Symbol:
Hic1
Name:
HIC ZBTB transcriptional repressor 1
RGD ID:
1307527
Description:
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific; histone deacetylase binding activity; and sequence-specific double-stranded DNA binding activity. Predicted to be involved in intrinsic apoptotic signaling pathway in response to DNA damage; negative regulation of transcription by RNA polymerase II; and regulation of signal transduction. Predicted to be located in chromatin. Predicted to be active in nucleus. Orthologous to human HIC1 (HIC ZBTB transcriptional repressor 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hypermethylated in cancer 1; hypermethylated in cancer 1 protein; hypermethylated in cancer 1 protein-like; LOC100912068; LOC303310
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 60,512,855 - 60,517,812 (-) NCBI GRCr8 mRatBN7.2 10 60,014,520 - 60,019,475 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,011,528 - 60,019,475 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 64,661,147 - 64,666,097 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,166,728 - 64,171,679 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 59,629,108 - 59,634,061 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 62,007,150 - 62,010,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 62,007,150 - 62,009,582 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 61,721,540 - 61,725,164 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 62,470,736 - 62,476,506 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 62,485,182 - 62,492,086 (-) NCBI Celera 10 59,044,464 - 59,049,428 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hic1 Rat (-)-demecolcine decreases expression ISO HIC1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of HIC1 mRNA CTD PMID:23649840 Hic1 Rat 1,2-dichloroethane decreases expression ISO Hic1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of HIC1 mRNA CTD PMID:28960355 Hic1 Rat 1,2-dimethylhydrazine multiple interactions ISO Hic1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HIC1 mRNA CTD PMID:22206623 Hic1 Rat 17beta-estradiol multiple interactions ISO HIC1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of HIC1 mRNA CTD PMID:30165855 Hic1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hic1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HIC1 mRNA CTD PMID:19933214 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HIC1 mRNA CTD PMID:33387578 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HIC1 mRNA CTD PMID:27913140 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO HIC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of HIC1 mRNA CTD PMID:27913140 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HIC1 mRNA CTD PMID:22298810 Hic1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hic1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HIC1 mRNA CTD PMID:20159946 and PMID:27913140 Hic1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Hic1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HIC1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIC1 mRNA CTD PMID:28628672 Hic1 Rat 4,4'-sulfonyldiphenol increases expression ISO Hic1 (Mus musculus) 6480464 bisphenol S results in increased expression of HIC1 mRNA CTD PMID:30951980 Hic1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Hic1 (Mus musculus) 6480464 bisphenol S affects the methylation of HIC1 gene CTD PMID:31683443 Hic1 Rat 4,4'-sulfonyldiphenol increases methylation ISO HIC1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of HIC1 gene CTD PMID:31601247 Hic1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Hic1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of HIC1 mRNA CTD PMID:30951980 Hic1 Rat 5-aza-2'-deoxycytidine increases expression ISO HIC1 (Homo sapiens) 6480464 Decitabine results in increased expression of HIC1 mRNA CTD PMID:19440673 Hic1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HIC1 mRNA CTD PMID:24780913 Hic1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of HIC1 mRNA CTD PMID:28959563 Hic1 Rat actinomycin D multiple interactions ISO HIC1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of HIC1 mRNA CTD PMID:38460933 Hic1 Rat all-trans-retinoic acid increases expression ISO HIC1 (Homo sapiens) 6480464 Tretinoin results in increased expression of HIC1 mRNA CTD PMID:17218384 more ... Hic1 Rat all-trans-retinoic acid multiple interactions ISO Hic1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of HIC1 mRNA more ... CTD PMID:30951980 and PMID:36189433 Hic1 Rat antirheumatic drug increases expression ISO HIC1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of HIC1 mRNA CTD PMID:24449571 Hic1 Rat benzo[a]pyrene decreases expression ISO Hic1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HIC1 mRNA CTD PMID:22228805 and PMID:27195522 Hic1 Rat benzo[a]pyrene affects methylation ISO HIC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HIC1 3' UTR and Benzo(a)pyrene affects the methylation of HIC1 promoter CTD PMID:27901495 Hic1 Rat benzo[a]pyrene increases expression ISO Hic1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HIC1 mRNA CTD PMID:32417428 Hic1 Rat benzo[a]pyrene increases expression ISO HIC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HIC1 mRNA CTD PMID:20064835 more ... Hic1 Rat benzo[a]pyrene multiple interactions ISO Hic1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of HIC1 mRNA and Benzo(a)pyrene promotes the reaction [AHR protein binds to HIC1 promoter] CTD PMID:19654925 and PMID:27858113 Hic1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO HIC1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Hic1 Rat benzo[b]fluoranthene multiple interactions ISO Hic1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of HIC1 mRNA CTD PMID:27858113 Hic1 Rat Benzo[k]fluoranthene increases expression ISO Hic1 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of HIC1 mRNA CTD PMID:26377693 Hic1 Rat benzophenanthridine decreases expression ISO HIC1 (Homo sapiens) 6480464 Benzophenanthridines analog results in decreased expression of HIC1 mRNA CTD PMID:23117580 Hic1 Rat beta-lapachone increases expression ISO HIC1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of HIC1 mRNA CTD PMID:38218311 Hic1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HIC1 mRNA CTD PMID:25181051 Hic1 Rat bisphenol A increases expression ISO Hic1 (Mus musculus) 6480464 bisphenol A results in increased expression of HIC1 mRNA CTD PMID:30951980 and PMID:32156529 Hic1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HIC1 mRNA CTD PMID:30816183 and PMID:34947998 Hic1 Rat bisphenol A decreases expression ISO HIC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HIC1 mRNA CTD PMID:26363213 Hic1 Rat bisphenol F multiple interactions ISO HIC1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of HIC1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIC1 mRNA CTD PMID:28628672 and PMID:31601247 Hic1 Rat bisphenol F increases expression ISO Hic1 (Mus musculus) 6480464 bisphenol F results in increased expression of HIC1 mRNA CTD PMID:30951980 Hic1 Rat bisphenol F multiple interactions ISO Hic1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of HIC1 mRNA CTD PMID:30951980 Hic1 Rat buta-1,3-diene decreases expression ISO Hic1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of HIC1 mRNA CTD PMID:29038090 Hic1 Rat cadmium sulfate multiple interactions ISO HIC1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of HIC1 mRNA CTD PMID:18654764 Hic1 Rat camptothecin increases expression ISO HIC1 (Homo sapiens) 6480464 Camptothecin results in increased expression of HIC1 mRNA CTD PMID:38460933 Hic1 Rat carbon nanotube increases expression ISO Hic1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Hic1 Rat chloroprene decreases expression ISO Hic1 (Mus musculus) 6480464 Chloroprene results in decreased expression of HIC1 mRNA CTD PMID:23125180 Hic1 Rat chrysene multiple interactions ISO Hic1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of HIC1 mRNA CTD PMID:27858113 Hic1 Rat cisplatin multiple interactions ISO HIC1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of HIC1 mRNA CTD PMID:27392435 Hic1 Rat clofibrate multiple interactions ISO Hic1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HIC1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HIC1 mRNA] CTD PMID:17585979 Hic1 Rat cobalt dichloride multiple interactions ISO HIC1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of HIC1 mRNA CTD PMID:18654764 Hic1 Rat