Symbol:
Nupr2
Name:
nuclear protein 2, transcriptional regulator
RGD ID:
1560258
Description:
Predicted to be involved in several processes, including cellular response to starvation; negative regulation of cell population proliferation; and negative regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Orthologous to human NUPR2 (nuclear protein 2, transcriptional regulator); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hypothetical protein LOC360799; LOC360799; nuclear protein 2; nuclear protein, transcriptional regulator, 1-like; nuclear transcriptional regulator 1-like protein; Nupr1l; RGD1560258; similar to RIKEN cDNA 4930579G22; uncharacterized protein LOC360799
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NUPR2 (nuclear protein 2, transcriptional regulator) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Nupr2 (nuclear protein transcriptional regulator 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nupr2 (nuclear protein 2, transcriptional regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NUPR2 (nuclear protein 2, transcriptional regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NUPR2 (nuclear protein 2, transcriptional regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NUPR2 (nuclear protein 2, transcriptional regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NUPR2 (nuclear protein 2, transcriptional regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HNF1A (HNF1 homeobox A) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Nupr2 (nuclear protein transcriptional regulator 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NUPR2 (nuclear protein 2, transcriptional regulator)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6770
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 32,436,233 - 32,439,391 (-) NCBI GRCr8 mRatBN7.2 12 26,800,123 - 26,803,228 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 26,799,800 - 26,803,304 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 27,946,416 - 27,949,534 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 28,556,950 - 28,560,070 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 27,618,445 - 27,621,565 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 30,300,936 - 30,304,041 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 30,303,725 - 30,304,036 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 32,245,778 - 32,248,883 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 27,847,750 - 27,850,855 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 28,513,877 - 28,516,982 (-) NCBI Celera Cytogenetic Map 12 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nupr2 Rat 1,2-dichloroethane increases expression ISO Nupr2 (Mus musculus) 6480464 ethylene dichloride results in increased expression of NUPR2 mRNA CTD PMID:28960355 Nupr2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Nupr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nupr2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Nupr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nupr2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Nupr2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Nupr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NUPR2 mRNA CTD PMID:33387578 Nupr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NUPR2 mRNA CTD PMID:21215274 Nupr2 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of NUPR2 mRNA CTD PMID:22952946 Nupr2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of NUPR2 mRNA CTD PMID:28522335 Nupr2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NUPR2 mRNA CTD PMID:36843608 Nupr2 Rat aflatoxin B1 increases methylation ISO NUPR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NUPR2 intron CTD PMID:30157460 Nupr2 Rat benzo[a]pyrene decreases methylation ISO NUPR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NUPR2 promoter CTD PMID:27901495 Nupr2 Rat benzo[a]pyrene increases methylation ISO NUPR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NUPR2 3' UTR CTD PMID:27901495 Nupr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NUPR2 mRNA CTD PMID:25181051 Nupr2 Rat carbon nanotube decreases expression ISO Nupr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nupr2 Rat carbon nanotube increases expression ISO Nupr2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of NUPR2 mRNA CTD PMID:25620056 Nupr2 Rat cisplatin multiple interactions ISO NUPR2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NUPR2 mRNA CTD PMID:27392435 Nupr2 Rat cisplatin increases expression ISO NUPR2 (Homo sapiens) 6480464 Cisplatin results in increased expression of NUPR2 mRNA CTD PMID:27392435 Nupr2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of NUPR2 mRNA CTD PMID:24386269 Nupr2 Rat dextran sulfate increases expression ISO Nupr2 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of NUPR2 mRNA CTD PMID:35093514 Nupr2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of NUPR2 mRNA CTD PMID:24136188 Nupr2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NUPR2 mRNA CTD PMID:33387578 Nupr2 Rat niclosamide increases expression ISO NUPR2 (Homo sapiens) 6480464 Niclosamide results in increased expression of NUPR2 mRNA CTD PMID:36318118 Nupr2 Rat oxaliplatin decreases expression EXP 6480464 Oxaliplatin results in decreased expression of NUPR2 mRNA CTD PMID:25729387 Nupr2 Rat oxaliplatin multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in decreased expression of NUPR2 mRNA CTD PMID:25729387 Nupr2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NUPR2 mRNA CTD PMID:33387578 Nupr2 Rat PCB138 multiple