Symbol:
Ndufb8
Name:
NADH:ubiquinone oxidoreductase subunit B8
RGD ID:
1309129
Description:
Predicted to be involved in mitochondrial electron transport, NADH to ubiquinone. Predicted to be located in mitochondrion. Predicted to be part of respiratory chain complex I. Predicted to be active in mitochondrial inner membrane. Biomarker of acute kidney failure. Human ortholog(s) of this gene implicated in nuclear type mitochondrial complex I deficiency 32. Orthologous to human NDUFB8 (NADH:ubiquinone oxidoreductase subunit B8); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH (S)-nicotine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC293991; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 253,357,878 - 253,362,936 (-) NCBI GRCr8 mRatBN7.2 1 243,408,656 - 243,413,715 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 243,408,619 - 243,413,817 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,553,580 - 251,558,636 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 258,254,776 - 258,259,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,903,779 - 250,908,835 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 264,298,671 - 264,303,712 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 264,298,669 - 264,303,762 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,741,836 - 271,746,877 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,597,402 - 249,602,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,857,515 - 249,862,713 (-) NCBI Celera 1 239,222,776 - 239,227,817 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndufb8 Rat (+)-dexrazoxane decreases expression ISO Ndufb8 (Mus musculus) 6480464 Dexrazoxane results in decreased expression of NDUFB8 mRNA CTD PMID:26873546 Ndufb8 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NDUFB8 protein CTD PMID:28681937 Ndufb8 Rat 1,2-dimethylhydrazine multiple interactions ISO Ndufb8 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFB8 mRNA CTD PMID:22206623 Ndufb8 Rat 1,2-dimethylhydrazine decreases expression ISO Ndufb8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NDUFB8 mRNA CTD PMID:22206623 Ndufb8 Rat 17alpha-ethynylestradiol increases expression ISO Ndufb8 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NDUFB8 mRNA CTD PMID:17555576 Ndufb8 Rat 17alpha-ethynylestradiol multiple interactions ISO Ndufb8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFB8 mRNA CTD PMID:17942748 Ndufb8 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NDUFB8 protein CTD PMID:22070562 Ndufb8 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NDUFB8 mRNA CTD PMID:32145629 Ndufb8 Rat 17beta-estradiol decreases expression ISO Ndufb8 (Mus musculus) 6480464 Estradiol results in decreased expression of NDUFB8 mRNA CTD PMID:19484750 Ndufb8 Rat 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:24041027 Ndufb8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ndufb8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFB8 mRNA CTD PMID:17942748 Ndufb8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFB8 mRNA CTD PMID:34747641 Ndufb8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ndufb8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NDUFB8 mRNA CTD PMID:21570461 Ndufb8 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of NDUFB8 mRNA CTD PMID:19162173 Ndufb8 Rat 4,4'-sulfonyldiphenol increases expression ISO Ndufb8 (Mus musculus) 6480464 bisphenol S results in increased expression of NDUFB8 mRNA CTD PMID:39298647 Ndufb8 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB8 mRNA CTD PMID:36041667 Ndufb8 Rat 5-aminolevulinic acid decreases expression EXP 6480464 Aminolevulinic Acid results in decreased expression of NDUFB8 protein CTD PMID:18665889 Ndufb8 Rat 7,12-dimethyltetraphene increases expression ISO Ndufb8 (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Ndufb8 Rat 8-bromo-3',5'-cyclic GMP increases expression ISO NDUFB8 (Homo sapiens) 6480464 8-bromocyclic GMP results in increased expression of NDUFB8 protein CTD PMID:24041027 Ndufb8 Rat 8-bromo-3',5'-cyclic GMP multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 tin protoporphyrin IX