Symbol:
Tyr
Name:
tyrosinase
RGD ID:
1589755
Description:
Predicted to enable copper ion binding activity; protein homodimerization activity; and tyrosinase activity. Involved in several processes, including response to UV; response to cAMP; and response to vitamin D. Predicted to be located in melanosome and perinuclear region of cytoplasm. Used to study oculocutaneous albinism. Human ortholog(s) of this gene implicated in several diseases, including melanoma (multiple); ocular albinism 1; oculocutaneous albinism (multiple); retinoschisis; and vitiligo. Orthologous to human TYR (tyrosinase); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH 6-propyl-2-thiouracil; actinomycin D; atrazine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C; Tyr_mapped; tyrosinase (albino coat color) (mapped)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TYR (tyrosinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tyr (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tyr (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TYR (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TYR (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tyr (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TYR (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TYR (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tyr (tyrosinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Tyr (tyrosinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TYR (tyrosinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tyr (tyrosinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tyr-1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
tyr-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
tyr-5
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tyr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Tyrem1Kyo
TyrsiaKyo
Genetic Models:
KFRS2/Kyo
DA-Tyrem1Kyo
KFRS2/Kyo-/+
Is Marker For:
Strains:
FHH.BN-(D1Hmgc14-D1Hmgc15 )/Mcwi
KFRS2/Kyo
DA-Tyrem1Kyo
KFRS2/Kyo-/+
F344-TyrC KitH /Kyo
F344-AsipA TyrC KitH /Kyo
F344-TyrC KitH /Hkv
F344-TyrC KitH .LEA-(Tel-D17Got10 )/Hkv
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 150,527,687 - 150,622,857 (-) NCBI GRCr8 mRatBN7.2 1 141,115,036 - 141,210,207 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 141,115,036 - 141,210,207 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 149,090,247 - 149,179,011 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 156,260,901 - 156,349,657 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 149,134,804 - 149,223,566 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 151,012,598 - 151,106,802 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 151,012,598 - 151,106,802 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 157,322,968 - 157,416,594 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 143,641,257 - 143,746,315 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 139,445,261 - 139,532,999 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tyr Rat (+)-artemisinic acid decreases expression ISO TYR (Homo sapiens) 6480464 artemisic acid results in decreased expression of TYR mRNA CTD PMID:23063590 Tyr Rat 17beta-estradiol multiple interactions ISO Tyr (Mus musculus) 6480464 Estradiol inhibits the reaction [imidazole results in increased expression of TYR protein] CTD PMID:3127403 Tyr Rat 1H-imidazole multiple interactions ISO Tyr (Mus musculus) 6480464 Estradiol inhibits the reaction [imidazole results in increased expression of TYR protein] and Estriol inhibits the reaction [imidazole results in increased expression of TYR protein] CTD PMID:3127403 Tyr Rat 1H-imidazole increases expression ISO Tyr (Mus musculus) 6480464 imidazole results in increased expression of TYR protein CTD PMID:3127403 Tyr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tyr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TYR mRNA CTD PMID:21570461 Tyr Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO TYR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased activity of TYR protein CTD PMID:20973933 Tyr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TYR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TYR mRNA CTD PMID:20973933 Tyr Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TYR (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin results in increased activity of TYR protein] which results in increased abundance of Melanins more ... CTD PMID:20973933 Tyr Rat 2-hydroxypropanoic acid affects expression ISO TYR (Homo sapiens) 6480464 Lactic Acid affects the expression of TYR mRNA CTD PMID:30851411 Tyr Rat 2-palmitoylglycerol increases expression ISO TYR (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TYR mRNA CTD PMID:37199045 Tyr Rat 3-(3,4-dihydroxyphenyl)propanoic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of 3 and 4-dihydroxyphenylpropionic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat 3-(3,4-dihydroxyphenyl)propanoic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of 3 and 4-dihydroxyphenylpropionic acid CTD PMID:20685355 Tyr Rat 3-isobutyl-1-methyl-7H-xanthine increases expression ISO Tyr (Mus musculus) 6480464 1-Methyl-3-isobutylxanthine results in increased expression of TYR mRNA CTD PMID:21972008 and PMID:26748310 Tyr Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Tyr (Mus musculus) 6480464 1-Methyl-3-isobutylxanthine results in increased expression of and results in increased activity of TYR protein more ... CTD PMID:21972008 more ... Tyr Rat 3-phenylpropionic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of 3-phenylpropionic acid CTD PMID:20685355 Tyr Rat 3-phenylpropionic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of 3-phenylpropionic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat 4-hydroxynon-2-enal decreases expression ISO TYR (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of TYR mRNA CTD PMID:23489423 Tyr Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions ISO TYR (Homo sapiens) 6480464 Omeprazole affects the N-linked glycosylation of and results in increased degradation of TYR protein and Omeprazole inhibits the reaction [ATP7A protein results in increased activity of TYR protein] CTD PMID:25337692 