Symbol:
Dtx3
Name:
deltex E3 ubiquitin ligase 3
RGD ID:
1566181
Description:
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in Notch signaling pathway and protein ubiquitination. Predicted to be located in cytoplasm. Predicted to be active in nucleoplasm. Orthologous to human DTX3 (deltex E3 ubiquitin ligase 3); PARTICIPATES IN Notch signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deltex 3 homolog; deltex 3 homolog (Drosophila); deltex 3, E3 ubiquitin ligase; deltex homolog 3; deltex homolog 3 (Drosophila); LOC500847; probable E3 ubiquitin-protein ligase DTX3; protein deltex-3; RGD1566181; similar to Deltex3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 64,898,693 - 64,904,636 (-) NCBI GRCr8 mRatBN7.2 7 63,013,769 - 63,018,431 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,013,371 - 63,018,522 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 64,903,070 - 64,907,731 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,105,474 - 67,110,135 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 66,906,542 - 66,911,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,476,737 - 70,482,852 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,476,729 - 70,481,796 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,654,378 - 70,660,222 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,145,276 - 67,149,937 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 60,155,333 - 60,160,117 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dtx3 Rat 1,2-dimethylhydrazine increases expression ISO Dtx3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DTX3 mRNA CTD PMID:22206623 Dtx3 Rat 17alpha-ethynylestradiol increases expression ISO Dtx3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of DTX3 mRNA CTD PMID:17942748 Dtx3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of DTX3 mRNA CTD PMID:29097150 Dtx3 Rat 17alpha-ethynylestradiol multiple interactions ISO Dtx3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DTX3 mRNA CTD PMID:17942748 Dtx3 Rat 17beta-estradiol decreases expression ISO DTX3 (Homo sapiens) 6480464 Estradiol results in decreased expression of DTX3 mRNA CTD PMID:31614463 Dtx3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dtx3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with AHR gene mutant form] results in increased expression of DTX3 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DTX3 mRNA CTD PMID:17942748 and PMID:19465110 Dtx3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DTX3 mRNA CTD PMID:34747641 Dtx3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DTX3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DTX3 mRNA CTD PMID:21296121 Dtx3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of DTX3 mRNA CTD PMID:36041667 Dtx3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DTX3 mRNA CTD PMID:30047161 Dtx3 Rat acrolein multiple interactions ISO DTX3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of DTX3 mRNA CTD PMID:32845096 Dtx3 Rat aflatoxin B1 decreases methylation ISO DTX3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DTX3 gene CTD PMID:27153756 Dtx3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of DTX3 mRNA CTD PMID:30047161 Dtx3 Rat antirheumatic drug increases expression ISO DTX3 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DTX3 mRNA CTD PMID:24449571 Dtx3 Rat benzo[a]pyrene increases methylation ISO DTX3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DTX3 promoter CTD PMID:27901495 Dtx3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO DTX3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of DTX3 mRNA CTD PMID:31163220 Dtx3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Dtx3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of DTX3 mRNA CTD PMID:33754040 Dtx3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DTX3 mRNA CTD PMID:25181051 Dtx3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of DTX3 mRNA CTD PMID:36041667 Dtx3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DTX3 mRNA CTD PMID:34947998 Dtx3 Rat bisphenol F decreases expression ISO Dtx3 (Mus musculus) 6480464 bisphenol F results in decreased expression of DTX3 mRNA CTD PMID:38685157 Dtx3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of DTX3 mRNA CTD PMID:36041667 Dtx3 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of DTX3 mRNA CTD PMID:32479839 Dtx3 Rat cadmium dichloride increases expression ISO DTX3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DTX3 mRNA CTD PMID:38568856 Dtx3 Rat CGP 52608 multiple interactions ISO DTX3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DTX3 gene] CTD PMID:28238834 Dtx3 Rat chlordecone decreases expression ISO Dtx3 (Mus musculus) 6480464 Chlordecone results in decreased expression of DTX3 mRNA CTD PMID:33711761 Dtx3 Rat chlorpyrifos increases expression ISO Dtx3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DTX3 mRNA CTD PMID:37019170 Dtx3 Rat choline multiple interactions ISO Dtx3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DTX3 mRNA CTD PMID:20938992 Dtx3 Rat Dibutyl phosphate affects expression ISO DTX3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DTX3 mRNA CTD PMID:37042841 Dtx3 Rat dorsomorphin multiple interactions ISO DTX3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTX3 mRNA CTD PMID:27188386 Dtx3 Rat doxorubicin affects expression ISO DTX3 (Homo sapiens) 6480464 Doxorubicin affects the expression of DTX3 mRNA CTD PMID:29803840 Dtx3 Rat enzalutamide affects expression ISO DTX3 (Homo sapiens) 6480464 enzalutamide affects the expression of DTX3 mRNA CTD PMID:30940724 Dtx3 Rat ethanol multiple interactions ISO Dtx3 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of DTX3 mRNA CTD PMID:30319688 Dtx3 Rat folic acid multiple interactions ISO Dtx3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DTX3 mRNA CTD PMID:20938992 Dtx3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DTX3 mRNA CTD PMID:33387578 Dtx3 Rat glyphosate increases expression ISO DTX3 (Homo sapiens) 6480464 Glyphosate results in increased expression of DTX3 mRNA CTD PMID:31295307 Dtx3 Rat hydrogen peroxide affects expression ISO DTX3 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of DTX3 mRNA CTD PMID:20044591 Dtx3 Rat hypochlorous acid decreases expression ISO Dtx3 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of DTX3 mRNA CTD PMID:19376150 Dtx3 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of DTX3 mRNA CTD PMID:21396975 Dtx3 Rat L-methionine multiple interactions ISO Dtx3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DTX3 