inhibits the reaction [8-bromocyclic GMP results in increased expression of NDUFB8 protein] CTD PMID:24041027 Ndufb8 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of NDUFB8 mRNA CTD PMID:31881176 Ndufb8 Rat aflatoxin B1 increases expression ISO Ndufb8 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NDUFB8 mRNA CTD PMID:19770486 Ndufb8 Rat aldehydo-D-glucose multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat alpha-D-galactose multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat arsane decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Arsenic results in decreased expression of NDUFB8 mRNA CTD PMID:16835338 Ndufb8 Rat arsenic atom decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Arsenic results in decreased expression of NDUFB8 mRNA CTD PMID:16835338 Ndufb8 Rat arsenite(3-) multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NDUFB8 mRNA] CTD PMID:32406909 Ndufb8 Rat atrazine decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Atrazine results in decreased expression of NDUFB8 mRNA CTD PMID:22378314 Ndufb8 Rat benzo[a]pyrene increases methylation ISO NDUFB8 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NDUFB8 promoter CTD PMID:27901495 Ndufb8 Rat beta-lapachone increases expression ISO NDUFB8 (Homo sapiens) 6480464 beta-lapachone results in increased expression of NDUFB8 mRNA CTD PMID:38218311 Ndufb8 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ndufb8 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NDUFB8 mRNA CTD PMID:33754040 Ndufb8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDUFB8 mRNA CTD PMID:25181051 Ndufb8 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB8 mRNA CTD PMID:36041667 Ndufb8 Rat bisphenol A decreases expression ISO Ndufb8 (Mus musculus) 6480464 bisphenol A results in decreased expression of NDUFB8 mRNA and bisphenol A results in decreased expression of NDUFB8 protein CTD PMID:35598803 and PMID:36549428 Ndufb8 Rat bisphenol A increases expression ISO Ndufb8 (Mus musculus) 6480464 bisphenol A results in increased expression of NDUFB8 mRNA CTD PMID:33221593 and PMID:38074096 Ndufb8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NDUFB8 mRNA CTD PMID:32145629 Ndufb8 Rat bisphenol A decreases expression ISO NDUFB8 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NDUFB8 protein CTD PMID:36549428 Ndufb8 Rat bisphenol A multiple interactions ISO Ndufb8 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NDUFB8 protein] CTD PMID:36549428 Ndufb8 Rat bisphenol A multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NDUFB8 protein] CTD PMID:36549428 Ndufb8 Rat bisphenol A affects expression ISO NDUFB8 (Homo sapiens) 6480464 bisphenol A affects the expression of NDUFB8 mRNA CTD PMID:30903817 Ndufb8 Rat bisphenol AF increases expression ISO NDUFB8 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NDUFB8 protein CTD PMID:34186270 Ndufb8 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB8 mRNA CTD PMID:36041667 Ndufb8 Rat bisphenol F increases expression ISO NDUFB8 (Homo sapiens) 6480464 bisphenol F results in increased expression of NDUFB8 protein CTD PMID:34186270 Ndufb8 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of NDUFB8 protein CTD PMID:28903499 Ndufb8 Rat cadmium atom multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDUFB8 mRNA CTD PMID:35301059 Ndufb8 Rat cadmium dichloride multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDUFB8 mRNA CTD PMID:35301059 Ndufb8 Rat calycosin multiple interactions EXP 6480464 7 more ... CTD PMID:36436616 Ndufb8 Rat calycosin multiple interactions ISO Ndufb8 (Mus musculus) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone inhibits the reaction [triptolide results in decreased expression of NDUFB8 protein] CTD PMID:36436616 Ndufb8 Rat carbon nanotube decreases expression ISO Ndufb8 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Ndufb8 Rat chloropicrin increases expression ISO NDUFB8 (Homo sapiens) 6480464 chloropicrin results in increased expression of NDUFB8 mRNA CTD PMID:26352163 Ndufb8 Rat cobalt dichloride decreases expression ISO NDUFB8 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NDUFB8 