Tyr Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole decreases expression ISO Tyr (Mus musculus) 6480464 Omeprazole results in decreased expression of TYR protein CTD PMID:25337692 Tyr Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TYR mRNA CTD PMID:25825206 Tyr Rat 7,12-dimethyltetraphene multiple interactions ISO Tyr (Mus musculus) 6480464 [9 more ... CTD PMID:20691676 Tyr Rat 9-cis-retinal multiple interactions ISO TYR (Homo sapiens) 6480464 ALDH1A1 mutant form inhibits the reaction [9-cis-retinal results in increased expression of TYR mRNA] CTD PMID:23489423 Tyr Rat 9-cis-retinal increases expression ISO TYR (Homo sapiens) 6480464 9-cis-retinal results in increased expression of TYR mRNA CTD PMID:23489423 Tyr Rat 9-cis-retinoic acid increases expression ISO TYR (Homo sapiens) 6480464 Alitretinoin results in increased expression of TYR mRNA and Alitretinoin results in increased expression of TYR protein CTD PMID:23489423 Tyr Rat actinomycin D multiple interactions ISO TYR (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Quercetin results in increased activity of TYR protein] CTD PMID:14717847 Tyr Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Phenylephrine results in increased activity of TYR protein] CTD PMID:15278367 Tyr Rat afzelin multiple interactions ISO TYR (Homo sapiens) 6480464 afzelin results in increased expression of and results in increased activity of TYR protein CTD PMID:27287415 Tyr Rat afzelin increases expression ISO TYR (Homo sapiens) 6480464 afzelin results in increased expression of TYR mRNA CTD PMID:27287415 Tyr Rat Alisol B multiple interactions ISO Tyr (Mus musculus) 6480464 alisol B inhibits the reaction [[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased activity of TYR protein] more ... CTD PMID:28051915 Tyr Rat all-trans-retinoic acid increases expression ISO Tyr (Mus musculus) 6480464 Tretinoin results in increased expression of TYR mRNA CTD PMID:11851873 Tyr Rat alpha-melanocyte stimulating hormone multiple interactions ISO Tyr (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytol inhibits the reaction [alpha-MSH results in increased expression of TYR protein]] more ... CTD PMID:28051915 and PMID:29486182 Tyr Rat alpha-melanocyte stimulating hormone increases activity ISO Tyr (Mus musculus) 6480464 alpha-MSH results in increased activity of TYR protein CTD PMID:28051915 Tyr Rat alpha-melanocyte stimulating hormone increases expression ISO Tyr (Mus musculus) 6480464 alpha-MSH results in increased expression of TYR protein CTD PMID:29486182 Tyr Rat amentoflavone decreases activity ISO TYR (Homo sapiens) 6480464 amentoflavone analog results in decreased activity of TYR protein CTD PMID:17473463 Tyr Rat amikacin decreases activity ISO TYR (Homo sapiens) 6480464 Amikacin results in decreased activity of TYR protein CTD PMID:23416261 Tyr Rat apigenin increases expression ISO Tyr (Mus musculus) 6480464 Apigenin results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TYR gene CTD PMID:28931070 Tyr Rat bathocuproine disulfonic acid multiple interactions ISO TYR (Homo sapiens) 6480464 bathocuproine sulfonate inhibits the reaction [ATP7A protein results in increased activity of TYR protein] and cupric chloride inhibits the reaction [bathocuproine sulfonate inhibits the reaction [ATP7A protein results in increased activity of TYR protein]] CTD PMID:11092760 Tyr Rat benzo[a]pyrene increases activity ISO Tyr (Mus musculus) 6480464 Benzo(a)pyrene results in increased activity of TYR protein CTD PMID:34856342 Tyr Rat benzo[a]pyrene multiple interactions ISO Tyr (Mus musculus) 6480464 [Acetylcysteine co-treated with Benzo(a)pyrene] results in increased activity of TYR protein more ... CTD PMID:34856342 Tyr Rat benzo[a]pyrene increases expression ISO Tyr (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TYR mRNA CTD PMID:34856342 Tyr Rat beta-ionone increases expression ISO TYR (Homo sapiens) 6480464 beta-ionone results in increased expression of TYR mRNA and beta-ionone results in increased expression of TYR protein CTD PMID:27226631 Tyr Rat biochanin A increases expression ISO Tyr (Mus musculus) 6480464 biochanin A results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat bis(2-chloroethyl) sulfide decreases expression ISO TYR (Homo sapiens) 6480464 Mustard Gas results in decreased expression of TYR protein CTD PMID:31785464 Tyr Rat bis(2-chloroethyl) sulfide affects expression ISO TYR (Homo sapiens) 6480464 Mustard Gas affects the expression of TYR mRNA CTD PMID:31785464 Tyr Rat bisphenol A increases expression ISO Tyr (Mus musculus) 6480464 bisphenol A results in increased expression of TYR mRNA CTD PMID:30951980 Tyr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TYR mRNA CTD PMID:34947998 Tyr Rat bisphenol F multiple interactions ISO TYR (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of TYR gene CTD PMID:31601247 Tyr Rat cannabidiol multiple interactions ISO TYR (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Cannabidiol results in increased activity of TYR protein] more ... CTD PMID:28601556 Tyr Rat cannabidiol increases expression ISO TYR (Homo sapiens) 6480464 Cannabidiol results in increased expression of TYR mRNA CTD PMID:28601556 Tyr Rat carnosic acid decreases expression ISO Tyr (Mus musculus) 6480464 salvin results in decreased expression of TYR mRNA CTD PMID:21071833 Tyr Rat Carnosol decreases expression ISO Tyr (Mus musculus) 6480464 carnosol results in decreased expression of TYR mRNA and carnosol results in decreased expression of TYR protein CTD PMID:21071833 Tyr Rat chaetocin multiple interactions ISO Tyr (Mus musculus) 6480464 chaetocin inhibits the reaction [1-Methyl-3-isobutylxanthine results in increased activity of TYR protein] more ... CTD PMID:26748310 Tyr Rat chlorogenic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of Chlorogenic Acid CTD PMID:20685355 Tyr Rat chlorogenic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of Chlorogenic Acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat chlorpromazine increases expression ISO TYR (Homo sapiens) 6480464 Chlorpromazine results in increased expression of TYR protein CTD PMID:25449126 Tyr Rat chlorpyrifos decreases expression ISO Tyr (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TYR mRNA CTD PMID:32715474 Tyr Rat chrysin increases expression ISO Tyr (Mus musculus) 6480464 chrysin results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat cis-caffeic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of caffeic acid CTD PMID:20685355 Tyr Rat cis-caffeic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat colforsin daropate hydrochloride multiple interactions ISO Tyr (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one promotes the reaction [Colforsin results in increased expression of TYR protein] more ... CTD PMID:28051915 and PMID:28849034 Tyr Rat colforsin daropate hydrochloride increases expression ISO TYR (Homo sapiens) 6480464 Colforsin results in increased expression of TYR mRNA CTD PMID:23700242 and PMID:28601556 Tyr Rat colforsin daropate hydrochloride increases activity ISO TYR (Homo sapiens) 6480464 Colforsin results in increased activity of TYR protein CTD PMID:17460731 Tyr Rat colforsin daropate hydrochloride multiple interactions ISO TYR (Homo sapiens) 6480464 [resveratrol co-treated with Colforsin] results in decreased activity of TYR protein more ... CTD PMID:17460731 more ... Tyr Rat colforsin daropate hydrochloride decreases expression ISO TYR (Homo sapiens) 6480464 Colforsin results in decreased expression of TYR protein CTD PMID:28849034 Tyr Rat colforsin daropate hydrochloride increases expression ISO Tyr (Mus musculus) 6480464 Colforsin results in increased expression of TYR protein CTD PMID:28849034 Tyr Rat copper atom multiple interactions ISO Tyr (Mus musculus) 6480464 [SLC31A1 gene mutant form affects the abundance of Copper] which results in decreased activity of TYR protein and Copper inhibits the reaction [[SLC31A1 gene mutant form affects the abundance of Copper] which results in decreased activity of TYR protein] CTD PMID:12177073 Tyr Rat copper atom multiple interactions ISO TYR (Homo sapiens) 6480464 [CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in increased oxidation of Levodopa] which results in increased chemical synthesis of Melanins] more ... CTD PMID:23053666 and PMID:23700242 Tyr Rat copper atom affects binding ISO Tyr (Mus musculus) 6480464 TYR protein binds to Copper CTD PMID:11781109 Tyr Rat copper(0) multiple interactions ISO Tyr (Mus musculus) 6480464 [SLC31A1 gene mutant form affects the abundance of Copper] which results in decreased activity of TYR protein and Copper inhibits the reaction [[SLC31A1 gene mutant form affects the abundance of Copper] which results in decreased activity of TYR protein] CTD PMID:12177073 Tyr Rat copper(0) multiple interactions ISO TYR (Homo sapiens) 6480464 [CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in increased oxidation of Levodopa] which results in increased chemical synthesis of Melanins] more ... CTD PMID:23053666 and PMID:23700242 Tyr Rat copper(0) affects binding ISO Tyr (Mus musculus) 6480464 TYR protein binds to Copper CTD PMID:11781109 Tyr Rat copper(II) chloride multiple interactions ISO TYR (Homo sapiens) 6480464 cupric chloride inhibits the reaction [bathocuproine sulfonate inhibits the reaction [ATP7A protein results in increased activity of TYR protein]] CTD PMID:11092760 Tyr Rat cordycepin multiple interactions ISO Tyr (Mus musculus) 6480464 cordycepin inhibits the reaction [1-Methyl-3-isobutylxanthine results in increased expression of TYR mRNA] more ... CTD PMID:21972008 Tyr Rat cyanamide decreases expression ISO TYR (Homo sapiens) 6480464 Cyanamide results in decreased expression of TYR mRNA CTD PMID:23489423 Tyr Rat cycloheximide multiple interactions ISO TYR (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Quercetin results in increased activity of TYR protein] CTD PMID:14717847 Tyr Rat cycloheximide multiple interactions ISO Tyr (Mus musculus) 6480464 [resorcinol co-treated with Cycloheximide] results in increased expression of TYR protein and SB 203580 inhibits the reaction [[resorcinol co-treated with Cycloheximide] results in increased expression of TYR protein] CTD PMID:29621941 Tyr Rat daidzein increases expression ISO Tyr (Mus musculus) 6480464 daidzein results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat dibenziodolium multiple interactions ISO Tyr (Mus musculus) 6480464 [diphenyleneiodonium co-treated with Benzo(a)pyrene] results in increased activity of TYR protein more ... CTD PMID:34856342 Tyr Rat diclofenac decreases expression ISO Tyr (Mus musculus) 6480464 Diclofenac results in decreased expression of TYR protein CTD PMID:21079976 Tyr Rat dimercaprol decreases activity ISO TYR (Homo sapiens) 6480464 Dimercaprol results in decreased activity of TYR protein CTD PMID:16928136 Tyr Rat dopachrome multiple interactions ISO Tyr (Mus musculus) 6480464 [POMC protein modified form results in increased activity of TYR protein] which results in increased chemical synthesis of dopachrome and Quercetin analog inhibits the reaction [[POMC protein modified form results in increased activity of TYR protein] which results in increased chemical synthesis of dopachrome] CTD PMID:26586997 Tyr Rat emodin decreases activity ISO TYR (Homo sapiens) 6480464 Emodin results in decreased activity of TYR protein CTD PMID:26972667 Tyr Rat epoxiconazole increases expression ISO Tyr (Mus musculus) 6480464 epoxiconazole results in increased expression of TYR mRNA CTD PMID:35436446 Tyr Rat estriol multiple interactions ISO Tyr (Mus musculus) 6480464 Estriol inhibits the reaction [imidazole results in increased expression of TYR protein] CTD PMID:3127403 Tyr Rat ethylenediamine multiple interactions ISO TYR (Homo sapiens) 6480464 ethylenediamine inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of Ascorbic Acid] more ... CTD PMID:20685355 Tyr Rat ethylparaben affects response to substance ISO TYR (Homo sapiens) 6480464 TYR protein affects the susceptibility to ethyl-p-hydroxybenzoate CTD PMID:19944085 Tyr Rat fenofibrate decreases expression ISO Tyr (Mus musculus) 6480464 Fenofibrate results in decreased expression of TYR mRNA CTD PMID:23872139 Tyr Rat fenofibrate multiple interactions ISO Tyr (Mus musculus) 6480464 [Fenofibrate results in decreased chemical synthesis of Melanins] which results in decreased expression