glyoxylate aminotransferase peroxisome-to-mitochondrion mistargeting and intraperoxisomal aggregation.
Danpure CJ, etal., Am J Hum Genet 1993 Aug;53(2):417-32.
2.
Evolution of alanine:glyoxylate aminotransferase 1 peroxisomal and mitochondrial targeting. A survey of its subcellular distribution in the livers of various representatives of the classes Mammalia, Aves and Amphibia.
Danpure CJ, etal., Eur J Cell Biol. 1994 Aug;64(2):295-313.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Inhibitory effect of cortisone acetate on the stimulation of rat liver cytosol L-serrine. Pyruvate aminotransferase by dibutyryl adenosine 3,5-monophosphate.
Hoshino J, etal., Biochim Biophys Acta. 1975 Jul 14;399(1):42-9.
6.
Regulation and characterization of L-serine: pyruvate aminotransferase in rat liver cytosol and mitochondria.
Hoshino J, etal., Z Naturforsch C. 1977 Mar-Apr;32(3-4):249-53.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
Capillary electrophoresis assay of alanine:glyoxylate aminotransferase activity in rat liver.
Nishijima S, etal., J Chromatogr B Analyt Technol Biomed Life Sci. 2002 Nov 15;780(1):13-9.
12.
Hepatic alanine-glyoxylate aminotransferase activity and oxalate metabolism in vitamin B6 deficient rats.
Nishijima S, etal., J Urol. 2003 Feb;169(2):683-6.
13.
Primary hyperoxaluria type I due to a point mutation of T to C in the coding region of the serine:pyruvate aminotransferase gene.
Nishiyama K, etal., Biochem Biophys Res Commun 1991 May 15;176(3):1093-9.
14.
Nucleotide sequence of the cDNA encoding the precursor for mitochondrial serine:pyruvate aminotransferase of rat liver.
Oda T, etal., Eur J Biochem 1987 Nov 2;168(3):537-42.
15.
Cloning and expression in Escherichia coli of cDNA for serine: pyruvate aminotransferase of rat liver.
Oda T, etal., Eur J Biochem. 1985 Aug 1;150(3):415-21.
16.
Mitochondrial targeting signal-induced conformational change and repression of the peroxisomal targeting signal of the precursor for rat liver serine:pyruvate/alanine:glyoxylate aminotransferase.
Oda T, etal., J Biochem (Tokyo). 2000 Apr;127(4):665-71.
17.
Generation from a single gene of two mRNAs that encode the mitochondrial and peroxisomal serine:pyruvate aminotransferase of rat liver.
Oda T, etal., J Biol Chem 1990 May 5;265(13):7513-9.
18.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Quantitative cryoimmunogold electron microscopic studies on induction of serine: pyruvate aminotransferase in rat liver mitochondria by administration of glucagon.
Satoh S, etal., Cell Struct Funct. 1995 Feb;20(1):89-96.
24.
The role of Sp1 and AP-2 in basal and protein kinase A--induced expression of mitochondrial serine:pyruvate aminotransferase in hepatocytes.
Uchida C, etal., J Biol Chem 2002 Oct 18;277(42):39082-92.
25.
Immunocytochemical demonstration of serine: pyruvate amino-transferase in peroxisomes and mitochondria of rat kidney.
Yokota S and Oda T, Histochemistry. 1985;83(1):81-5.
