Symbol:
Bbs10
Name:
Bardet-Biedl syndrome 10
RGD ID:
1560748
Description:
Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity. Predicted to be involved in chaperone-mediated protein complex assembly; non-motile cilium assembly; and photoreceptor cell maintenance. Predicted to act upstream of or within several processes, including neuronal action potential; retina morphogenesis in camera-type eye; and visual perception. Human ortholog(s) of this gene implicated in Bardet-Biedl syndrome and Bardet-Biedl syndrome 10. Orthologous to human BBS10 (Bardet-Biedl syndrome 10); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Bardet-Biedl syndrome 10 (human); LOC500832; RGD1560748; similar to hypothetical protein FLJ23560
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,637,324 - 48,640,395 (+) NCBI GRCr8 mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,650,683 - 48,653,709 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 50,853,830 - 50,856,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,631,584 - 50,634,610 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,317,863 - 50,320,886 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 43,552,129 - 43,555,152 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bbs10 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BBS10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat 1,2-dimethylhydrazine decreases expression ISO Bbs10 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BBS10 mRNA CTD PMID:22206623 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BBS10 mRNA CTD PMID:32109520 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bbs10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BBS10 mRNA CTD PMID:31961203 Bbs10 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Bbs10 Rat 2-hydroxypropanoic acid decreases expression ISO BBS10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BBS10 mRNA CTD PMID:30851411 Bbs10 Rat 4,4'-sulfonyldiphenol decreases expression ISO Bbs10 (Mus musculus) 6480464 bisphenol S results in decreased expression of BBS10 mRNA CTD PMID:39298647 Bbs10 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat aflatoxin M1 decreases expression ISO BBS10 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of BBS10 mRNA CTD PMID:30928695 Bbs10 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat benzo[a]pyrene affects methylation ISO BBS10 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BBS10 promoter CTD PMID:27901495 Bbs10 Rat bis(2-ethylhexyl) phthalate increases expression ISO Bbs10 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BBS10 mRNA CTD PMID:21318169 and PMID:34319233 Bbs10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BBS10 mRNA CTD PMID:25181051 and PMID:32145629 Bbs10 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BBS10 gene CTD PMID:28505145 Bbs10 Rat cadmium dichloride decreases expression ISO BBS10 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BBS10 mRNA CTD PMID:38568856 Bbs10 Rat calcitriol increases expression ISO BBS10 (Homo sapiens) 6480464 Calcitriol results in increased expression of BBS10 mRNA CTD PMID:16002434 Bbs10 Rat carbon nanotube increases expression ISO Bbs10 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of BBS10 mRNA CTD PMID:25620056 Bbs10 Rat chlorpyrifos decreases expression ISO Bbs10 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of BBS10 mRNA CTD PMID:37019170 Bbs10 Rat cisplatin decreases expression ISO BBS10 (Homo sapiens) 6480464 Cisplatin results in decreased expression of BBS10 mRNA CTD PMID:27392435 Bbs10 Rat copper(II) sulfate decreases expression ISO BBS10 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BBS10 mRNA CTD PMID:19549813 Bbs10 Rat cyclosporin A decreases expression ISO BBS10 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BBS10 mRNA CTD PMID:20106945 more ... Bbs10 Rat Dibutyl phosphate affects expression ISO BBS10 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BBS10 mRNA CTD PMID:37042841 Bbs10 Rat dicrotophos decreases expression ISO BBS10 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BBS10 mRNA CTD PMID:28302478 Bbs10 Rat dorsomorphin multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat doxorubicin decreases expression ISO BBS10 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BBS10 mRNA CTD PMID:29803840 Bbs10 Rat formaldehyde increases expression ISO BBS10 (Homo sapiens) 6480464 Formaldehyde results in increased expression of BBS10 mRNA CTD PMID:23649840 Bbs10 Rat furan decreases expression ISO Bbs10 (Mus musculus) 6480464 furan results in decreased expression of BBS10 mRNA CTD PMID:24183702 Bbs10 Rat furan decreases expression EXP 6480464 furan results in decreased expression of BBS10 mRNA CTD PMID:25539665 Bbs10 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of BBS10 mRNA CTD PMID:29162477 Bbs10 Rat okadaic acid decreases expression ISO BBS10 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of BBS10 mRNA CTD PMID:38832940 Bbs10 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat phenobarbital affects expression ISO BBS10 (Homo sapiens) 6480464 Phenobarbital affects the expression of BBS10 mRNA CTD PMID:19159669 Bbs10 Rat potassium chromate decreases expression ISO BBS10 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat potassium chromate