mRNA CTD PMID:19376846 Ndufb8 Rat colistin decreases expression ISO Ndufb8 (Mus musculus) 6480464 Colistin results in decreased expression of NDUFB8 protein CTD PMID:35378205 Ndufb8 Rat crocidolite asbestos increases expression ISO NDUFB8 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of NDUFB8 mRNA CTD PMID:29523930 Ndufb8 Rat cyclosporin A decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NDUFB8 mRNA CTD PMID:25562108 Ndufb8 Rat D-glucose multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat deoxynivalenol decreases expression ISO NDUFB8 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of NDUFB8 protein CTD PMID:33890134 Ndufb8 Rat desferrioxamine B decreases expression ISO Ndufb8 (Mus musculus) 6480464 Deferoxamine results in decreased expression of NDUFB8 protein CTD PMID:31238089 Ndufb8 Rat dichloromethane increases expression ISO Ndufb8 (Mus musculus) 6480464 Methylene Chloride results in increased expression of NDUFB8 protein CTD PMID:30240022 Ndufb8 Rat dioxygen multiple interactions ISO Ndufb8 (Mus musculus) 6480464 NFE2L2 protein affects the reaction [sulforaphane promotes the reaction [Oxygen results in increased expression of NDUFB8 protein]] and sulforaphane promotes the reaction [Oxygen results in increased expression of NDUFB8 protein] CTD PMID:30529165 Ndufb8 Rat dioxygen increases expression ISO Ndufb8 (Mus musculus) 6480464 Oxygen results in increased expression of NDUFB8 protein CTD PMID:30529165 Ndufb8 Rat diuron decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Diuron results in decreased expression of NDUFB8 mRNA CTD PMID:35967413 Ndufb8 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of NDUFB8 protein CTD PMID:26678157 Ndufb8 Rat doxorubicin decreases expression ISO Ndufb8 (Mus musculus) 6480464 Doxorubicin results in decreased expression of NDUFB8 protein CTD PMID:29653124 Ndufb8 Rat doxorubicin increases expression ISO NDUFB8 (Homo sapiens) 6480464 Doxorubicin results in increased expression of NDUFB8 mRNA CTD PMID:29803840 Ndufb8 Rat ethanol affects splicing ISO Ndufb8 (Mus musculus) 6480464 Ethanol affects the splicing of NDUFB8 mRNA CTD PMID:30319688 Ndufb8 Rat fenthion increases expression ISO Ndufb8 (Mus musculus) 6480464 Fenthion results in increased expression of NDUFB8 mRNA CTD PMID:34813904 Ndufb8 Rat flutamide decreases expression ISO Ndufb8 (Mus musculus) 6480464 Flutamide analog results in decreased expression of NDUFB8 mRNA and Flutamide results in decreased expression of NDUFB8 mRNA CTD PMID:17702527 Ndufb8 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NDUFB8 mRNA CTD PMID:24136188 Ndufb8 Rat folic acid decreases expression ISO Ndufb8 (Mus musculus) 6480464 Folic Acid results in decreased expression of NDUFB8 CTD PMID:24275386 Ndufb8 Rat folic acid multiple interactions ISO Ndufb8 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFB8 mRNA CTD PMID:22206623 Ndufb8 Rat galactose multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat glucose multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of NDUFB8 promoter CTD PMID:23740543 Ndufb8 Rat hydrogen peroxide increases expression ISO NDUFB8 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of NDUFB8 protein CTD PMID:18603805 Ndufb8 Rat isopimaric acid decreases expression ISO Ndufb8 (Mus musculus) 6480464 isopimaric acid results in decreased expression of NDUFB8 protein CTD PMID:36754215 Ndufb8 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of NDUFB8 mRNA CTD PMID:30303030 Ndufb8 Rat ivermectin decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NDUFB8 protein CTD PMID:32959892 Ndufb8 Rat josamycin affects response to substance ISO NDUFB8 (Homo sapiens) 6480464 NDUFB8 protein affects the susceptibility to Josamycin CTD PMID:31915244 Ndufb8 Rat lead diacetate multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of NDUFB8 protein and BACH1 gene mutant form inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of NDUFB8 protein] CTD PMID:36096218 Ndufb8 Rat lead(0) multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of NDUFB8 protein and BACH1 gene mutant form inhibits the reaction [[lead