of TYR more ... CTD PMID:23872139 Tyr Rat ferulic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of ferulic acid CTD PMID:20685355 Tyr Rat ferulic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of ferulic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat fulvestrant multiple interactions ISO TYR (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of TYR gene CTD PMID:31601247 Tyr Rat fulvestrant decreases methylation ISO TYR (Homo sapiens) 6480464 Fulvestrant results in decreased methylation of TYR gene CTD PMID:31601247 Tyr Rat galangin increases expression ISO Tyr (Mus musculus) 6480464 galangin results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat genistein increases expression ISO Tyr (Mus musculus) 6480464 Genistein results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat geranic acid decreases expression ISO Tyr (Mus musculus) 6480464 decaprenoic acid results in decreased expression of TYR protein CTD PMID:23286867 Tyr Rat glabridin multiple interactions ISO Tyr (Mus musculus) 6480464 glabridin inhibits the reaction [[Colforsin co-treated with 1-Methyl-3-isobutylxanthine] results in increased activity of TYR protein] and glabridin inhibits the reaction [alpha-MSH results in increased activity of TYR protein] CTD PMID:28051915 Tyr Rat glutathione multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein affects the susceptibility to caffeic acid phenethyl ester] which affects the abundance of Glutathione more ... CTD PMID:20685355 Tyr Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of TYR mRNA CTD PMID:24395379 Tyr Rat hydroquinone increases expression ISO TYR (Homo sapiens) 6480464 hydroquinone results in increased expression of TYR mRNA and hydroquinone results in increased expression of TYR protein CTD PMID:23738040 Tyr Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO Tyr (Mus musculus) 6480464 Arbutin results in decreased expression of TYR mRNA CTD PMID:21071833 Tyr Rat hydroquinone O-beta-D-glucopyranoside decreases activity ISO Tyr (Mus musculus) 6480464 Arbutin results in decreased activity of TYR protein CTD PMID:22705713 Tyr Rat isorhamnetin increases expression ISO Tyr (Mus musculus) 6480464 3-methylquercetin results in increased expression of TYR protein CTD PMID:24853321 Tyr Rat kenpaullone increases expression ISO Tyr (Mus musculus) 6480464 kenpaullone results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat kojic acid decreases activity ISO Tyr (Mus musculus) 6480464 kojic acid results in decreased activity of TYR protein CTD PMID:27586645 Tyr Rat kojic acid increases expression ISO TYR (Homo sapiens) 6480464 kojic acid results in increased expression of TYR mRNA and kojic acid results in increased expression of TYR protein CTD PMID:23738040 Tyr Rat L-ascorbic acid multiple interactions ISO TYR (Homo sapiens) 6480464 ethylenediamine inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of Ascorbic Acid] and Glutathione inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of Ascorbic Acid] CTD PMID:20685355 Tyr Rat L-ascorbic acid increases oxidation ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of Ascorbic Acid CTD PMID:20685355 Tyr Rat lawsone multiple interactions ISO Tyr (Mus musculus) 6480464 lawsone results in decreased expression of and results in decreased activity of TYR protein CTD PMID:25584612 Tyr Rat loliolide multiple interactions ISO Tyr (Mus musculus) 6480464 loliolide inhibits the reaction [POMC protein alternative form results in increased expression of TYR protein] CTD PMID:30231594 Tyr Rat luteolin increases expression ISO Tyr (Mus musculus) 6480464 Luteolin results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat LY294002 multiple interactions ISO Tyr (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Drugs more ... CTD PMID:21816215 and PMID:28849034 Tyr Rat LY294002 multiple interactions ISO TYR (Homo sapiens) 6480464 [Wortmannin co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one] results in decreased expression of TYR protein CTD PMID:28849034 Tyr Rat mefenamic acid decreases expression ISO Tyr (Mus musculus) 6480464 Mefenamic Acid results in decreased expression of TYR mRNA and Mefenamic Acid results in decreased expression of TYR protein CTD PMID:21079976 Tyr Rat melanins multiple interactions ISO TYR (Homo sapiens) 6480464 [CLDN3 protein results in increased abundance of Copper] promotes the reaction [[TYR protein results in increased oxidation of Levodopa] which results in increased chemical synthesis of Melanins] more ... CTD PMID:11092760 more ... Tyr Rat melanins multiple interactions ISO Tyr (Mus musculus) 6480464 [Fenofibrate results in decreased chemical synthesis of Melanins] which results in decreased expression of TYR CTD PMID:23872139 Tyr Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Tyr (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [scoparone results in increased expression of TYR protein] CTD PMID:17049123 Tyr Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases activity ISO TYR (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased activity of TYR protein CTD PMID:30849679 Tyr Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide decreases activity ISO Tyr (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide results in decreased activity of TYR protein CTD PMID:30849679 Tyr Rat N-acetyl-L-cysteine multiple interactions ISO Tyr (Mus musculus) 6480464 [Acetylcysteine co-treated with 6-formylindolo(3 more ... CTD PMID:34856342 Tyr Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Tyr (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Fenofibrate results in decreased expression of TYR protein] CTD PMID:23872139 Tyr Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Tyr (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of TYR gene CTD PMID:16180137 more ... Tyr Rat N-methyl-N-nitrosourea increases mutagenesis ISO Tyr (Mus musculus) 6480464 Methylnitrosourea results in increased mutagenesis of TYR gene CTD PMID:17174358 Tyr Rat NAD zwitterion multiple interactions ISO TYR (Homo sapiens) 6480464 ethylenediamine inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD] and Glutathione inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD] CTD