Symbol:
Rlbp1
Name:
retinaldehyde binding protein 1
RGD ID:
1309649
Description:
Predicted to enable 11-cis retinal binding activity and phosphatidylinositol bisphosphate binding activity. Located in cell body. Human ortholog(s) of this gene implicated in Bothnia retinal dystrophy; Newfoundland cone-rod dystrophy; fundus albipunctatus; night blindness; and retinitis pigmentosa. Orthologous to human RLBP1 (retinaldehyde binding protein 1); PARTICIPATES IN altered retinoid cycle metabolic pathway; retinitis pigmentosa pathway; retinoid cycle metabolic pathway; INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC293049; retinaldehyde-binding protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Arrd1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 142,718,262 - 142,731,621 (-) NCBI GRCr8 mRatBN7.2 1 133,308,920 - 133,322,296 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 133,308,938 - 133,322,296 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 141,217,953 - 141,231,346 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 148,387,376 - 148,400,769 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 141,305,075 - 141,318,468 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 141,097,789 - 141,111,375 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 141,097,695 - 141,111,400 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 142,059,882 - 142,073,463 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 135,122,063 - 135,135,420 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 135,201,061 - 135,219,115 (-) NCBI Celera 1 125,372,094 - 125,385,448 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Ocular phenotype of bothnia dystrophy, an autosomal recessive retinitis pigmentosa associated with an R234W mutation in the RLBP1 gene.
Burstedt MS, etal., Arch Ophthalmol. 2001 Feb;119(2):260-7.
2.
Genes and mutations causing retinitis pigmentosa.
Daiger SP, etal., Clin Genet. 2013 Aug;84(2):132-41. doi: 10.1111/cge.12203. Epub 2013 Jun 19.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Localizations of visual cycle components in retinal pigment epithelium.
Huang J, etal., Mol Vis. 2009;15:223-34. Epub 2009 Jan 26.
6.
Fundus albipunctatus and retinitis punctata albescens in a pedigree with an R150Q mutation in RLBP1.
Katsanis N, etal., Clin Genet. 2001 Jun;59(6):424-9.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
The biochemical and structural basis for trans-to-cis isomerization of retinoids in the chemistry of vision.
von Lintig J, etal., Trends Biochem Sci. 2010 Jul;35(7):400-10. Epub 2010 Feb 24.
13.
Photoreceptor degeneration: genetic and mechanistic dissection of a complex trait.
Wright AF, etal., Nat Rev Genet. 2010 Apr;11(4):273-84. doi: 10.1038/nrg2717.
Rlbp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 142,718,262 - 142,731,621 (-) NCBI GRCr8 mRatBN7.2 1 133,308,920 - 133,322,296 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 133,308,938 - 133,322,296 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 141,217,953 - 141,231,346 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 148,387,376 - 148,400,769 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 141,305,075 - 141,318,468 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 141,097,789 - 141,111,375 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 141,097,695 - 141,111,400 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 142,059,882 - 142,073,463 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 135,122,063 - 135,135,420 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 135,201,061 - 135,219,115 (-) NCBI Celera 1 125,372,094 - 125,385,448 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
RLBP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 89,209,869 - 89,221,579 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 89,209,869 - 89,221,614 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 89,753,100 - 89,764,810 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 87,554,102 - 87,565,926 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 87,554,102 - 87,565,926 NCBI Celera 15 66,154,386 - 66,166,204 (-) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 65,865,051 - 65,876,811 (-) NCBI HuRef CHM1_1 15 89,594,080 - 89,605,905 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 86,964,701 - 86,976,409 (-) NCBI T2T-CHM13v2.0
