Symbol:
Adgrd1
Name:
adhesion G protein-coupled receptor D1
RGD ID:
1594795
Description:
Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway. Predicted to be located in cytosol and nuclear speck. Predicted to be active in plasma membrane. Orthologous to human ADGRD1 (adhesion G protein-coupled receptor D1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; methoxychlor.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
adhesion G-protein coupled receptor D1; G protein-coupled receptor 133; Gpr133; LOC689257; similar to G protein-coupled receptor 133
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 33,124,981 - 33,239,778 (-) NCBI GRCr8 mRatBN7.2 12 27,488,908 - 27,603,714 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 27,488,908 - 27,603,696 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 12 31,134,806 - 31,249,594 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 31,136,741 - 31,249,118 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 33,062,021 - 33,176,459 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 28,566,102 - 28,658,141 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 29,184,868 - 29,299,574 (-) NCBI Celera Cytogenetic Map 12 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Adgrd1 Rat 1,1,1-trichloroethane increases expression ISO Adgrd1 (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Adgrd1 Rat 1,2-dichloroethane decreases expression ISO Adgrd1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ADGRD1 mRNA CTD PMID:28960355 Adgrd1 Rat 17beta-estradiol multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of ADGRD1 mRNA CTD PMID:20660070 Adgrd1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO ADGRD1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Adgrd1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ADGRD1 mRNA CTD PMID:33387578 Adgrd1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Adgrd1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Adgrd1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADGRD1 mRNA CTD PMID:28628672 Adgrd1 Rat 4,4'-sulfonyldiphenol increases expression ISO Adgrd1 (Mus musculus) 6480464 bisphenol S results in increased expression of ADGRD1 mRNA CTD PMID:30951980 Adgrd1 Rat 8-Br-cAMP increases expression ISO ADGRD1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of ADGRD1 mRNA CTD PMID:22079614 Adgrd1 Rat aflatoxin B1 decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ADGRD1 mRNA CTD PMID:27153756 Adgrd1 Rat aflatoxin B1 decreases methylation ISO ADGRD1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ADGRD1 intron CTD PMID:30157460 Adgrd1 Rat Aflatoxin B2 alpha increases methylation ISO ADGRD1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ADGRD1 intron CTD PMID:30157460 Adgrd1 Rat amiodarone increases expression ISO ADGRD1 (Homo sapiens) 6480464 Amiodarone results in increased expression of ADGRD1 mRNA CTD PMID:19774075 Adgrd1 Rat arsane affects methylation ISO ADGRD1 (Homo sapiens) 6480464 Arsenic affects the methylation of ADGRD1 gene CTD PMID:25304211 Adgrd1 Rat arsenic atom affects methylation ISO ADGRD1 (Homo sapiens) 6480464 Arsenic affects the methylation of ADGRD1 gene CTD PMID:25304211 Adgrd1 Rat benzo[a]pyrene increases methylation ISO ADGRD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ADGRD1 5' UTR CTD PMID:27901495 Adgrd1 Rat benzo[a]pyrene affects methylation ISO ADGRD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ADGRD1 3' UTR more ... CTD PMID:27901495 and PMID:30157460 Adgrd1 Rat benzo[e]pyrene increases methylation ISO ADGRD1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ADGRD1 intron CTD PMID:30157460 Adgrd1 Rat Benzo[ghi]perylene increases expression ISO Adgrd1 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of ADGRD1 mRNA CTD PMID:26377693 Adgrd1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of ADGRD1 mRNA CTD PMID:31163220 Adgrd1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ADGRD1 mRNA CTD PMID:25181051 Adgrd1 Rat bisphenol A increases expression ISO Adgrd1 (Mus musculus) 6480464 bisphenol A results in increased expression of ADGRD1 mRNA CTD PMID:32156529 Adgrd1 Rat bisphenol A decreases methylation ISO ADGRD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ADGRD1 gene CTD PMID:31601247 Adgrd1 Rat bisphenol A multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ADGRD1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADGRD1 mRNA CTD PMID:28628672 and PMID:31601247 Adgrd1 Rat bisphenol F increases expression ISO Adgrd1 (Mus musculus) 6480464 bisphenol F results in increased expression of ADGRD1 mRNA CTD PMID:30951980 Adgrd1 Rat bisphenol F decreases expression ISO Adgrd1 (Mus musculus) 6480464 bisphenol F results in decreased expression of ADGRD1 mRNA CTD PMID:38685157 Adgrd1 Rat butanal decreases expression ISO