acetate results in increased abundance of Lead] which results in decreased expression of NDUFB8 protein] CTD PMID:36096218 Ndufb8 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of NDUFB8 mRNA CTD PMID:24136188 Ndufb8 Rat lenvatinib affects expression EXP 6480464 lenvatinib affects the expression of NDUFB8 protein CTD PMID:34019861 Ndufb8 Rat lipopolysaccharide multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFB8 mRNA CTD PMID:31059760 Ndufb8 Rat LY294002 multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltiprotoporphyrin results in increased expression of NDUFB8 protein] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [tricarbonylchloro(glycinato)ruthenium(II) results in increased expression of NDUFB8 protein] CTD PMID:24041027 Ndufb8 Rat melatonin multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NDUFB8 protein] CTD PMID:36549428 Ndufb8 Rat melatonin multiple interactions ISO Ndufb8 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NDUFB8 protein] CTD PMID:36549428 Ndufb8 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Ndufb8 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of NDUFB8 protein CTD PMID:32255176 Ndufb8 Rat monosodium L-glutamate multiple interactions ISO Ndufb8 (Mus musculus) 6480464 [Sodium Glutamate co-treated with High Fructose Corn Syrup] results in increased expression of NDUFB8 mRNA CTD PMID:20111022 Ndufb8 Rat N-methyl-4-phenylpyridinium decreases expression ISO NDUFB8 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NDUFB8 protein CTD PMID:26102036 Ndufb8 Rat N-methyl-4-phenylpyridinium multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 MTERF4 protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NDUFB8 protein] CTD PMID:26102036 Ndufb8 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NDUFB8 protein CTD PMID:28681937 Ndufb8 Rat p-menthan-3-ol decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Menthol results in decreased expression of NDUFB8 protein CTD PMID:32783911 Ndufb8 Rat paracetamol affects expression ISO Ndufb8 (Mus musculus) 6480464 Acetaminophen affects the expression of NDUFB8 mRNA CTD PMID:17562736 Ndufb8 Rat paracetamol multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFB8 mRNA CTD PMID:31059760 Ndufb8 Rat paracetamol decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NDUFB8 mRNA CTD PMID:31059760 Ndufb8 Rat paraquat increases expression ISO Ndufb8 (Mus musculus) 6480464 Paraquat results in increased expression of NDUFB8 protein CTD PMID:34811946 Ndufb8 Rat paraquat multiple interactions ISO Ndufb8 (Mus musculus) 6480464 ST2825 inhibits the reaction [Paraquat results in increased expression of NDUFB8 protein] CTD PMID:34811946 Ndufb8 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of NDUFB8 mRNA CTD PMID:19162173 Ndufb8 Rat pyruvic acid multiple interactions EXP 6480464 [Glucose deficiency co-treated with Galactose co-treated with Pyruvic Acid] results in increased expression of NDUFB8 protein CTD PMID:25997894 Ndufb8 Rat rac-1,2-dichloropropane decreases expression ISO Ndufb8 (Mus musculus) 6480464 propylene dichloride results in decreased expression of NDUFB8 protein CTD PMID:30240022 Ndufb8 Rat regorafenib decreases expression EXP 6480464 regorafenib results in decreased expression of NDUFB8 protein CTD PMID:33166663 Ndufb8 Rat resveratrol increases expression ISO Ndufb8 (Mus musculus) 6480464 resveratrol results in increased expression of NDUFB8 mRNA and resveratrol results in increased expression of NDUFB8 protein CTD PMID:17112576 more ... Ndufb8 Rat resveratrol multiple interactions ISO Ndufb8 (Mus musculus) 6480464 resveratrol inhibits the reaction [lipopolysaccharide more ... CTD PMID:24041027 Ndufb8 Rat resveratrol multiple interactions ISO NDUFB8 (Homo sapiens) 6480464 1H-(1 more ... CTD PMID:24041027 Ndufb8 Rat rotenone increases expression ISO NDUFB8 (Homo sapiens) 6480464 Rotenone results in increased expression of NDUFB8 mRNA CTD PMID:18191903 Ndufb8 Rat rotenone decreases expression ISO Ndufb8 (Mus musculus) 6480464 Rotenone results in decreased expression of NDUFB8 mRNA CTD PMID:23186747 Ndufb8 Rat sodium arsenite decreases