Rlbp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 79,024,613 - 79,041,989 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 79,024,618 - 79,036,796 (-) Ensembl GRCm39 Ensembl GRCm38 7 79,374,865 - 79,392,250 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 79,374,870 - 79,387,048 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 86,519,756 - 86,531,913 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 79,248,384 - 79,258,298 (-) NCBI MGSCv36 mm8 Celera 7 76,771,983 - 76,784,152 (-) NCBI Celera Cytogenetic Map 7 D2 NCBI cM Map 7 45.0 NCBI
Rlbp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 15,862,426 - 15,873,327 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 15,862,510 - 15,873,261 (+) NCBI ChiLan1.0 ChiLan1.0
RLBP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 78,756,312 - 78,769,640 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 82,460,801 - 82,474,300 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 67,901,276 - 67,913,911 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 87,108,815 - 87,117,971 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 87,108,815 - 87,117,971 (-) Ensembl panpan1.1 panPan2
RLBP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 52,260,872 - 52,282,532 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 52,260,944 - 52,282,134 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 54,896,890 - 54,917,412 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 52,679,708 - 52,700,241 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 52,679,781 - 52,700,236 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 52,202,149 - 52,222,270 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 52,412,790 - 52,432,911 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 52,751,756 - 52,772,280 (-) NCBI UU_Cfam_GSD_1.0
Rlbp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 131,236,419 - 131,247,998 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 15,084,756 - 15,096,072 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 15,086,485 - 15,097,980 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RLBP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 54,776,113 - 54,889,014 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 54,783,965 - 54,800,008 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 59,759,346 - 59,775,286 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RLBP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 7,756,742 - 7,769,061 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 7,757,158 - 7,765,777 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 39,059,553 - 39,071,474 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rlbp1
.
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 83 Interacting mature miRNAs: 93 Transcripts: ENSRNOT00000022962 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
RH134202
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 133,309,023 - 133,309,231 (+) MAPPER mRatBN7.2 Rnor_6.0 1 141,097,881 - 141,098,088 NCBI Rnor6.0 Rnor_5.0 1 142,059,969 - 142,060,176 UniSTS Rnor5.0 RGSC_v3.4 1 135,122,149 - 135,122,356 UniSTS RGSC3.4 Celera 1 125,372,180 - 125,372,387 UniSTS RH 3.4 Map 1 1060.8 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
43
113
76
75
45
25
45
6
189
88
93
39
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022962 ⟹ ENSRNOP00000022962
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 133,308,938 - 133,322,296 (-) Ensembl Rnor_6.0 Ensembl 1 141,097,695 - 141,111,400 (-) Ensembl
RefSeq Acc Id:
NM_001106274 ⟹ NP_001099744
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,718,262 - 142,731,621 (-) NCBI mRatBN7.2 1 133,308,937 - 133,322,296 (-) NCBI Rnor_6.0 1 141,097,795 - 141,111,375 (-) NCBI Rnor_5.0 1 142,059,882 - 142,073,463 (-) NCBI RGSC_v3.4 1 135,122,063 - 135,135,420 (-) RGD Celera 1 125,372,094 - 125,385,448 (-) RGD
Sequence:
TCCCAGGCTCCCCTGCCTCCCAGTTTGAGAAGAGAGAGGGCAGGAAAATGAGACGGGGCTGGCCCAGATCCCAGTGAAGTAGCTTCCACATGGCCGAACAGAGCTCCAAGCAGGAGCTCACAAAGCAG
hide sequence
RefSeq Acc Id:
XM_039105632 ⟹ XP_038961560
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,718,262 - 142,731,571 (-) NCBI mRatBN7.2 1 133,308,920 - 133,322,253 (-) NCBI
RefSeq Acc Id:
NP_001099744 ⟸ NM_001106274
- UniProtKB:
D3Z956 (UniProtKB/TrEMBL), A6JC48 (UniProtKB/TrEMBL)
- Sequence:
MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRDEAVRELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRARKFDVGRAYELLKGYVNFRLQYPELF
hide sequence
Ensembl Acc Id:
ENSRNOP00000022962 ⟸ ENSRNOT00000022962
RefSeq Acc Id:
XP_038961560 ⟸ XM_039105632
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Rlbp1
retinaldehyde binding protein 1
Rlbp1_predicted
retinaldehyde binding protein 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rlbp1_predicted
retinaldehyde binding protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