PMID:20685355 Tyr Rat NAD zwitterion increases oxidation ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD CTD PMID:20685355 Tyr Rat NAD(+) multiple interactions ISO TYR (Homo sapiens) 6480464 ethylenediamine inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD] and Glutathione inhibits the reaction [[TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD] CTD PMID:20685355 Tyr Rat NAD(+) increases oxidation ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of NAD CTD PMID:20685355 Tyr Rat nicotinamide increases expression ISO TYR (Homo sapiens) 6480464 Niacinamide results in increased expression of TYR mRNA and Niacinamide results in increased expression of TYR protein CTD PMID:23738040 Tyr Rat nimesulide decreases expression ISO Tyr (Mus musculus) 6480464 nimesulide results in decreased expression of TYR mRNA and nimesulide results in decreased expression of TYR protein CTD PMID:21079976 Tyr Rat nonanedioic acid decreases expression ISO Tyr (Mus musculus) 6480464 azelaic acid results in decreased expression of TYR protein CTD PMID:20804622 Tyr Rat nonanedioic acid multiple interactions ISO Tyr (Mus musculus) 6480464 [Taurine co-treated with azelaic acid] results in decreased activity of TYR protein and [Taurine co-treated with azelaic acid] results in decreased expression of TYR protein CTD PMID:20804622 Tyr Rat omacetaxine mepesuccinate increases expression ISO Tyr (Mus musculus) 6480464 Homoharringtonine results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat omeprazole decreases expression ISO Tyr (Mus musculus) 6480464 Omeprazole results in decreased expression of TYR protein CTD PMID:25337692 Tyr Rat omeprazole multiple interactions ISO TYR (Homo sapiens) 6480464 Omeprazole affects the N-linked glycosylation of and results in increased degradation of TYR protein and Omeprazole inhibits the reaction [ATP7A protein results in increased activity of TYR protein] CTD PMID:25337692 Tyr Rat phenethyl caffeate multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein affects the susceptibility to caffeic acid phenethyl ester] which affects the abundance of Glutathione more ... CTD PMID:20685355 and PMID:21458432 Tyr Rat phenethyl caffeate increases oxidation ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid phenethyl ester] which results in increased oxidation of Ascorbic Acid more ... CTD PMID:20685355 Tyr Rat phenethyl caffeate affects response to substance ISO TYR (Homo sapiens) 6480464 TYR protein affects the susceptibility to caffeic acid phenethyl ester CTD PMID:20685355 Tyr Rat phenylephrine multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Phenylephrine results in increased activity of TYR protein] and Prazosin inhibits the reaction [Phenylephrine results in increased activity of TYR protein] CTD PMID:15278367 Tyr Rat phenylephrine increases activity EXP 6480464 Phenylephrine results in increased activity of TYR protein CTD PMID:15278367 Tyr Rat phorbol 13-acetate 12-myristate multiple interactions ISO Tyr (Mus musculus) 6480464 [9 more ... CTD PMID:20691676 Tyr Rat phytol multiple interactions ISO Tyr (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytol inhibits the reaction [alpha-MSH results in increased expression of TYR protein]] and Phytol inhibits the reaction [alpha-MSH results in increased expression of TYR protein] CTD PMID:29486182 Tyr Rat pifithrin-alpha hydrobromide decreases expression ISO TYR (Homo sapiens) 6480464 pifithrin results in decreased expression of TYR mRNA and pifithrin results in decreased expression of TYR protein CTD PMID:19098008 Tyr Rat prazosin multiple interactions EXP 6480464 Prazosin inhibits the reaction [Phenylephrine results in increased activity of TYR protein] CTD PMID:15278367 Tyr Rat quercetin multiple interactions ISO TYR (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Quercetin results in increased activity of TYR protein] and Dactinomycin inhibits the reaction [Quercetin results in increased activity of TYR protein] CTD PMID:14717847 Tyr Rat quercetin increases expression ISO Tyr (Mus musculus) 6480464 Quercetin results in increased expression of TYR protein CTD PMID:24318284 Tyr Rat quercetin affects activity ISO TYR (Homo sapiens) 6480464 Quercetin affects the activity of TYR protein CTD PMID:21290442 Tyr Rat quercetin affects expression ISO Tyr (Mus musculus) 6480464 Quercetin affects the expression of TYR protein and Quercetin affects the expression of TYR protein modified form CTD PMID:21290442 Tyr Rat quercetin affects activity ISO Tyr (Mus musculus) 6480464 Quercetin affects the activity of TYR protein CTD PMID:21290442 Tyr Rat quercetin affects expression ISO TYR (Homo sapiens) 6480464 Quercetin affects the expression of TYR protein and Quercetin affects the expression of TYR protein modified form CTD PMID:21290442 Tyr Rat quercetin multiple interactions ISO Tyr (Mus musculus) 6480464 Quercetin analog inhibits the reaction [[POMC protein modified form results in increased activity of TYR protein] which results in increased chemical synthesis of dopachrome] more ... CTD PMID:21290442 and PMID:26586997 Tyr Rat quercetin increases response to substance ISO TYR (Homo sapiens) 6480464 TYR protein results in increased susceptibility to Quercetin CTD PMID:18001220 Tyr Rat quercetin increases metabolic processing ISO TYR (Homo sapiens) 6480464 TYR protein results in increased metabolism of Quercetin CTD PMID:18001220 Tyr Rat quercetin increases activity ISO TYR (Homo sapiens) 6480464 Quercetin results in increased activity of TYR protein CTD PMID:14717847 Tyr Rat rac-lactic acid affects expression ISO TYR (Homo sapiens) 6480464 Lactic Acid affects the expression of TYR mRNA CTD PMID:30851411 Tyr Rat reactive oxygen species multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein affects the susceptibility to caffeic acid phenethyl ester] which affects the abundance of Reactive Oxygen Species CTD PMID:20685355 Tyr Rat resorcinol decreases activity ISO TYR (Homo sapiens) 6480464 resorcinol results in decreased activity of TYR protein CTD PMID:29621941 Tyr Rat resorcinol decreases expression ISO Tyr (Mus musculus) 6480464 resorcinol results in decreased expression of TYR mRNA and resorcinol results