expression ISO NDUFB8 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NDUFB8 protein CTD PMID:27908234 Ndufb8 Rat sulforaphane multiple interactions ISO Ndufb8 (Mus musculus) 6480464 NFE2L2 protein affects the reaction [sulforaphane promotes the reaction [Oxygen results in increased expression of NDUFB8 protein]] and sulforaphane promotes the reaction [Oxygen results in increased expression of NDUFB8 protein] CTD PMID:30529165 Ndufb8 Rat sulforaphane increases expression ISO Ndufb8 (Mus musculus) 6480464 sulforaphane results in increased expression of NDUFB8 mRNA CTD PMID:30529165 Ndufb8 Rat telbivudine decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Telbivudine results in decreased expression of NDUFB8 protein CTD PMID:37659625 Ndufb8 Rat telbivudine decreases expression ISO Ndufb8 (Mus musculus) 6480464 Telbivudine results in decreased expression of NDUFB8 protein CTD PMID:37659625 Ndufb8 Rat thalidomide decreases expression ISO Ndufb8 (Mus musculus) 6480464 Thalidomide results in decreased expression of NDUFB8 mRNA CTD PMID:26217789 Ndufb8 Rat thapsigargin decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of NDUFB8 mRNA CTD PMID:22378314 Ndufb8 Rat titanium dioxide decreases methylation ISO Ndufb8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NDUFB8 promoter alternative form CTD PMID:35295148 Ndufb8 Rat toluene affects expression EXP 6480464 Toluene affects the expression of NDUFB8 mRNA CTD PMID:21827849 Ndufb8 Rat triphenyl phosphate affects expression ISO NDUFB8 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDUFB8 mRNA CTD PMID:37042841 Ndufb8 Rat Triptolide multiple interactions ISO Ndufb8 (Mus musculus) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone inhibits the reaction [triptolide results in decreased expression of NDUFB8 protein] CTD PMID:36436616 Ndufb8 Rat Triptolide multiple interactions EXP 6480464 7 more ... CTD PMID:36436616 Ndufb8 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of NDUFB8 mRNA and triptolide results in decreased expression of NDUFB8 protein CTD PMID:36436616 Ndufb8 Rat Triptolide decreases expression ISO Ndufb8 (Mus musculus) 6480464 triptolide results in decreased expression of NDUFB8 protein CTD PMID:36436616 Ndufb8 Rat tungsten increases expression ISO Ndufb8 (Mus musculus) 6480464 Tungsten results in increased expression of NDUFB8 mRNA CTD PMID:30912803 Ndufb8 Rat tunicamycin decreases expression ISO NDUFB8 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of NDUFB8 mRNA CTD PMID:22378314 Ndufb8 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NDUFB8 mRNA CTD PMID:23034163 Ndufb8 Rat vitamin E increases expression ISO NDUFB8 (Homo sapiens) 6480464 Vitamin E results in increased expression of NDUFB8 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 5-aminolevulinic acid (EXP) 7,12-dimethyltetraphene (ISO) 8-bromo-3',5'-cyclic GMP (ISO) acetamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP) alpha-D-galactose (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calycosin (EXP,ISO) carbon nanotube (ISO) chloropicrin (ISO) cobalt dichloride (ISO) colistin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) D-glucose (EXP) deoxynivalenol (ISO) desferrioxamine B (ISO) dichloromethane (ISO) dioxygen (ISO) diuron (ISO) doxorubicin (EXP,ISO) ethanol (ISO) fenthion (ISO) flutamide (EXP,ISO) folic acid (ISO) galactose (EXP) glucose (EXP) hexane (EXP) hydrogen peroxide (ISO) isopimaric acid (ISO) isoprenaline (EXP) ivermectin (ISO) josamycin (ISO) lead diacetate (ISO) lead(0) (ISO) leflunomide (EXP) lenvatinib (EXP) lipopolysaccharide (ISO) LY294002 (ISO) melatonin (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) nicotine (EXP) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) pregnenolone 16alpha-carbonitrile (EXP) pyruvic acid (EXP) rac-1,2-dichloropropane (ISO) regorafenib (EXP) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sulforaphane (ISO) telbivudine (ISO) thalidomide (ISO) thapsigargin (ISO) titanium dioxide (ISO) toluene (EXP) triphenyl phosphate (ISO) Triptolide (EXP,ISO) tungsten (ISO) tunicamycin (ISO) vinclozolin (EXP) vitamin E (ISO)
1.