ADGRD1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ADGRD1 mRNA CTD PMID:26079696 Adgrd1 Rat cantharidin decreases expression ISO Adgrd1 (Mus musculus) 6480464 Cantharidin results in decreased expression of ADGRD1 mRNA CTD PMID:36907384 Adgrd1 Rat carbon nanotube increases expression ISO Adgrd1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ADGRD1 mRNA CTD PMID:25554681 Adgrd1 Rat chrysene increases expression ISO Adgrd1 (Mus musculus) 6480464 chrysene results in increased expression of ADGRD1 mRNA CTD PMID:26377693 Adgrd1 Rat copper atom multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ADGRD1 mRNA CTD PMID:20971185 Adgrd1 Rat copper(0) multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ADGRD1 mRNA CTD PMID:20971185 Adgrd1 Rat cyclosporin A decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ADGRD1 mRNA CTD PMID:25562108 and PMID:27989131 Adgrd1 Rat dexamethasone multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADGRD1 mRNA CTD PMID:28628672 Adgrd1 Rat dibutyl phthalate increases expression ISO Adgrd1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ADGRD1 mRNA CTD PMID:21266533 Adgrd1 Rat doxorubicin decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ADGRD1 mRNA CTD PMID:29803840 Adgrd1 Rat epoxiconazole decreases expression ISO Adgrd1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ADGRD1 mRNA CTD PMID:35436446 Adgrd1 Rat ethyl methanesulfonate increases expression ISO ADGRD1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of ADGRD1 mRNA CTD PMID:23649840 Adgrd1 Rat fluoranthene multiple interactions ISO Adgrd1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of ADGRD1 mRNA CTD PMID:28329830 Adgrd1 Rat fluoranthene decreases expression ISO Adgrd1 (Mus musculus) 6480464 fluoranthene results in decreased expression of ADGRD1 mRNA CTD PMID:28329830 Adgrd1 Rat folic acid decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of ADGRD1 mRNA CTD PMID:21867686 Adgrd1 Rat fulvestrant multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ADGRD1 gene CTD PMID:31601247 Adgrd1 Rat genistein increases expression ISO Adgrd1 (Mus musculus) 6480464 Genistein results in increased expression of ADGRD1 mRNA CTD PMID:32186404 Adgrd1 Rat indometacin multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADGRD1 mRNA CTD PMID:28628672 Adgrd1 Rat isoprenaline increases expression ISO Adgrd1 (Mus musculus) 6480464 Isoproterenol results in increased expression of ADGRD1 mRNA CTD PMID:20003209 Adgrd1 Rat lipopolysaccharide multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Adgrd1 Rat methapyrilene increases methylation ISO ADGRD1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ADGRD1 intron CTD PMID:30157460 Adgrd1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ADGRD1 gene CTD PMID:35440735 Adgrd1 Rat methyl methanesulfonate increases expression ISO ADGRD1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ADGRD1 mRNA CTD PMID:23649840 Adgrd1 Rat mono(2-ethylhexyl) phthalate increases expression ISO ADGRD1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ADGRD1 mRNA CTD PMID:36695872 Adgrd1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ADGRD1 gene CTD PMID:33148267 Adgrd1 Rat nickel atom increases expression ISO ADGRD1 (Homo sapiens) 6480464 Nickel results in increased expression of ADGRD1 mRNA CTD PMID:25583101 Adgrd1 Rat ozone multiple interactions ISO Adgrd1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ADGRD1 mRNA CTD PMID:34911549 Adgrd1 Rat paracetamol decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ADGRD1 mRNA CTD PMID:26690555 Adgrd1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ADGRD1 mRNA CTD PMID:33387578 Adgrd1 Rat paracetamol increases expression ISO ADGRD1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ADGRD1 mRNA CTD PMID:29067470 Adgrd1 Rat perfluorooctanoic acid increases expression ISO ADGRD1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ADGRD1 mRNA CTD PMID:36326898 Adgrd1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ADGRD1 gene CTD PMID:33148267 Adgrd1 Rat pirinixic acid increases expression ISO Adgrd1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ADGRD1 mRNA CTD PMID:17426115 Adgrd1 Rat progesterone multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of ADGRD1 mRNA CTD PMID:20660070 Adgrd1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ADGRD1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Adgrd1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO ADGRD1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of ADGRD1 mRNA CTD PMID:35811015 Adgrd1 Rat silicon dioxide decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ADGRD1 mRNA CTD PMID:25895662 Adgrd1 Rat silver atom affects expression ISO Adgrd1 (Mus musculus) 6480464 Silver affects the expression of ADGRD1 mRNA CTD PMID:27131904 Adgrd1 Rat silver(0) affects expression