in decreased expression of TYR protein CTD PMID:29621941 Tyr Rat resorcinol decreases activity ISO Tyr (Mus musculus) 6480464 resorcinol results in decreased activity of TYR protein CTD PMID:29621941 and PMID:30849679 Tyr Rat resorcinol multiple interactions ISO Tyr (Mus musculus) 6480464 [resorcinol co-treated with Cycloheximide] results in increased expression of TYR protein more ... CTD PMID:25584612 and PMID:29621941 Tyr Rat resveratrol affects localization ISO TYR (Homo sapiens) 6480464 resveratrol affects the localization of TYR protein modified form CTD PMID:17460731 Tyr Rat resveratrol multiple interactions ISO Tyr (Mus musculus) 6480464 resveratrol inhibits the reaction [alpha-MSH results in increased expression of TYR protein] CTD PMID:29486182 Tyr Rat resveratrol increases expression ISO Tyr (Mus musculus) 6480464 resveratrol results in increased expression of TYR mRNA CTD PMID:21071833 Tyr Rat resveratrol decreases expression ISO TYR (Homo sapiens) 6480464 resveratrol results in decreased expression of TYR protein CTD PMID:17460731 Tyr Rat resveratrol decreases activity ISO TYR (Homo sapiens) 6480464 resveratrol results in decreased activity of TYR protein CTD PMID:17460731 Tyr Rat resveratrol multiple interactions ISO TYR (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TYR mRNA and [Resveratrol co-treated with Colforsin] results in decreased activity of TYR protein CTD PMID:17460731 and PMID:23557933 Tyr Rat rottlerin decreases expression ISO Tyr (Mus musculus) 6480464 rottlerin results in decreased expression of TYR mRNA and rottlerin results in decreased expression of TYR protein CTD PMID:21071833 Tyr Rat sanguinarine multiple interactions ISO Tyr (Mus musculus) 6480464 [9 more ... CTD PMID:20691676 Tyr Rat SB 203580 multiple interactions ISO TYR (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Cannabidiol results in increased activity of TYR protein] and SB 203580 inhibits the reaction [Cannabidiol results in increased expression of TYR mRNA] CTD PMID:28601556 Tyr Rat SB 203580 multiple interactions ISO Tyr (Mus musculus) 6480464 SB 203580 inhibits the reaction [[resorcinol co-treated with Cycloheximide] results in increased expression of TYR protein] and SB 203580 inhibits the reaction [resorcinol results in decreased activity of TYR protein] CTD PMID:29621941 Tyr Rat scoparone multiple interactions ISO Tyr (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [scoparone results in increased expression of TYR protein] and scoparone results in increased expression of and results in increased activity of TYR protein CTD PMID:17049123 Tyr Rat scoparone increases expression ISO Tyr (Mus musculus) 6480464 scoparone results in increased expression of TYR mRNA CTD PMID:17049123 Tyr Rat stilbenoid decreases expression ISO Tyr (Mus musculus) 6480464 Stilbenes analog results in decreased expression of TYR mRNA CTD PMID:29042215 Tyr Rat sulforaphane decreases expression ISO Tyr (Mus musculus) 6480464 sulforaphane results in decreased expression of TYR mRNA CTD PMID:21071833 Tyr Rat Sweroside decreases expression ISO Tyr (Mus musculus) 6480464 sweroside results in decreased expression of TYR protein CTD PMID:26051519 Tyr Rat taurine multiple interactions ISO Tyr (Mus musculus) 6480464 [Taurine co-treated with azelaic acid] results in decreased activity of TYR protein and [Taurine co-treated with azelaic acid] results in decreased expression of TYR protein CTD PMID:20804622 Tyr Rat taurine decreases expression ISO Tyr (Mus musculus) 6480464 Taurine results in decreased expression of TYR protein CTD PMID:20804622 Tyr Rat testosterone decreases expression ISO Tyr (Mus musculus) 6480464 Testosterone results in decreased expression of TYR protein CTD PMID:18336327 Tyr Rat theophylline increases expression ISO Tyr (Mus musculus) 6480464 Theophylline results in increased expression of TYR mRNA and Theophylline results in increased expression of TYR protein CTD PMID:21071833 and PMID:32001318 Tyr Rat trans-caffeic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of caffeic acid CTD PMID:20685355 Tyr Rat trans-caffeic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of caffeic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat trans-cinnamic acid increases oxidation ISO TYR (Homo sapiens) 6480464 TYR protein results in increased oxidation of cinnamic acid CTD PMID:20685355 Tyr Rat trans-cinnamic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [TYR protein results in increased oxidation of cinnamic acid] which results in decreased abundance of Glutathione CTD PMID:20685355 Tyr Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TYR mRNA CTD PMID:33387578 Tyr Rat valproic acid increases expression ISO TYR (Homo sapiens) 6480464 Valproic Acid results in increased expression of TYR mRNA CTD PMID:27188386 Tyr Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TYR mRNA CTD PMID:35594946 Tyr Rat valproic acid multiple interactions ISO TYR (Homo sapiens) 6480464 [5 more ... CTD PMID:23001511 Tyr Rat vemurafenib increases expression ISO TYR (Homo sapiens) 6480464 Vemurafenib results in increased expression of TYR mRNA and Vemurafenib results in increased expression of TYR protein CTD PMID:26640592 Tyr Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of TYR gene CTD PMID:31079544 Tyr Rat wortmannin multiple interactions ISO TYR (Homo sapiens) 6480464 [Wortmannin co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one] results in decreased expression of TYR protein CTD PMID:28849034 Tyr Rat wortmannin multiple interactions ISO Tyr (Mus musculus) 6480464 [Colforsin co-treated with Wortmannin co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one] results in decreased expression of TYR protein more ... CTD PMID:28849034 Tyr Rat zinc atom multiple interactions ISO TYR (Homo sapiens) 6480464 [Zinc analog co-treated with Copper analog] inhibits the reaction [Colforsin results in increased expression of TYR mRNA] CTD PMID:23700242 Tyr Rat zinc(0) multiple interactions ISO TYR (Homo sapiens) 6480464 [Zinc analog co-treated with Copper analog] inhibits the reaction [Colforsin results in increased expression of TYR mRNA] CTD PMID:23700242
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1.