cypermethrin increases expression ISO Hic1 (Mus musculus) 6480464 cypermethrin results in increased expression of HIC1 mRNA CTD PMID:35031408 Hic1 Rat dexamethasone multiple interactions ISO HIC1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIC1 mRNA CTD PMID:28628672 Hic1 Rat dibenz[a,h]anthracene increases expression ISO Hic1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Hic1 Rat diquat decreases expression ISO Hic1 (Mus musculus) 6480464 Diquat results in decreased expression of HIC1 mRNA CTD PMID:36851058 Hic1 Rat disodium selenite increases expression ISO Hic1 (Mus musculus) 6480464 Sodium Selenite results in increased expression of HIC1 mRNA CTD PMID:23274088 Hic1 Rat disodium selenite multiple interactions ISO Hic1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in increased expression of HIC1 mRNA CTD PMID:23274088 Hic1 Rat doxorubicin decreases expression ISO HIC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HIC1 mRNA CTD PMID:29803840 Hic1 Rat etoposide multiple interactions ISO HIC1 (Homo sapiens) 6480464 E2F1 protein affects the reaction [Etoposide results in increased expression of HIC1 mRNA] and Etoposide promotes the reaction [E2F1 protein binds to HIC1 promoter] CTD PMID:19491197 Hic1 Rat etoposide increases expression ISO HIC1 (Homo sapiens) 6480464 Etoposide results in increased expression of HIC1 mRNA CTD PMID:19491197 Hic1 Rat folic acid multiple interactions ISO Hic1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HIC1 mRNA CTD PMID:22206623 Hic1 Rat folic acid increases methylation ISO HIC1 (Homo sapiens) 6480464 Folic Acid deficiency results in increased methylation of HIC1 promoter CTD PMID:28752528 Hic1 Rat folic acid decreases expression ISO Hic1 (Mus musculus) 6480464 Folic Acid results in decreased expression of HIC1 mRNA CTD PMID:25629700 Hic1 Rat formaldehyde increases expression ISO HIC1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of HIC1 mRNA CTD PMID:27905399 Hic1 Rat fulvestrant multiple interactions ISO HIC1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of HIC1 gene CTD PMID:31601247 Hic1 Rat indometacin multiple interactions ISO HIC1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIC1 mRNA CTD PMID:28628672 Hic1 Rat lead(II) chloride multiple interactions ISO HIC1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] affects the expression of HIC1 mRNA CTD PMID:18654764 Hic1 Rat lipopolysaccharide multiple interactions ISO HIC1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of HIC1 mRNA] CTD PMID:35811015 Hic1 Rat lipopolysaccharide increases expression ISO HIC1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of HIC1 mRNA CTD PMID:35811015 Hic1 Rat methylisothiazolinone increases expression ISO HIC1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of HIC1 mRNA CTD PMID:31629900 Hic1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Hic1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of HIC1 mRNA CTD PMID:36189433 Hic1 Rat N-Nitrosopyrrolidine increases expression ISO HIC1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of HIC1 mRNA CTD PMID:32234424 Hic1 Rat Nutlin-3 multiple interactions ISO HIC1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of HIC1 mRNA CTD PMID:38460933 Hic1 Rat paracetamol multiple interactions ISO Hic1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HIC1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HIC1 mRNA] CTD PMID:17585979 Hic1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HIC1 mRNA CTD PMID:33387578 Hic1 Rat paracetamol affects expression ISO Hic1 (Mus musculus) 6480464 Acetaminophen affects the expression of HIC1 mRNA CTD PMID:17562736 Hic1 Rat perfluorohexanesulfonic acid decreases expression ISO Hic1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of HIC1 mRNA CTD PMID:37995155 Hic1 Rat pirinixic acid multiple interactions ISO Hic1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of HIC1 mRNA CTD PMID:19710929 Hic1 Rat progesterone multiple interactions ISO HIC1 (Homo sapiens) 6480464 [Progesterone co-treated with TGFB1 protein] results in increased expression of HIC1 mRNA CTD PMID:21768398 Hic1 Rat progesterone increases expression ISO HIC1 (Homo sapiens) 6480464 Progesterone results in increased expression of HIC1 