multiple interactions ISO BBS10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat progesterone increases expression ISO BBS10 (Homo sapiens) 6480464 Progesterone results in increased expression of BBS10 mRNA CTD PMID:18070364 Bbs10 Rat rac-lactic acid decreases expression ISO BBS10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BBS10 mRNA CTD PMID:30851411 Bbs10 Rat SB 431542 multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat sodium arsenite decreases expression ISO BBS10 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BBS10 mRNA CTD PMID:38568856 Bbs10 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of BBS10 mRNA CTD PMID:34492290 Bbs10 Rat titanium dioxide increases expression ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in increased expression of BBS10 mRNA CTD PMID:35295148 Bbs10 Rat titanium dioxide increases methylation ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in increased methylation of BBS10 promoter CTD PMID:35295148 Bbs10 Rat titanium dioxide decreases methylation ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BBS10 gene CTD PMID:35295148 Bbs10 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat trichostatin A decreases expression ISO BBS10 (Homo sapiens) 6480464 trichostatin A results in decreased expression of BBS10 mRNA CTD PMID:24935251 and PMID:26272509 Bbs10 Rat trichostatin A multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat triphenyl phosphate affects expression ISO BBS10 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BBS10 mRNA CTD PMID:37042841 Bbs10 Rat triptonide increases expression ISO Bbs10 (Mus musculus) 6480464 triptonide results in increased expression of BBS10 mRNA CTD PMID:33045310 Bbs10 Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of BBS10 mRNA CTD PMID:36084822 Bbs10 Rat urethane decreases expression ISO BBS10 (Homo sapiens) 6480464 Urethane results in decreased expression of BBS10 mRNA CTD PMID:28818685 Bbs10 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of BBS10 mRNA CTD PMID:23034163 Bbs10 Rat zinc atom decreases expression ISO BBS10 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BBS10 mRNA CTD PMID:22171008 Bbs10 Rat zinc(0) decreases expression ISO BBS10 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BBS10 mRNA CTD PMID:22171008
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin M1 (ISO) amitrole (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) formaldehyde (ISO) furan (EXP,ISO) gentamycin (EXP) methimazole (EXP) Monobutylphthalate (EXP) okadaic acid (ISO) paracetamol (EXP) phenobarbital (ISO) potassium chromate (ISO) progesterone (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) triticonazole (EXP) urethane (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Biological Process
chaperone-mediated protein complex assembly (IBA,IEA,ISO) cone retinal bipolar cell differentiation (IEA,ISO) negative regulation of neuron apoptotic process (IEA,ISO) neuronal action potential (IEA,ISO) non-motile cilium assembly (IEA,ISO) photoreceptor cell differentiation (IEA,ISO) photoreceptor cell maintenance (IEA,ISO) protein localization (IEA,ISO) regulation of protein-containing complex assembly (IEA,ISO) response to endoplasmic reticulum stress (IEA,ISO) response to light stimulus (IEA,ISO) retina development in camera-type eye (IEA,ISO) retinal cone cell differentiation (IEA,ISO) retinal rod cell differentiation (IEA,ISO) visual perception (IEA,ISO)
Bbs10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,637,324 - 48,640,395 (+) NCBI GRCr8 mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,650,683 - 48,653,709 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 50,853,830 - 50,856,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,631,584 - 50,634,610 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,317,863 - 50,320,886 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 43,552,129 - 43,555,152 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
BBS10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 76,344,474 - 76,348,415 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 76,344,474 - 76,348,415 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 76,738,254 - 76,742,195 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 75,262,397 - 75,266,353 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 76,404,216 - 76,408,172 (-) NCBI Celera Cytogenetic Map 12 q21.2 NCBI HuRef 12 73,790,430 - 73,794,386 (-) NCBI HuRef CHM1_1 12 76,703,860 - 76,707,816 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 76,322,395 - 76,326,336 (-) NCBI T2T-CHM13v2.0
Bbs10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 111,134,540 - 111,137,597 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 111,134,540 - 111,137,588 (+) Ensembl GRCm39 Ensembl GRCm38 10 111,298,679 - 111,301,736 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 111,298,679 - 111,301,727 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 110,735,735 - 110,738,792 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 110,702,789 - 110,706,282 (+) NCBI MGSCv36 mm8 Celera 10 113,232,400 - 113,235,457 (+) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 58.46 NCBI
Bbs10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 15,571,073 - 15,574,791 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 15,571,458 - 15,574,568 (-) NCBI ChiLan1.0 ChiLan1.0