Agxt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 101,122,793 - 101,132,746 (+) NCBI GRCr8 mRatBN7.2 9 93,675,384 - 93,685,337 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 93,675,384 - 93,685,336 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 102,110,940 - 102,120,893 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 107,246,884 - 107,256,803 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 105,603,034 - 105,612,953 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 100,281,339 - 100,291,292 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 100,281,339 - 100,291,291 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 99,939,444 - 99,949,397 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 92,412,128 - 92,422,075 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 92,616,896 - 92,626,844 (+) NCBI Celera 9 91,210,785 - 91,220,737 (+) NCBI Celera Cytogenetic Map 9 q36 NCBI
AGXT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 240,868,824 - 240,880,500 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 240,868,824 - 240,880,502 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 241,808,241 - 241,819,917 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 241,456,835 - 241,467,210 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 241,528,151 - 241,538,527 NCBI Celera 2 235,480,100 - 235,491,174 (+) NCBI Celera Cytogenetic Map 2 q37.3 NCBI HuRef 2 233,568,172 - 233,579,109 (+) NCBI HuRef CHM1_1 2 241,814,212 - 241,824,586 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 241,367,223 - 241,379,660 (+) NCBI T2T-CHM13v2.0
Agxt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 93,062,962 - 93,073,143 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 93,062,962 - 93,073,143 (+) Ensembl GRCm39 Ensembl GRCm38 1 93,135,240 - 93,145,421 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 93,135,240 - 93,145,421 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 95,031,853 - 95,041,998 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 94,965,651 - 94,988,099 (+) NCBI MGSCv36 mm8 Celera 1 96,079,940 - 96,090,082 (+) NCBI Celera Cytogenetic Map 1 D NCBI cM Map 1 47.0 NCBI
Agxt Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955542 710,005 - 717,741 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955542 710,506 - 720,564 (-) NCBI ChiLan1.0 ChiLan1.0
AGXT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 143,555,885 - 143,567,244 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 143,570,805 - 143,582,039 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 128,125,289 - 128,137,091 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 246,928,784 - 246,939,837 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 246,928,784 - 246,939,837 (+) Ensembl panpan1.1 panPan2
AGXT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 50,968,291 - 50,976,089 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 51,181,404 - 51,189,176 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 51,163,250 - 51,171,015 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 51,163,418 - 51,170,784 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 51,004,270 - 51,012,034 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 50,750,660 - 50,758,423 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 51,026,487 - 51,034,252 (+) NCBI UU_Cfam_GSD_1.0
Agxt
AGXT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 139,720,612 - 139,730,736 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 139,720,648 - 139,730,737 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 157,616,991 - 157,627,404 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AGXT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 126,933,711 - 126,943,980 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 126,933,835 - 126,944,354 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 72,444,112 - 72,454,149 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Agxt
.
Predicted Target Of
Count of predictions: 166 Count of miRNA genes: 131 Interacting mature miRNAs: 135 Transcripts: ENSRNOT00000029127 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1582203 Gluco19 Glucose level QTL 19 3.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 92491589 100929786 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 724547 Cm21 Cardiac mass QTL 21 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 79271511 102910209 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 4889852 Pur26 Proteinuria QTL 26 15 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 77813894 101597663 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat
RH130348
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 101,131,940 - 101,132,519 (+) Marker Load Pipeline mRatBN7.2 9 93,684,531 - 93,685,110 (+) MAPPER mRatBN7.2 Rnor_6.0 9 100,290,487 - 100,291,065 NCBI Rnor6.0 Rnor_5.0 9 99,948,592 - 99,949,170 UniSTS Rnor5.0 RGSC_v3.4 9 92,421,275 - 92,421,853 UniSTS RGSC3.4 Celera 9 91,219,932 - 91,220,510 UniSTS Cytogenetic Map 9 q34-q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
5
36
81
84
59
18
59
2
119
34
25
13
30
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029127 ⟹ ENSRNOP00000030340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 93,675,384 - 93,685,336 (+) Ensembl Rnor_6.0 Ensembl 9 100,281,339 - 100,291,291 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079305 ⟹ ENSRNOP00000070626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 93,679,849 - 93,685,336 (+) Ensembl Rnor_6.0 Ensembl 9 100,285,804 - 100,291,291 (+) Ensembl
RefSeq Acc Id:
NM_001270659 ⟹ NP_001257588
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,127,258 - 101,132,746 (+) NCBI mRatBN7.2 9 93,679,849 - 93,685,337 (+) NCBI Rnor_6.0 9 100,285,804 - 100,291,292 (+) NCBI Rnor_5.0 9 99,939,444 - 99,949,397 (+) NCBI Celera 9 91,215,250 - 91,220,737 (+) NCBI
Sequence:
ACATACCATATCACTGGGACAACAGCCTGAGTTCGGCCAGACCGTGAGACAGGGCGTCGGGGTGCATCAGGCGGCAGCTGCTACTGCAGGCATCGACATCTTGTACTCTGGCTCTCAGAAGGTCCTGA
hide sequence
RefSeq Acc Id:
NM_001276706 ⟹ NP_001263635
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,122,793 - 101,132,746 (+) NCBI mRatBN7.2 9 93,675,384 - 93,685,337 (+) NCBI Rnor_6.0 9 100,281,339 - 100,291,292 (+) NCBI Rnor_5.0 9 99,939,444 - 99,949,397 (+) NCBI Celera 9 91,210,785 - 91,220,737 (+) NCBI
Sequence:
AGGACAAACATCGATCAGGGTCAAATTGACAATAAAAGGGCTGGAGCAAGCAACAGGGACTCAC
hide sequence
RefSeq Acc Id:
NM_030656 ⟹ NP_085914
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 101,122,793 - 101,132,746 (+) NCBI mRatBN7.2 9 93,675,384 - 93,685,337 (+) NCBI Rnor_6.0 9 100,281,339 - 100,291,292 (+) NCBI Rnor_5.0 9 99,939,444 - 99,949,397 (+) NCBI RGSC_v3.4 9 92,412,128 - 92,422,075 (+) RGD Celera 9 91,210,785 - 91,220,737 (+) NCBI
Sequence:
AGGACAAACATCGATCAGGGTCAAATTGACAATAAAAGGGCTGGAGCAAGCAACAGGGACTCAC
hide sequence
RefSeq Acc Id:
NP_085914 ⟸ NM_030656
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q9R2C7 (UniProtKB/Swiss-Prot), P09139 (UniProtKB/Swiss-Prot), Q5I0N5 (UniProtKB/TrEMBL), A6JQX5 (UniProtKB/TrEMBL)
- Sequence:
MFRMLAKASVTLGSRAASWVRNMGSHQLLVPPPEALSKPLSIPKRLLLGPGPSNLAPRVLAAGSLRMIGHMQKEMFQIMDEIKQGIQYVFQTRNPLTLVVSGSGHCAMETALFNLLEPGDSFLVGTNG
hide sequence
RefSeq Acc Id:
NP_001263635 ⟸ NM_001276706
- Peptide Label:
isoform 3
- UniProtKB:
Q5I0N5 (UniProtKB/TrEMBL)
- Sequence:
MGSHQLLVPPPEALSKPLSIPKRLLLGPGPSNLAPRVLAAGSLRMIGHMQKEMFQIMDEIKQGI
hide sequence
RefSeq Acc Id:
NP_001257588 ⟸ NM_001270659
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2JYE8 (UniProtKB/TrEMBL)
- Sequence:
MPHQGSPSSPSTTRPNPKSTPGRQSQSPSTQTSLICPSCGAVRARPECSFLFPRIHHTLPVISLYCLRESLALISEQGLENSWRRHREATAHLHKCLRELGLKFFVKDPEIRLPTITTVTVPAGYNWR
hide sequence
Ensembl Acc Id:
ENSRNOP00000070626 ⟸ ENSRNOT00000079305
Ensembl Acc Id:
ENSRNOP00000030340 ⟸ ENSRNOT00000029127
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-09-01
Agxt
alanine--glyoxylate aminotransferase
Agxt
alanine--glyoxylate and serine--pyruvate aminotransferase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2018-03-22
Agxt
alanine--glyoxylate and serine--pyruvate aminotransferase
Agxt
alanine-glyoxylate aminotransferase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Agxt
alanine-glyoxylate aminotransferase
Symbol and Name updated
629477 APPROVED
2003-03-07
Agxt
alanine-glyoxylate aminotransferase
Spat
Serine-pyruvate aminotransferase
Data merged from RGD:3743
628472 PROVISIONAL
2002-11-06
Agxt
angiotensin receptor 2
Alanine-glyoxylate aminotransferase (Serine-pyruvate aminotransferase)
Name updated
625702 APPROVED
2002-06-10
Agxt
Alanine-glyoxylate aminotransferase (Serine-pyruvate aminotransferase)
Symbol and Name status set to approved
70586 APPROVED
2002-06-10
Spat
Serine-pyruvate aminotransferase
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
products of alternative initiation sites are localized to mitochondria and peroxisomes
632169
gene_expression
expressed in liver
632168
gene_transcript
variant transcripts are transcribed from different initiation sites in exon 1 and differ at the 5-terminal sequence
632169
gene_transcript
variant transcript encoding polypeptide targeted to the mitochondria has 70 additional nucleotides which encode the N-terminal mitochondrial targeting sequence
632169