Persistent disruption of mitochondrial homeostasis after acute kidney injury.
Funk JA and Schnellmann RG, Am J Physiol Renal Physiol. 2012 Apr 1;302(7):F853-64. doi: 10.1152/ajprenal.00035.2011. Epub 2011 Dec 7.
2.
Accelerated recovery of renal mitochondrial and tubule homeostasis with SIRT1/PGC-1a activation following ischemia-reperfusion injury.
Funk JA and Schnellmann RG, Toxicol Appl Pharmacol. 2013 Dec 1;273(2):345-54. doi: 10.1016/j.taap.2013.09.026. Epub 2013 Oct 3.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Mitochondrial DNA Depletion in Respiratory Chain-Deficient Parkinson Disease Neurons.
Grünewald A, etal., Ann Neurol. 2016 Mar;79(3):366-78. doi: 10.1002/ana.24571. Epub 2016 Jan 28.
6.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
7.
Glutathione S-transferase omega-1 modifies age-at-onset of Alzheimer disease and Parkinson disease.
Li YJ, etal., Hum Mol Genet 2003 Dec 15;12(24):3259-67. Epub 2003 Oct 21.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Sepsis-induced cardiac mitochondrial dysfunction involves altered mitochondrial-localization of tyrosine kinase Src and tyrosine phosphatase SHP2.
Zang QS, etal., PLoS One. 2012;7(8):e43424. doi: 10.1371/journal.pone.0043424. Epub 2012 Aug 27.
Ndufb8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 253,357,878 - 253,362,936 (-) NCBI GRCr8 mRatBN7.2 1 243,408,656 - 243,413,715 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 243,408,619 - 243,413,817 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 251,553,580 - 251,558,636 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 258,254,776 - 258,259,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 250,903,779 - 250,908,835 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 264,298,671 - 264,303,712 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 264,298,669 - 264,303,762 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 271,741,836 - 271,746,877 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 249,597,402 - 249,602,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 249,857,515 - 249,862,713 (-) NCBI Celera 1 239,222,776 - 239,227,817 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
NDUFB8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 100,523,729 - 100,529,923 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 100,523,668 - 100,530,000 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 102,283,486 - 102,289,680 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 102,273,487 - 102,279,626 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 102,273,486 - 102,279,626 NCBI Celera 10 96,021,344 - 96,027,467 (-) NCBI Celera Cytogenetic Map 10 q24.31 NCBI HuRef 10 95,912,314 - 95,918,432 (-) NCBI HuRef CHM1_1 10 102,568,149 - 102,574,284 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 101,406,832 - 101,413,008 (-) NCBI T2T-CHM13v2.0
Ndufb8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 44,537,010 - 44,543,881 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 44,537,011 - 44,543,879 (-) Ensembl GRCm39 Ensembl GRCm38 19 44,548,571 - 44,555,442 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 44,548,572 - 44,555,440 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 44,624,744 - 44,629,905 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 44,603,565 - 44,608,726 (-) NCBI MGSCv36 mm8 Celera 19 45,317,871 - 45,323,032 (-) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 37.98 NCBI
Ndufb8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 9,607,781 - 9,613,151 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 9,607,781 - 9,613,123 (+) NCBI ChiLan1.0 ChiLan1.0