mRNA CTD PMID:20938992 Dtx3 Rat methamphetamine increases expression ISO Dtx3 (Mus musculus) 6480464 Methamphetamine results in increased expression of DTX3 mRNA CTD PMID:26307267 Dtx3 Rat methamphetamine increases methylation ISO Dtx3 (Mus musculus) 6480464 Methamphetamine results in increased methylation of DTX3 promoter CTD PMID:26307267 Dtx3 Rat nickel atom decreases expression ISO DTX3 (Homo sapiens) 6480464 Nickel results in decreased expression of DTX3 mRNA CTD PMID:25583101 Dtx3 Rat nickel sulfate decreases expression ISO DTX3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of DTX3 mRNA CTD PMID:22714537 Dtx3 Rat ozone multiple interactions ISO DTX3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in decreased expression of DTX3 mRNA CTD PMID:32845096 Dtx3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dtx3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of DTX3 mRNA CTD PMID:36331819 Dtx3 Rat SB 431542 multiple interactions ISO DTX3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTX3 mRNA CTD PMID:27188386 Dtx3 Rat sodium arsenite decreases expression ISO DTX3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DTX3 mRNA CTD PMID:34032870 Dtx3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of DTX3 mRNA CTD PMID:30047161 Dtx3 Rat sunitinib decreases expression ISO DTX3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DTX3 mRNA CTD PMID:31533062 Dtx3 Rat temozolomide decreases expression ISO DTX3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DTX3 mRNA CTD PMID:31758290 Dtx3 Rat titanium dioxide increases expression ISO Dtx3 (Mus musculus) 6480464 titanium dioxide results in increased expression of DTX3 mRNA CTD PMID:29264374 Dtx3 Rat valproic acid decreases expression ISO DTX3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DTX3 mRNA CTD PMID:23179753 more ... Dtx3 Rat valproic acid multiple interactions ISO DTX3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DTX3 mRNA CTD PMID:27188386 Dtx3 Rat zinc sulfate increases expression ISO DTX3 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of DTX3 mRNA CTD PMID:16330358 Dtx3 Rat zoledronic acid increases expression ISO DTX3 (Homo sapiens) 6480464 zoledronic acid results in increased expression of DTX3 mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
Dtx3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 64,898,693 - 64,904,636 (-) NCBI GRCr8 mRatBN7.2 7 63,013,769 - 63,018,431 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,013,371 - 63,018,522 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 64,903,070 - 64,907,731 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,105,474 - 67,110,135 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 66,906,542 - 66,911,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,476,737 - 70,482,852 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,476,729 - 70,481,796 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,654,378 - 70,660,222 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,145,276 - 67,149,937 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 60,155,333 - 60,160,117 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
DTX3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 57,604,824 - 57,609,802 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 57,604,622 - 57,609,804 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 57,998,607 - 58,003,585 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 56,284,871 - 56,289,850 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 56,284,870 - 56,289,850 NCBI Celera 12 57,654,419 - 57,659,398 (+) NCBI Celera Cytogenetic Map 12 q13.3 NCBI HuRef 12 55,036,290 - 55,041,268 (+) NCBI HuRef CHM1_1 12 57,966,420 - 57,971,399 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 57,572,308 - 57,578,021 (+) NCBI T2T-CHM13v2.0
Dtx3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 127,026,242 - 127,032,367 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 127,026,247 - 127,031,597 (-) Ensembl GRCm39 Ensembl GRCm38 10 127,190,373 - 127,196,498 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 127,190,378 - 127,195,728 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 126,627,434 - 126,632,765 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 126,593,327 - 126,598,658 (-) NCBI MGSCv36 mm8 Celera 10 129,583,408 - 129,588,773 (-) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 74.5 NCBI
Dtx3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 5,328,725 - 5,334,092 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 5,328,723 - 5,334,092 (+) NCBI ChiLan1.0 ChiLan1.0
DTX3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 36,731,185 - 36,734,797 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 36,727,956 - 36,731,568 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 31,316,968 - 31,322,340 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 31,576,351 - 31,581,819 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 31,577,001 - 31,579,669 (-) Ensembl panpan1.1 panPan2
DTX3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 1,684,394 - 1,687,244 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 1,683,410 - 1,686,814 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 1,745,460 - 1,750,402 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 1,691,642 - 1,696,581 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 1,691,625 - 1,696,579 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 1,669,425 - 1,674,360 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 1,911,185 - 1,916,104 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 2,036,415 - 2,041,352 (+) NCBI UU_Cfam_GSD_1.0
Dtx3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 57,115,836 - 57,121,204 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936646 1,751,387 - 1,754,353 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936646 1,749,061 - 1,754,399 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DTX3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 22,867,711 - 22,873,393 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 22,867,691 - 22,873,413 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 24,734,097 - 24,820,351 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DTX3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 53,512,657 - 53,517,978 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 53,515,043 - 53,517,330 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 192,444,161 - 192,449,230 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dtx3
.