Tyrosinase as an autoantigen in patients with vitiligo.
Baharav E, etal., Clin Exp Immunol. 1996 Jul;105(1):84-8.
2.
A Tyrosinase missense mutation causes albinism in the Wistar rat.
Blaszczyk WM, etal., Pigment Cell Res. 2005 Apr;18(2):144-5.
3.
Pink-eyed dilution protein controls the processing of tyrosinase.
Chen K, etal., Mol Biol Cell 2002 Jun;13(6):1953-64.
4.
Immunity to melanin and to tyrosinase in melanoma patients, and in people with vitiligo.
Dordic M, etal., BMC Complement Altern Med. 2012 Jul 26;12:109.
5.
Autosomal recessive ocular albinism associated with a functionally significant tyrosinase gene polymorphism.
Fukai K, etal., Nat Genet. 1995 Jan;9(1):92-5.
6.
Tyrosinase-like polypeptides in the uterus and in the central nervous system of rats.
Garai J, etal., Steroids. 1992 Apr;57(4):183-8.
7.
AAV-mediated tyrosinase gene transfer restores melanogenesis and retinal function in a model of oculo-cutaneous albinism type I (OCA1).
Gargiulo A, etal., Mol Ther. 2009 Aug;17(8):1347-54. doi: 10.1038/mt.2009.112. Epub 2009 May 12.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
A transgenic mouse model with inducible Tyrosinase gene expression using the tetracycline (Tet-on) system allows regulated rescue of abnormal chiasmatic projections found in albinism.
Gimenez E, etal., Pigment Cell Res. 2004 Aug;17(4):363-70.
10.
Assessment of tyrosinase variants and skin cancer risk in a large cohort of French subjects.
Hu HH, etal., J Dermatol Sci. 2011 Nov;64(2):127-33. doi: 10.1016/j.jdermsci.2011.07.003. Epub 2011 Aug 22.
11.
Tyrosinase is the modifier of retinoschisis in mice.
Johnson BA, etal., Genetics. 2010 Dec;186(4):1337-44. doi: 10.1534/genetics.110.120840. Epub 2010 Sep 27.
12.
Mutation spectrum of the TYR and SLC45A2 genes in patients with oculocutaneous albinism.
Ko JM, etal., Mol Med Rep. 2012 Apr;5(4):943-8. doi: 10.3892/mmr.2012.764. Epub 2012 Jan 25.
13.
Peripheral blood tyrosinase messenger RNA detection and survival in malignant melanoma.
Kunter U, etal., J Natl Cancer Inst. 1996 May 1;88(9):590-4.
14.
Molecular basis of mouse Himalayan mutation.
Kwon BS, etal., Biochem Biophys Res Commun. 1989 May 30;161(1):252-60.
15.
A novel missense mutation of the TYR gene in a pedigree with oculocutaneous albinism type 1 from China.
Lin YY, etal., Chin Med J (Engl). 2011 Oct;124(20):3358-61.
16.
Tyrosinase gene (TYR) mutations in Chinese patients with oculocutaneous albinism type 1.
Liu J, etal., Clin Experiment Ophthalmol. 2010 Jan;38(1):37-42. doi: 10.1111/j.1442-9071.2009.02220.x.
17.
Efficient gene targeting by TAL effector nucleases coinjected with exonucleases in zygotes.
Mashimo T, etal., Sci Rep. 2013;3:1253. doi: 10.1038/srep01253. Epub 2013 Feb 13.
18.
Melanin precursors prevent premature age-related and noise-induced hearing loss in albino mice.
Murillo-Cuesta S, etal., Pigment Cell Melanoma Res. 2010 Feb;23(1):72-83. doi: 10.1111/j.1755-148X.2009.00646.x. Epub 2009 Oct 19.
19.
Absence of strial melanin coincides with age-associated marginal cell loss and endocochlear potential decline.
Ohlemiller KK, etal., Hear Res. 2009 Mar;249(1-2):1-14. doi: 10.1016/j.heares.2008.12.005. Epub 2008 Dec 25.
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
Mutations of the tyrosinase gene in three Korean patients with type I oculocutaneous albinism.
Park KC, etal., Jpn J Hum Genet. 1996 Sep;41(3):299-305.
22.
Vitamin D nutrition increases skin tyrosinase response to exposure to ultraviolet radiation.
Pavlovitch JH, etal., Mol Cell Endocrinol. 1982 Mar;25(3):295-302.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Comprehensive gene review and curation
RGD comprehensive gene curation
28.
Information Derived from GenBank Report
RGD, Sept. 2003
29.
Loss of tyrosinase activity confers increased skin tumor susceptibility in mice.
Saran A, etal., Oncogene. 2004 May 20;23(23):4130-5.
30.
Molecular basis of dark-eyed albinism in the mouse.
Schmidt A and Beermann F, Proc Natl Acad Sci U S A. 1994 May 24;91(11):4756-60.
31.
Melanization in albino mice transformed by introducing cloned mouse tyrosinase gene.
Tanaka S, etal., Development. 1990 Feb;108(2):223-7.
32.
Tyrosinase gene mutations in type I (tyrosinase-deficient) oculocutaneous albinism define two clusters of missense substitutions.
Tripathi RK, etal., Am J Med Genet. 1992 Jul 15;43(5):865-71.
33.
Prognosis of metastatic melanoma: no correlation of tyrosinase mRNA in bone marrow and survival time.
Waldmann V, etal., Recent Results Cancer Res. 2001;158:118-25.
34.