mRNA CTD PMID:21768398 Hic1 Rat propanal decreases expression ISO HIC1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of HIC1 mRNA CTD PMID:26079696 Hic1 Rat Ptaquiloside increases expression ISO Hic1 (Mus musculus) 6480464 ptaquiloside results in increased expression of HIC1 mRNA CTD PMID:23274088 Hic1 Rat Ptaquiloside multiple interactions ISO Hic1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in increased expression of HIC1 mRNA CTD PMID:23274088 Hic1 Rat rotenone increases expression ISO Hic1 (Mus musculus) 6480464 Rotenone results in increased expression of HIC1 mRNA CTD PMID:32937126 Hic1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO HIC1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of HIC1 mRNA] CTD PMID:35811015 Hic1 Rat silicon dioxide decreases methylation ISO HIC1 (Homo sapiens) 6480464 Silicon Dioxide results in decreased methylation of HIC1 gene CTD PMID:34973136 Hic1 Rat silicon dioxide increases expression ISO HIC1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of HIC1 mRNA CTD PMID:34973136 Hic1 Rat sodium arsenite increases expression ISO HIC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HIC1 mRNA CTD PMID:38568856 Hic1 Rat sodium arsenite decreases expression ISO HIC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HIC1 mRNA CTD PMID:34032870 Hic1 Rat sotorasib multiple interactions ISO HIC1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of HIC1 mRNA CTD PMID:36139627 Hic1 Rat testosterone increases expression ISO HIC1 (Homo sapiens) 6480464 Testosterone results in increased expression of HIC1 mRNA CTD PMID:33359661 Hic1 Rat tetraphene multiple interactions ISO Hic1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of HIC1 mRNA CTD PMID:27858113 Hic1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HIC1 mRNA CTD PMID:34492290 Hic1 Rat titanium dioxide decreases methylation ISO Hic1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HIC1 gene and titanium dioxide results in decreased methylation of HIC1 promoter CTD PMID:35295148 Hic1 Rat titanium dioxide increases methylation ISO Hic1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HIC1 promoter and titanium dioxide results in increased methylation of HIC1 promoter alternative form CTD PMID:35295148 Hic1 Rat trametinib multiple interactions ISO HIC1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of HIC1 mRNA CTD PMID:36139627 Hic1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of HIC1 mRNA CTD PMID:33387578 Hic1 Rat triptonide increases expression ISO Hic1 (Mus musculus) 6480464 triptonide results in increased expression of HIC1 mRNA CTD PMID:33045310 Hic1 Rat urethane increases expression ISO HIC1 (Homo sapiens) 6480464 Urethane results in increased expression of HIC1 mRNA CTD PMID:28818685 Hic1 Rat valproic acid increases methylation ISO HIC1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of HIC1 gene CTD PMID:29154799 Hic1 Rat valproic acid increases expression ISO Hic1 (Mus musculus) 6480464 Valproic Acid results in increased expression of HIC1 mRNA CTD PMID:24896083 Hic1 Rat vincristine decreases expression ISO HIC1 (Homo sapiens) 6480464 Vincristine results in decreased expression of HIC1 mRNA CTD PMID:23649840
(-)-demecolcine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) benzophenanthridine (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium sulfate (ISO) camptothecin (ISO) carbon nanotube (ISO) chloroprene (ISO) chrysene (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) cypermethrin (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) diquat (ISO) disodium selenite (ISO) doxorubicin (ISO) etoposide (ISO) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) indometacin (ISO) lead(II) chloride (ISO) lipopolysaccharide (ISO) methylisothiazolinone (ISO) mono(2-ethylhexyl) phthalate (ISO) N-Nitrosopyrrolidine (ISO) Nutlin-3 (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) pirinixic acid (ISO) progesterone (ISO) propanal (ISO) Ptaquiloside (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sotorasib (ISO) testosterone (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP) triptonide (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO)
