Symbol:
Ercc1
Name:
ERCC excision repair 1, endonuclease non-catalytic subunit
RGD ID:
1306992
Description:
Predicted to enable DNA binding activity; TFIID-class transcription factor complex binding activity; and promoter-specific chromatin binding activity. Predicted to contribute to 3' overhang single-stranded DNA endodeoxyribonuclease activity and DNA binding activity. Involved in several processes, including response to cadmium ion; response to immobilization stress; and response to sucrose. Predicted to be located in chromosome, telomeric region and nucleoplasm. Predicted to be part of ERCC4-ERCC1 complex and nucleotide-excision repair factor 1 complex. Predicted to be active in nucleus. Used to study lung carcinoma. Biomarker of alcohol use disorder. Human ortholog(s) of this gene implicated in several diseases, including azoospermia; carcinoma (multiple); cerebrooculofacioskeletal syndrome 4; gastrointestinal system cancer (multiple); and hematologic cancer (multiple). Orthologous to human ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit); PARTICIPATES IN nucleotide excision repair pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
DNA excision repair protein ERCC-1; excision repair cross-complementation group 1; excision repair cross-complementing 1; excision repair cross-complementing rodent repair deficiency, complementation group 1; LOC292673
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ercc1 (excision repair cross-complementing rodent repair deficiency, complementation group 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ercc1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ercc1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ercc1 (ERCC excision repair 1, endonuclease non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ERCC1 (ERCC excision repair 1, endonuclease non-catalytic subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ercc1 (excision repair cross-complementing rodent repair deficiency, complementation group 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ercc1 (excision repair cross-complementation group 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ercc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RAD10
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PhylomeDB)
Caenorhabditis elegans (roundworm):
ercc-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ercc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,099,308 - 88,135,966 (+) NCBI GRCr8 mRatBN7.2 1 78,971,310 - 79,007,963 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 78,996,390 - 79,007,963 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,385,658 - 84,396,816 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 92,943,314 - 92,954,535 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,140,755 - 86,151,914 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,256,973 - 80,268,198 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,256,973 - 80,268,198 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,523,234 - 81,534,459 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 78,711,249 - 78,722,474 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 78,787,675 - 78,800,533 (+) NCBI Celera 1 73,458,746 - 73,469,951 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ercc1 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of ERCC1 mRNA CTD PMID:17971868 Ercc1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ERCC1 mRNA] CTD PMID:31150632 Ercc1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO Ercc1 (Mus musculus) 6480464 [epigallocatechin gallate co-treated with polylactic acid-polyglycolic acid copolymer analog] inhibits the reaction [9 more ... CTD PMID:23717041 Ercc1 Rat (-)-quinic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Quinic Acid analog] results in increased expression of ERCC1 mRNA CTD PMID:21751221 Ercc1 Rat 1,2-dimethylhydrazine increases expression ISO Ercc1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ERCC1 mRNA CTD PMID:22206623 Ercc1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ERCC1 mRNA CTD PMID:17942748 Ercc1 Rat 17beta-estradiol multiple interactions ISO ERCC1 (Homo sapiens) 6480464 decitabine inhibits the reaction [Estradiol results in decreased expression of ERCC1 mRNA] CTD PMID:22082530 Ercc1 Rat 17beta-estradiol decreases expression ISO ERCC1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ERCC1 mRNA CTD PMID:22082530 Ercc1 Rat 1H-pyrazole increases expression ISO Ercc1 (Mus musculus) 6480464 pyrazole results in increased expression of ERCC1 mRNA CTD PMID:17945193 Ercc1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:28712647 Ercc1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ercc1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ercc1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO ERCC1 (Homo sapiens) 6480464 2 more ... CTD PMID:26808241 Ercc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ERCC1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ERCC1 promoter] CTD PMID:17942748 and PMID:19654925 Ercc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ERCC1 mRNA CTD PMID:33387578 Ercc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ercc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ERCC1 mRNA CTD PMID:21570461 Ercc1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ERCC1 mRNA CTD PMID:21346803 Ercc1 Rat 2-hydroxypropanoic acid decreases expression ISO ERCC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ERCC1 mRNA CTD PMID:30851411 Ercc1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Ercc1 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of ERCC1 mRNA CTD PMID:25172293 Ercc1 Rat 3-aminobenzamide multiple interactions ISO ERCC1 (Homo sapiens) 6480464 3-aminobenzamide inhibits the reaction [Glucose results in increased expression of ERCC1 mRNA] and 3-aminobenzamide inhibits the reaction [Glucose