interactions ISO Nupr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nupr2 Rat pirinixic acid increases expression ISO Nupr2 (Mus musculus) 6480464 pirinixic acid results in increased expression of NUPR2 mRNA CTD PMID:23811191 Nupr2 Rat rotenone increases expression ISO NUPR2 (Homo sapiens) 6480464 Rotenone results in increased expression of NUPR2 mRNA CTD PMID:29955902 Nupr2 Rat sodium arsenite decreases expression ISO NUPR2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NUPR2 mRNA CTD PMID:29301061 Nupr2 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of NUPR2 mRNA CTD PMID:24136188 Nupr2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NUPR2 mRNA CTD PMID:33387578 Nupr2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NUPR2 mRNA CTD PMID:34492290 Nupr2 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of NUPR2 mRNA CTD PMID:24136188 Nupr2 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of NUPR2 mRNA CTD PMID:22967744 Nupr2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of NUPR2 mRNA CTD PMID:25729387 Nupr2 Rat topotecan multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in decreased expression of NUPR2 mRNA CTD PMID:25729387 Nupr2 Rat valproic acid increases methylation ISO NUPR2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NUPR2 gene CTD PMID:29154799 Nupr2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NUPR2 mRNA CTD PMID:23034163
1,2-dichloroethane (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,5-hexanedione (EXP) 3-chloropropane-1,2-diol (EXP) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) carbon nanotube (ISO) cisplatin (ISO) cobalt dichloride (EXP) dextran sulfate (ISO) finasteride (EXP) gentamycin (EXP) niclosamide (ISO) oxaliplatin (EXP) paracetamol (EXP) PCB138 (ISO) pirinixic acid (ISO) rotenone (ISO) sodium arsenite (ISO) sulindac (EXP) tetrachloromethane (EXP) thioacetamide (EXP) tolcapone (EXP) toluene (EXP) topotecan (EXP) valproic acid (ISO) vinclozolin (EXP)
Nupr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 32,436,233 - 32,439,391 (-) NCBI GRCr8 mRatBN7.2 12 26,800,123 - 26,803,228 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 26,799,800 - 26,803,304 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 27,946,416 - 27,949,534 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 28,556,950 - 28,560,070 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 27,618,445 - 27,621,565 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 30,300,936 - 30,304,041 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 30,303,725 - 30,304,036 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 32,245,778 - 32,248,883 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 27,847,750 - 27,850,855 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 28,513,877 - 28,516,982 (-) NCBI Celera Cytogenetic Map 12 q13 NCBI
NUPR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 56,114,681 - 56,116,417 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 56,114,681 - 56,116,417 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 56,182,374 - 56,184,110 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 56,149,869 - 56,157,505 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 67,235,281 - 67,237,043 (-) NCBI Celera Cytogenetic Map 7 p11.2 NCBI HuRef 7 55,996,671 - 55,998,401 (-) NCBI HuRef CHM1_1 7 56,185,401 - 56,187,163 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 56,274,492 - 56,276,280 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 56,186,621 - 56,188,337 (-) NCBI
Nupr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 129,937,381 - 129,942,629 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 129,937,381 - 129,942,630 (+) Ensembl GRCm39 Ensembl GRCm38 5 129,908,540 - 129,913,788 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 129,908,540 - 129,913,789 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 130,384,410 - 130,387,151 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 130,193,268 - 130,195,983 (+) NCBI MGSCv36 mm8 Celera 5 126,911,103 - 126,913,757 (+) NCBI Celera Cytogenetic Map 5 G1.3 NCBI cM Map 5 68.26 NCBI
Nupr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 8,268,429 - 8,269,517 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 8,268,429 - 8,269,517 (-) NCBI ChiLan1.0 ChiLan1.0
NUPR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 60,966,842 - 60,968,575 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 109,291,568 - 109,293,307 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 56,727,702 - 56,729,433 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 57,149,240 - 57,150,946 (-) NCBI panpan1.1 PanPan1.1 panPan2
NUPR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 589,882 - 590,763 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 590,410 - 590,706 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 2,289,351 - 2,290,218 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 393,719 - 394,586 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 394,247 - 394,543 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 337,473 - 338,340 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 331,557 - 332,424 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 502,798 - 503,665 (-) NCBI UU_Cfam_GSD_1.0
NUPR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 16,806,900 - 16,807,196 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 16,803,928 - 16,807,843 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 17,059,566 - 17,060,439 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NUPR2
.