Predicted Target Of
Count of predictions: 132 Count of miRNA genes: 99 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000006815 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
RH137001
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 63,020,091 - 63,020,271 (+) MAPPER mRatBN7.2 Rnor_6.0 7 70,484,032 - 70,484,211 NCBI Rnor6.0 Rnor_5.0 7 70,661,276 - 70,661,455 UniSTS Rnor5.0 RGSC_v3.4 7 67,151,552 - 67,151,731 UniSTS RGSC3.4 Celera 7 60,161,688 - 60,161,867 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006815 ⟹ ENSRNOP00000006815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 70,477,135 - 70,481,796 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090057 ⟹ ENSRNOP00000070751
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,013,371 - 63,018,522 (-) Ensembl Rnor_6.0 Ensembl 7 70,476,729 - 70,480,724 (-) Ensembl
RefSeq Acc Id:
NM_001191989 ⟹ NP_001178918
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,899,091 - 64,903,752 (-) NCBI mRatBN7.2 7 63,013,769 - 63,018,431 (-) NCBI Rnor_6.0 7 70,477,135 - 70,481,796 (-) NCBI Rnor_5.0 7 70,654,378 - 70,660,222 (-) NCBI Celera 7 60,155,333 - 60,160,117 (-) NCBI
Sequence:
CAATGGCGGCGCTGACGAGAGGATCTCCCTCTGCACTGGGAGAAAAAGAGAAGTTAGCCTGATGAAGTTCCTTGAGCAACTTGGAGAGGATCCTGCAGGAGAGAGGAAATAGAGGAGCGTTTTCTTTC
hide sequence
RefSeq Acc Id:
XM_063264107 ⟹ XP_063120177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,904,635 (-) NCBI
RefSeq Acc Id:
XM_063264108 ⟹ XP_063120178
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,904,636 (-) NCBI
RefSeq Acc Id:
XM_063264109 ⟹ XP_063120179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,904,631 (-) NCBI
RefSeq Acc Id:
XM_063264110 ⟹ XP_063120180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,904,626 (-) NCBI
RefSeq Acc Id:
XM_063264111 ⟹ XP_063120181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,903,685 (-) NCBI
RefSeq Acc Id:
XM_063264112 ⟹ XP_063120182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 64,898,693 - 64,904,627 (-) NCBI
RefSeq Acc Id:
NP_001178918 ⟸ NM_001191989
- UniProtKB:
F1LY78 (UniProtKB/TrEMBL)
- Sequence:
MSFVLSRMAACGGSCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPELHRPGPPPLRAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000070751 ⟸ ENSRNOT00000090057
Ensembl Acc Id:
ENSRNOP00000006815 ⟸ ENSRNOT00000006815
RefSeq Acc Id:
XP_063120178 ⟸ XM_063264108
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063120177 ⟸ XM_063264107
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063120179 ⟸ XM_063264109
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063120182 ⟸ XM_063264112
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JYQ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120180 ⟸ XM_063264110
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JYQ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120181 ⟸ XM_063264111
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JYQ5 (UniProtKB/TrEMBL)
RGD ID: 13695252 Promoter ID: EPDNEW_R5777 Type: multiple initiation site Name: Dtx3_1 Description: deltex E3 ubiquitin ligase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 70,481,810 - 70,481,870 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-22
Dtx3
deltex E3 ubiquitin ligase 3
Dtx3
deltex 3, E3 ubiquitin ligase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-02-06
Dtx3
deltex 3, E3 ubiquitin ligase
Dtx3
deltex homolog 3 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-03-24
Dtx3
deltex homolog 3 (Drosophila)
Dtx3
deltex 3 homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Dtx3
deltex 3 homolog (Drosophila)
RGD1566181_predicted
similar to Deltex3 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1566181_predicted
similar to Deltex3 (predicted)
LOC500847
similar to Deltex3
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500847
similar to Deltex3
Symbol and Name status set to provisional
70820 PROVISIONAL