[Study of tyrosinase gene mutation in oculocutaneous albinism type 1 patients].
Zheng H, etal., Zhongguo Ying Yong Sheng Li Xue Za Zhi. 2011 Aug;27(3):329-32.
Tyr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 150,527,687 - 150,622,857 (-) NCBI GRCr8 mRatBN7.2 1 141,115,036 - 141,210,207 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 141,115,036 - 141,210,207 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 149,090,247 - 149,179,011 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 156,260,901 - 156,349,657 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 149,134,804 - 149,223,566 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 151,012,598 - 151,106,802 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 151,012,598 - 151,106,802 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 157,322,968 - 157,416,594 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 143,641,257 - 143,746,315 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 139,445,261 - 139,532,999 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
TYR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 89,177,875 - 89,295,759 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 89,177,875 - 89,295,759 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 88,911,043 - 89,028,927 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 88,550,688 - 88,668,575 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 88,550,687 - 88,668,474 NCBI Celera 11 85,603,013 - 85,720,910 (-) NCBI Celera Cytogenetic Map 11 q14.3 NCBI HuRef 11 85,151,456 - 85,265,865 (+) NCBI HuRef CHM1_1 11 88,794,044 - 88,911,928 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 89,097,534 - 89,215,415 (+) NCBI T2T-CHM13v2.0
Tyr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 87,073,979 - 87,142,637 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 87,073,979 - 87,142,720 (-) Ensembl GRCm39 Ensembl GRCm38 7 87,424,771 - 87,493,512 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 87,424,771 - 87,493,512 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 94,575,915 - 94,641,921 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 87,303,166 - 87,369,172 (-) NCBI MGSCv36 mm8 Celera 7 84,786,868 - 84,854,808 (-) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 49.01 NCBI
Tyr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 4,244,035 - 4,314,001 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 4,244,035 - 4,314,001 (-) NCBI ChiLan1.0 ChiLan1.0
TYR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 90,055,036 - 90,172,775 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 91,099,017 - 91,216,729 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 84,188,557 - 84,306,686 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 87,769,989 - 87,888,138 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 87,769,606 - 87,888,138 (+) Ensembl panpan1.1 panPan2
TYR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 10,799,940 - 10,894,187 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 10,799,940 - 10,894,191 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 10,649,581 - 10,749,918 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 10,980,195 - 11,074,816 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 10,980,195 - 11,074,820 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 10,768,466 - 10,862,962 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 10,834,102 - 10,934,647 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 10,884,281 - 10,984,898 (-) NCBI UU_Cfam_GSD_1.0
Tyr
TYR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 22,517,047 - 22,604,290 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 22,517,047 - 22,604,290 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 25,164,768 - 25,214,580 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TYR
Tyr
.
Predicted Target Of
Count of predictions: 529 Count of miRNA genes: 257 Interacting mature miRNAs: 326 Transcripts: ENSRNOT00000021971 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
RH133723
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 141,116,373 - 141,116,572 (+) MAPPER mRatBN7.2 Rnor_6.0 1 151,013,936 - 151,014,134 NCBI Rnor6.0 Rnor_5.0 1 157,324,306 - 157,324,504 UniSTS Rnor5.0 RGSC_v3.4 1 143,642,595 - 143,642,793 UniSTS RGSC3.4 Celera 1 139,446,599 - 139,446,797 UniSTS RH 3.4 Map 1 1113.39 UniSTS Cytogenetic Map 1 q32 UniSTS
This gene Tyr is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
10
16
97
51
49
19
24
19
6
112
62
77
15
29
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021971 ⟹ ENSRNOP00000021971
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 141,115,036 - 141,210,207 (-) Ensembl Rnor_6.0 Ensembl 1 151,012,598 - 151,106,802 (-) Ensembl
RefSeq Acc Id:
NM_001107535 ⟹ NP_001101005
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 150,527,687 - 150,622,857 (-) NCBI mRatBN7.2 1 141,115,036 - 141,210,207 (-) NCBI Rnor_6.0 1 151,012,598 - 151,106,802 (-) NCBI Rnor_5.0 1 157,322,968 - 157,416,594 (-) NCBI RGSC_v3.4 1 143,641,257 - 143,746,315 (-) RGD Celera 1 139,445,261 - 139,532,999 (-) RGD
Sequence:
GGAAAAGAAGTCTGTGACACTCATTAACTTGTTTGAGCAGATCTTGTACGGTCTAAAGGGAAAAATGTTCTTGGCTGTTTTGTATTACCTTCTGTGGAGTTTTCAGACCTCTGCTGGCCATTTTCCTC
hide sequence
RefSeq Acc Id:
NP_001101005 ⟸ NM_001107535
- Peptide Label:
precursor
- UniProtKB:
D4A9G4 (UniProtKB/TrEMBL), A6I5Y6 (UniProtKB/TrEMBL)
- Sequence:
MFLAVLYYLLWSFQTSAGHFPRDCASSKNLMAKECCPPWMGDGSPCGHLSGRGSCQDILLSNAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRLLIRRNIFDLSA
hide sequence
Ensembl Acc Id:
ENSRNOP00000021971 ⟸ ENSRNOT00000021971
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2007-02-12
tyrosinase
Tyr
tyrosinase (albino coat color) (mapped)
Name updated to reflect Human and Mouse nomenclature
1299863 PROVISIONAL
2007-02-12
Tyr
tyrosinase (albino coat color) (mapped)
Tyr_mapped
tyrosinase (albino coat color) (mapped)
Data merged from RGD:3922
1299863 PROVISIONAL
2006-11-19
Tyr
tyrosinase (albino coat color) (mapped)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-11-17
Tyr_mapped
tyrosinase (albino coat color) (mapped)
Tyr
tyrosinase
Symbol and Name updated
1556543 APPROVED
2002-06-10
Tyr
Tyrosinase (albino coat color)
Symbol and Name status set to approved
70586 APPROVED