BBS10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 84,379,029 - 84,383,696 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 84,375,439 - 84,380,075 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 73,862,775 - 73,867,377 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 76,713,028 - 76,716,956 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 76,713,028 - 76,716,956 (-) Ensembl panpan1.1 panPan2
LOC100688777 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 19,302,988 - 19,334,763 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 19,331,876 - 19,335,583 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 19,788,066 - 19,819,690 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 19,646,036 - 19,657,550 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 15 19,243,010 - 19,274,520 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 19,304,566 - 19,316,044 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 19,432,535 - 19,444,024 (-) NCBI UU_Cfam_GSD_1.0
Bbs10 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 41,082,653 - 41,089,515 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936568 4,638,637 - 4,644,502 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936568 4,640,611 - 4,644,627 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BBS10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 39,557,715 - 39,566,323 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 39,557,716 - 39,566,350 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 43,253,172 - 43,256,444 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BBS10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 71,921,816 - 71,925,164 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 71,921,893 - 71,924,551 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 173,623,293 - 173,626,605 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bbs10
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 38 Interacting mature miRNAs: 41 Transcripts: ENSRNOT00000039096 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH130422
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 46,749,378 - 46,749,592 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,029,601 - 54,029,814 NCBI Rnor6.0 Rnor_5.0 7 54,167,511 - 54,167,724 UniSTS Rnor5.0 Rnor_5.0 7 54,039,365 - 54,039,578 UniSTS Rnor5.0 RGSC_v3.4 7 50,316,140 - 50,316,353 UniSTS RGSC3.4 Celera 7 43,550,406 - 43,550,619 UniSTS RH 3.4 Map 7 391.0 UniSTS Cytogenetic Map 7 q21 UniSTS
BE102942
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 46,753,892 - 46,754,079 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,034,115 - 54,034,301 NCBI Rnor6.0 Rnor_5.0 7 54,043,879 - 54,044,065 UniSTS Rnor5.0 RGSC_v3.4 7 50,320,654 - 50,320,840 UniSTS RGSC3.4 Celera 7 43,554,920 - 43,555,106 UniSTS RH 3.4 Map 7 390.1 UniSTS Cytogenetic Map 7 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039096 ⟹ ENSRNOP00000037320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl
RefSeq Acc Id:
NM_001109286 ⟹ NP_001102756
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,637,365 - 48,640,388 (+) NCBI mRatBN7.2 7 46,751,102 - 46,754,125 (+) NCBI Rnor_6.0 7 54,031,324 - 54,034,347 (+) NCBI Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI RGSC_v3.4 7 50,317,863 - 50,320,886 (+) RGD Celera 7 43,552,129 - 43,555,152 (+) RGD
Sequence:
CATCGGTCCTGACCTTCTAAAGAAGTATTTACCCACAGCTCCGTTTCCATGGCGTCCCAGGGGTCTGTGACAGCGGCACTGCGGGTGGCTGAGGTGCTGGAAACCATCGCGAACCGCTGCGTGGGGCC
hide sequence
RefSeq Acc Id:
XM_006241323 ⟹ XP_006241385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,637,324 - 48,640,395 (+) NCBI mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI
Sequence:
GTGTGTGTGTGAAAAAGATGGGTACAGGCCTGACACGGATTGTGACAGTATCCCTAATGTATGTTTTACTTGGTACTTCATATTCTTTTTTAAAAATAAGTGGAAATTATACCTATTTCATACATTAA
hide sequence
RefSeq Acc Id:
NP_001102756 ⟸ NM_001109286
- UniProtKB:
B1H296 (UniProtKB/TrEMBL)
- Sequence:
MASQGSVTAALRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPLARMIVACVSSHLKKTGDGAKTFIIFLCHLLRGLHAIGEKEKDSFTSEDIQSHERHWKNCCQWKSISRA
hide sequence
RefSeq Acc Id:
XP_006241385 ⟸ XM_006241323
- Peptide Label:
isoform X1
- UniProtKB:
F7EKF1 (UniProtKB/TrEMBL)
- Sequence:
MASQGSVTAALRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPLARGLHAIGEKEKDSFTSEDIQSHERHWKNCCQWKSISRALLRFQTQTLGCIVDQHLSRHYLSAFSSSA
hide sequence
Ensembl Acc Id:
ENSRNOP00000037320 ⟸ ENSRNOT00000039096
RGD ID: 13695189 Promoter ID: EPDNEW_R5714 Type: initiation region Name: Bbs10_1 Description: Bardet-Biedl syndrome 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 54,031,305 - 54,031,365 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-11-05
Bbs10
Bardet-Biedl syndrome 10
Bbs10
Bardet-Biedl syndrome 10 (human)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-28
Bbs10
Bardet-Biedl syndrome 10 (human)
RGD1560748_predicted
similar to hypothetical protein FLJ23560 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1560748_predicted
similar to hypothetical protein FLJ23560 (predicted)
LOC500832
similar to hypothetical protein FLJ23560
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500832
similar to hypothetical protein FLJ23560
Symbol and Name status set to provisional
70820 PROVISIONAL