ISO Adgrd1 (Mus musculus) 6480464 Silver affects the expression of ADGRD1 mRNA CTD PMID:27131904 Adgrd1 Rat sodium arsenite decreases expression ISO ADGRD1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ADGRD1 mRNA CTD PMID:29301061 Adgrd1 Rat sodium arsenite decreases expression ISO Adgrd1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ADGRD1 mRNA CTD PMID:37682722 Adgrd1 Rat sulforaphane decreases expression ISO ADGRD1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of ADGRD1 mRNA CTD PMID:31838189 Adgrd1 Rat testosterone decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of ADGRD1 mRNA CTD PMID:33359661 Adgrd1 Rat triadimefon decreases expression ISO ADGRD1 (Homo sapiens) 6480464 triadimefon results in decreased expression of ADGRD1 mRNA CTD PMID:26705709 Adgrd1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ADGRD1 mRNA CTD PMID:33387578 Adgrd1 Rat trichostatin A increases expression ISO ADGRD1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ADGRD1 mRNA CTD PMID:26705709 Adgrd1 Rat triclosan decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Triclosan results in decreased expression of ADGRD1 mRNA CTD PMID:30510588 Adgrd1 Rat tris(2-butoxyethyl) phosphate affects expression ISO ADGRD1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of ADGRD1 mRNA CTD PMID:29024780 Adgrd1 Rat urethane decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Urethane results in decreased expression of ADGRD1 mRNA CTD PMID:28818685 Adgrd1 Rat valproic acid decreases expression ISO ADGRD1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ADGRD1 mRNA CTD PMID:29154799 Adgrd1 Rat valproic acid increases methylation ISO ADGRD1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ADGRD1 gene CTD PMID:29154799 Adgrd1 Rat valproic acid affects expression ISO ADGRD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ADGRD1 mRNA CTD PMID:25979313
1,1,1-trichloroethane (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amiodarone (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cantharidin (ISO) carbon nanotube (ISO) chrysene (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) fluoranthene (ISO) folic acid (ISO) fulvestrant (ISO) genistein (ISO) indometacin (ISO) isoprenaline (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) nickel atom (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (EXP) pirinixic acid (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulforaphane (ISO) testosterone (ISO) triadimefon (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO)
Adgrd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 33,124,981 - 33,239,778 (-) NCBI GRCr8 mRatBN7.2 12 27,488,908 - 27,603,714 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 27,488,908 - 27,603,696 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 12 31,134,806 - 31,249,594 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 31,136,741 - 31,249,118 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 33,062,021 - 33,176,459 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 28,566,102 - 28,658,141 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 29,184,868 - 29,299,574 (-) NCBI Celera Cytogenetic Map 12 q13 NCBI
ADGRD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 130,953,907 - 131,141,469 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 130,953,907 - 131,141,469 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 131,438,452 - 131,626,014 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 130,004,790 - 130,189,786 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 129,963,716 - 130,148,713 NCBI Celera 12 131,051,949 - 131,239,316 (+) NCBI Celera Cytogenetic Map 12 q24.33 NCBI HuRef 12 128,420,616 - 128,608,491 (+) NCBI HuRef CHM1_1 12 131,259,305 - 131,446,861 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 130,993,251 - 131,181,371 (+) NCBI T2T-CHM13v2.0
Adgrd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 129,173,741 - 129,281,663 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 129,173,814 - 129,281,663 (+) Ensembl GRCm39 Ensembl GRCm38 5 129,096,750 - 129,204,599 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 129,096,750 - 129,204,599 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 129,602,625 - 129,710,474 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 129,411,458 - 129,519,307 (+) NCBI MGSCv36 mm8 Celera 5 126,132,426 - 126,249,048 (+) NCBI Celera Cytogenetic Map 5 G1.3 NCBI cM Map 5 67.99 NCBI
Adgrd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955482 1,089,008 - 1,173,633 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955482 1,091,081 - 1,173,087 (-) NCBI ChiLan1.0 ChiLan1.0