Hic1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 60,512,855 - 60,517,812 (-) NCBI GRCr8 mRatBN7.2 10 60,014,520 - 60,019,475 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,011,528 - 60,019,475 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 64,661,147 - 64,666,097 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,166,728 - 64,171,679 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 59,629,108 - 59,634,061 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 62,007,150 - 62,010,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 62,007,150 - 62,009,582 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 61,721,540 - 61,725,164 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 62,470,736 - 62,476,506 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 62,485,182 - 62,492,086 (-) NCBI Celera 10 59,044,464 - 59,049,428 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
HIC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 2,055,103 - 2,063,241 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 2,054,154 - 2,063,241 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 1,958,397 - 1,966,535 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 1,905,143 - 1,909,731 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 1,906,714 - 1,908,879 NCBI Celera 17 1,974,408 - 1,978,996 (+) NCBI Celera Cytogenetic Map 17 p13.3 NCBI HuRef 17 1,853,855 - 1,857,995 (+) NCBI HuRef CHM1_1 17 1,967,163 - 1,971,751 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 1,942,378 - 1,950,518 (+) NCBI T2T-CHM13v2.0
Hic1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 75,052,203 - 75,059,970 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 75,055,391 - 75,060,345 (-) Ensembl GRCm39 Ensembl GRCm38 11 75,161,377 - 75,170,255 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 75,164,565 - 75,169,519 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 74,978,067 - 74,983,757 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 74,980,763 - 74,985,714 (-) NCBI MGSCv36 mm8 Celera 11 82,671,336 - 82,677,017 (-) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.76 NCBI
Hic1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 1,179,015 - 1,181,825 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 1,179,015 - 1,182,936 (-) NCBI ChiLan1.0 ChiLan1.0
HIC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 9,635,373 - 9,640,053 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 11,602,754 - 11,607,442 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 2,045,960 - 2,051,483 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 1,935,628 - 1,937,474 (+) NCBI panpan1.1 PanPan1.1 panPan2
HIC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 46,156,909 - 46,162,849 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 46,159,136 - 46,162,004 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 45,306,957 - 45,312,945 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 46,987,712 - 46,993,723 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 46,989,156 - 46,993,692 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 45,754,761 - 45,760,755 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 46,049,100 - 46,055,081 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 46,104,136 - 46,110,131 (+) NCBI UU_Cfam_GSD_1.0
Hic1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 45,241,606 - 45,248,219 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 8,122,749 - 8,125,306 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 8,122,557 - 8,126,157 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HIC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 48,168,900 - 48,172,636 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 48,167,861 - 48,172,540 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 50,021,109 - 50,025,558 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HIC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 1,687,560 - 1,697,888 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 1,694,341 - 1,697,023 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 20,267,675 - 20,271,313 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hic1
.
Predicted Target Of
Count of predictions: 148 Count of miRNA genes: 106 Interacting mature miRNAs: 118 Transcripts: ENSRNOT00000004143, ENSRNOT00000066972 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