NDUFB8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 112,407,560 - 112,419,817 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 112,412,880 - 112,425,137 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 97,123,826 - 97,129,919 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 100,604,914 - 100,611,016 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 100,604,914 - 100,611,016 (-) Ensembl panpan1.1 panPan2
NDUFB8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 13,249,067 - 13,253,670 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 13,249,070 - 13,253,619 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 13,420,026 - 13,424,630 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 13,718,281 - 13,722,885 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 13,717,817 - 13,722,833 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 13,264,760 - 13,269,366 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 13,306,376 - 13,310,981 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 13,437,377 - 13,441,981 (-) NCBI UU_Cfam_GSD_1.0
Ndufb8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 33,518,864 - 33,523,551 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 5,116,423 - 5,129,334 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 5,122,004 - 5,126,776 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDUFB8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 111,626,097 - 111,633,564 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 111,626,827 - 111,633,548 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 63,909,851 - 63,916,428 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NDUFB8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 93,544,663 - 93,550,748 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 93,544,589 - 93,550,905 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 54,592,819 - 54,598,911 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndufb8
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 35 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000019039 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019039 ⟹ ENSRNOP00000019039
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 243,408,659 - 243,413,817 (-) Ensembl Rnor_6.0 Ensembl 1 264,298,669 - 264,303,762 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115908 ⟹ ENSRNOP00000086087
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 243,408,619 - 243,413,704 (-) Ensembl
RefSeq Acc Id:
NM_001106360 ⟹ NP_001099830
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 253,357,878 - 253,362,936 (-) NCBI mRatBN7.2 1 243,408,656 - 243,413,715 (-) NCBI Rnor_6.0 1 264,298,671 - 264,303,712 (-) NCBI Rnor_5.0 1 271,741,836 - 271,746,877 (-) NCBI RGSC_v3.4 1 249,597,402 - 249,602,443 (-) RGD Celera 1 239,222,776 - 239,227,817 (-) RGD
Sequence:
GAAGGTGAAGATGGCGGCGTCCCGGGCTGCGGCCCTGGGAGTCCGGTGGCTGCAAAGGACATCCCGCTGCGTGGTGCCACTTGAGGCACGGAGAGCCTTCCACATGACCAAGGACATGATGCCGGGGT
hide sequence
RefSeq Acc Id:
NP_001099830 ⟸ NM_001106360
- UniProtKB:
B2RYS8 (UniProtKB/TrEMBL), A6JHG3 (UniProtKB/TrEMBL), F7F9K9 (UniProtKB/TrEMBL), B2RYU4 (UniProtKB/TrEMBL)
- Sequence:
MAASRAAALGVRWLQRTSRCVVPLEARRAFHMTKDMMPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYEWDHPDLRLNWGEPIHWDLDMYIRNRVDTSPTPVSWDV
hide sequence
Ensembl Acc Id:
ENSRNOP00000019039 ⟸ ENSRNOT00000019039
Ensembl Acc Id:
ENSRNOP00000086087 ⟸ ENSRNOT00000115908
RGD ID: 13690940 Promoter ID: EPDNEW_R1465 Type: multiple initiation site Name: Ndufb8_1 Description: NADH:ubiquinone oxidoreductase subunit B8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 264,303,733 - 264,303,793 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-26
Ndufb8
NADH:ubiquinone oxidoreductase subunit B8
Ndufb8
NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ndufb8
NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8
Ndufb8_predicted
NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ndufb8_predicted
NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