Predicted Target Of
Count of predictions: 130 Count of miRNA genes: 105 Interacting mature miRNAs: 112 Transcripts: ENSRNOT00000001218 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 1331763 Wbc2 White blood cell count QTL 2 3.162 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 12 24234777 31894213 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001218 ⟹ ENSRNOP00000001218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 26,799,800 - 26,803,304 (-) Ensembl Rnor_6.0 Ensembl 12 30,303,725 - 30,304,036 (-) Ensembl
RefSeq Acc Id:
NM_001134570 ⟹ NP_001128042
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 32,436,234 - 32,439,339 (-) NCBI mRatBN7.2 12 26,800,123 - 26,803,228 (-) NCBI Rnor_6.0 12 30,300,936 - 30,304,041 (-) NCBI Rnor_5.0 12 32,245,778 - 32,248,883 (-) NCBI RGSC_v3.4 12 27,847,750 - 27,850,855 (-) RGD Celera 12 28,513,877 - 28,516,982 (-) RGD
Sequence:
TAGCGATGGACTCTCCAGTTCGTCCTCCTGTCTCCCGCCCACGGACTCGAGGTCGCCCGCCGCCGCCGCCGGAGGCACTGCCCACTGTCGGCTTAGAAGAGGAGCTGTACGATTGCCTGGACTACCAC
hide sequence
RefSeq Acc Id:
XM_063271496 ⟹ XP_063127566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 32,436,233 - 32,439,391 (-) NCBI
RefSeq Acc Id:
NP_001128042 ⟸ NM_001134570
- UniProtKB:
D3ZTS1 (UniProtKB/TrEMBL), A6J0P2 (UniProtKB/TrEMBL)
- Sequence:
MDSPVRPPVSRPRTRGRPPPPPEALPTVGLEEELYDCLDYHYLRDFPASGAGHSKGRTRREQQLRTNYTVPGGHERKVAQILLNGQRKRRQRQMQPRPRTRLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000001218 ⟸ ENSRNOT00000001218
RefSeq Acc Id:
XP_063127566 ⟸ XM_063271496
- Peptide Label:
isoform X1
- UniProtKB:
A6J0P2 (UniProtKB/TrEMBL), D3ZTS1 (UniProtKB/TrEMBL)
RGD ID: 13698581 Promoter ID: EPDNEW_R9106 Type: initiation region Name: Nupr2_1 Description: nuclear protein 2, transcriptional regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 30,304,078 - 30,304,138 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-30
Nupr2
nuclear protein 2, transcriptional regulator
Nupr1l
nuclear protein, transcriptional regulator, 1-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-11
Nupr1l
nuclear protein, transcriptional regulator, 1-like
RGD1560258
similar to RIKEN cDNA 4930579G22
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1560258
similar to RIKEN cDNA 4930579G22
RGD1560258_predicted
similar to RIKEN cDNA 4930579G22 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1560258_predicted
similar to RIKEN cDNA 4930579G22 (predicted)
LOC360799
similar to RIKEN cDNA 4930579G22
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC360799
similar to RIKEN cDNA 4930579G22
Symbol and Name status set to provisional
70820 PROVISIONAL