Hic1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 37,395,772 - 37,396,092 (+) Marker Load Pipeline Rnor_6.0 10 62,007,652 - 62,007,753 NCBI Rnor6.0 Rnor_5.0 10 61,722,042 - 61,722,143 UniSTS Rnor5.0 RGSC_v3.4 10 62,471,238 - 62,471,338 UniSTS RGSC3.4 Celera 10 59,044,969 - 59,045,066 UniSTS Cytogenetic Map 10 q24 UniSTS
BE100929
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 60,019,266 - 60,019,416 (+) MAPPER mRatBN7.2 Rnor_6.0 10 62,010,566 - 62,010,715 NCBI Rnor6.0 Rnor_5.0 10 61,724,956 - 61,725,105 UniSTS Rnor5.0 RGSC_v3.4 10 62,476,298 - 62,476,447 UniSTS RGSC3.4 Celera 10 59,049,220 - 59,049,369 UniSTS Cytogenetic Map 10 q24 UniSTS
G54872
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 60,015,541 - 60,015,789 (+) MAPPER mRatBN7.2 Rnor_6.0 10 62,480,957 - 62,481,204 NCBI Rnor6.0 Rnor_6.0 10 62,008,171 - 62,008,418 NCBI Rnor6.0 Rnor_5.0 10 61,722,561 - 61,722,808 UniSTS Rnor5.0 Rnor_5.0 10 62,192,273 - 62,192,520 UniSTS Rnor5.0 RGSC_v3.4 10 62,471,756 - 62,472,003 UniSTS RGSC3.4 Celera 10 59,045,484 - 59,045,731 UniSTS Cytogenetic Map 10 q24 UniSTS
RH124699
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 60,014,518 - 60,014,663 (+) MAPPER mRatBN7.2 Rnor_6.0 10 62,007,149 - 62,007,293 NCBI Rnor6.0 Rnor_5.0 10 61,721,539 - 61,721,683 UniSTS Rnor5.0 RGSC_v3.4 10 62,470,735 - 62,470,879 UniSTS RGSC3.4 Celera 10 59,044,466 - 59,044,610 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004143 ⟹ ENSRNOP00000004143
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,014,507 - 60,018,109 (-) Ensembl Rnor_6.0 Ensembl 10 62,007,150 - 62,009,582 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079956 ⟹ ENSRNOP00000074161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,014,520 - 60,019,475 (-) Ensembl Rnor_6.0 Ensembl 10 62,480,767 - 62,483,342 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115646 ⟹ ENSRNOP00000090248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,011,528 - 60,019,160 (-) Ensembl
RefSeq Acc Id:
NM_001107021 ⟹ NP_001100491
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,512,858 - 60,517,812 (-) NCBI mRatBN7.2 10 60,014,520 - 60,019,475 (-) NCBI Rnor_6.0 10 62,007,150 - 62,010,774 (-) NCBI Rnor_5.0 10 61,721,540 - 61,725,164 (-) NCBI RGSC_v3.4 10 62,470,736 - 62,476,506 (-) RGD
Sequence:
ATGATTACAAGAGTGCGCCACCAGCCCTGGCTTGAGTTCCCCATTTGAAGACAGAACCTTTTCCGAATTGGTGCAATATTACTTTTAAATATGTACTCGGAAGCACTCAGCACAAAACCCCAAGGTTT
hide sequence
RefSeq Acc Id:
NM_001422893 ⟹ NP_001409822
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,512,855 - 60,517,445 (-) NCBI
RefSeq Acc Id:
XM_063269069 ⟹ XP_063125139
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,512,855 - 60,516,453 (-) NCBI
RefSeq Acc Id:
XM_063269070 ⟹ XP_063125140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,512,855 - 60,517,030 (-) NCBI
RefSeq Acc Id:
NP_001100491 ⟸ NM_001107021
- Peptide Label:
isoform 2
- Sequence:
MLDAMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLTDSVEAAAAAAVAPGAEPSLGAVLAAASYLQIPDLVALCKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000004143 ⟸ ENSRNOT00000004143
Ensembl Acc Id:
ENSRNOP00000074161 ⟸ ENSRNOT00000079956
Ensembl Acc Id:
ENSRNOP00000090248 ⟸ ENSRNOT00000115646
RefSeq Acc Id:
NP_001409822 ⟸ NM_001422893
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6ADF2 (UniProtKB/TrEMBL), A0A0G2K7D6 (UniProtKB/TrEMBL), A6HGP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125140 ⟸ XM_063269070
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063125139 ⟸ XM_063269069
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Hic1
HIC ZBTB transcriptional repressor 1
LOC100912068
hypermethylated in cancer 1 protein-like
Data merged from RGD:6488990
737654 PROVISIONAL
2016-10-12
Hic1
HIC ZBTB transcriptional repressor 1
Hic1
hypermethylated in cancer 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100912068
hypermethylated in cancer 1 protein-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-04-30
Hic1
hypermethylated in cancer 1
Hic1_predicted
hypermethylated in cancer 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Hic1_predicted
hypermethylated in cancer 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