ADGRD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 139,024,588 - 139,212,855 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 139,021,152 - 139,209,389 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 128,578,498 - 128,766,463 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 132,773,848 - 132,955,262 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 132,773,848 - 132,955,258 (+) Ensembl panpan1.1 panPan2
ADGRD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 1,255,524 - 1,378,116 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 1,257,415 - 1,377,394 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 1,456,102 - 1,578,574 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 1,501,632 - 1,624,035 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 1,501,632 - 1,623,687 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 1,438,073 - 1,560,385 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 1,534,718 - 1,657,257 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 1,441,986 - 1,564,501 (-) NCBI UU_Cfam_GSD_1.0
Adgrd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 122,890,422 - 122,992,749 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936660 1,730,432 - 1,831,118 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936660 1,728,331 - 1,831,088 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADGRD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 24,059,019 - 24,241,176 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 24,059,667 - 24,241,270 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 25,517,697 - 25,654,544 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADGRD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 126,342,228 - 126,539,633 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 126,343,515 - 126,537,315 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 118,493,828 - 118,679,653 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Adgrd1
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 44 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000058586, ENSRNOT00000073105 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 1331763 Wbc2 White blood cell count QTL 2 3.162 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 12 24234777 31894213 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
77
76
45
25
45
6
203
97
93
44
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058586 ⟹ ENSRNOP00000055384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 27,488,908 - 27,603,696 (-) Ensembl Rnor_6.0 Ensembl 12 31,136,741 - 31,249,118 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000073105 ⟹ ENSRNOP00000066668
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 27,488,908 - 27,603,696 (-) Ensembl Rnor_6.0 Ensembl 12 31,136,741 - 31,249,118 (-) Ensembl
RefSeq Acc Id:
XM_001070157 ⟹ XP_001070157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 33,124,981 - 33,239,778 (-) NCBI mRatBN7.2 12 27,488,908 - 27,603,708 (-) NCBI Rnor_6.0 12 31,134,806 - 31,249,594 (-) NCBI Rnor_5.0 12 33,062,021 - 33,176,459 (-) NCBI RGSC_v3.4 12 28,566,102 - 28,658,141 (-) RGD
Sequence:
CTCTCCACCCAAAGCCACGGGCTGGACTCTGGGCCAACGAGGTGTGGCGGAGCTCAGCTGCGGAGGGAGGCAGCACACACATCACCAAGCTCCAAGCTACGGGCTGAGCTCTGGGCTCTGAGCTCTGA
hide sequence
RefSeq Acc Id:
XM_017598511 ⟹ XP_017454000
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 33,124,981 - 33,239,778 (-) NCBI mRatBN7.2 12 27,488,908 - 27,603,707 (-) NCBI Rnor_6.0 12 31,134,806 - 31,249,594 (-) NCBI
Sequence:
CTCTCCACCCAAAGCCACGGGCTGGACTCTGGGCCAACGAGGTGTGGCGGAGCTCAGCTGCGGA
hide sequence
RefSeq Acc Id:
XM_039090099 ⟹ XP_038946027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 33,142,373 - 33,239,778 (-) NCBI mRatBN7.2 12 27,509,357 - 27,603,714 (-) NCBI
RefSeq Acc Id:
XM_063271783 ⟹ XP_063127853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 33,142,373 - 33,239,778 (-) NCBI
RefSeq Acc Id:
XP_001070157 ⟸ XM_001070157
- Peptide Label:
isoform X1
- Sequence:
MKELPALSCHWVWLFWSFCGFQVCGTQPRAQEHPGFEVLASASHYWPLENVEGIRELQDTTGALRTLNLTVPLSHNATFVFTNDSAYSNLSATVDIMEGKVNKSIYLKEEKGVTFLYYGRYKSSCISN
hide sequence
RefSeq Acc Id:
XP_017454000 ⟸ XM_017598511
- Peptide Label:
isoform X2
- Sequence:
MKELPALSCHWVWLFWSFCGFQVCGTQPRAQEHPGFEVLASASHYWPLENVEGIRELQDTTGDI
hide sequence
Ensembl Acc Id:
ENSRNOP00000066668 ⟸ ENSRNOT00000073105
Ensembl Acc Id:
ENSRNOP00000055384 ⟸ ENSRNOT00000058586
RefSeq Acc Id:
XP_038946027 ⟸ XM_039090099
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063127853 ⟸ XM_063271783
- Peptide Label:
isoform X4
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-03-16
Adgrd1
adhesion G protein-coupled receptor D1
Gpr133
G protein-coupled receptor 133
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-02
Gpr133
G protein-coupled receptor 133
LOC689257
similar to G protein-coupled receptor 133
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC689257
similar to G protein-coupled receptor 133
Symbol and Name status set to provisional
70820 PROVISIONAL