results in increased expression of ERCC1 protein] CTD PMID:22228707 Ercc1 Rat 3-aminobenzamide multiple interactions EXP 6480464 3-aminobenzamide inhibits the reaction [Streptozocin results in increased expression of ERCC1 mRNA] CTD PMID:22228707 Ercc1 Rat 3-aminobenzamide decreases expression ISO ERCC1 (Homo sapiens) 6480464 3-aminobenzamide results in decreased expression of ERCC1 mRNA and 3-aminobenzamide results in decreased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of ERCC1 mRNA CTD PMID:21346803 Ercc1 Rat 4-hydroxynon-2-enal decreases expression ISO Ercc1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of ERCC1 mRNA CTD PMID:19191707 Ercc1 Rat 4-hydroxyphenyl retinamide increases expression ISO ERCC1 (Homo sapiens) 6480464 Fenretinide results in increased expression of ERCC1 protein CTD PMID:15059897 Ercc1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ercc1 (Mus musculus) 6480464 Fenretinide results in increased expression of ERCC1 mRNA CTD PMID:28973697 Ercc1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO ERCC1 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Cadmium Chloride results in decreased expression of ERCC1 mRNA] more ... CTD PMID:22082530 and PMID:22112500 Ercc1 Rat 5-aza-2'-deoxycytidine decreases expression ISO ERCC1 (Homo sapiens) 6480464 Decitabine results in decreased expression of ERCC1 mRNA CTD PMID:22082530 Ercc1 Rat 5-fluorouracil multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Cisplatin co-treated with Fluorouracil] results in decreased expression of ERCC1 mRNA more ... CTD PMID:15173087 more ... Ercc1 Rat 5-fluorouracil decreases expression ISO ERCC1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of ERCC1 mRNA CTD PMID:17016597 Ercc1 Rat 5-formyltetrahydrofolic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene SNP affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with oxaliplatin] CTD PMID:17401013 Ercc1 Rat 7,12-dimethyltetraphene decreases expression ISO Ercc1 (Mus musculus) 6480464 9 more ... CTD PMID:23717041 Ercc1 Rat 7,12-dimethyltetraphene multiple interactions ISO Ercc1 (Mus musculus) 6480464 [epigallocatechin gallate co-treated with polylactic acid-polyglycolic acid copolymer analog] inhibits the reaction [9 more ... CTD PMID:23717041 Ercc1 Rat acrolein multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ERCC1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of ERCC1 mRNA CTD PMID:32699268 Ercc1 Rat aflatoxin B1 increases expression ISO ERCC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ERCC1 mRNA CTD PMID:22100608 Ercc1 Rat aldehydo-D-glucose multiple interactions ISO ERCC1 (Homo sapiens) 6480464 3-aminobenzamide inhibits the reaction [Glucose results in increased expression of ERCC1 mRNA] more ... CTD PMID:22228707 Ercc1 Rat aldehydo-D-glucose increases expression ISO ERCC1 (Homo sapiens) 6480464 Glucose results in increased expression of ERCC1 mRNA and Glucose results in increased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat alpha-pinene multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ERCC1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of ERCC1 mRNA CTD PMID:32699268 Ercc1 Rat amphibole asbestos increases expression ISO ERCC1 (Homo sapiens) 6480464 Asbestos and Amphibole results in increased expression of ERCC1 protein CTD PMID:20855422 Ercc1 Rat arsane decreases expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ERCC1 mRNA and Arsenic results in decreased expression of ERCC1 protein CTD PMID:12569548 and PMID:16882524 Ercc1 Rat arsane multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of ERCC1 mRNA CTD PMID:33736254 Ercc1 Rat arsane affects expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic affects the expression of ERCC1 mRNA CTD PMID:33736254 Ercc1 Rat arsane increases expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic results in increased expression of ERCC1 mRNA CTD PMID:19661343 Ercc1 Rat arsenic atom increases expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic results in increased expression of ERCC1 mRNA CTD PMID:19661343 Ercc1 Rat arsenic atom affects expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic affects the expression of ERCC1 mRNA CTD PMID:33736254 Ercc1 Rat arsenic atom multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of ERCC1 mRNA CTD PMID:33736254 Ercc1 Rat arsenic atom decreases expression ISO ERCC1 (Homo sapiens) 6480464 Arsenic results in decreased expression of ERCC1 mRNA and Arsenic results in decreased expression of ERCC1 protein CTD PMID:12569548 and PMID:16882524 Ercc1 Rat azathioprine increases expression ISO ERCC1 (Homo sapiens) 6480464 Azathioprine results in increased expression of ERCC1 mRNA CTD PMID:22623647 Ercc1 Rat benzene affects expression ISO ERCC1 (Homo sapiens) 6480464 Benzene affects the expression of ERCC1 mRNA CTD PMID:16188086 Ercc1 Rat benzo[a]pyrene affects expression ISO ERCC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of ERCC1 mRNA CTD PMID:20624995 Ercc1 Rat benzo[a]pyrene decreases expression ISO ERCC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ERCC1 protein CTD PMID:30020114 Ercc1 Rat benzo[a]pyrene multiple interactions ISO Ercc1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [Benzo(a)pyrene results in decreased expression of ERCC1 mRNA] CTD PMID:30020114 Ercc1 Rat benzo[a]pyrene decreases expression ISO Ercc1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ERCC1 mRNA CTD PMID:30020114 Ercc1 Rat benzo[a]pyrene multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Folic Acid co-treated with Benzo(a)pyrene] results in increased expression of ERCC1 mRNA and Folic Acid inhibits the reaction [Benzo(a)pyrene results in decreased expression of ERCC1 protein] CTD PMID:30020114 Ercc1 Rat benzo[a]pyrene increases expression ISO Ercc1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ERCC1 mRNA CTD PMID:22228805 and PMID:22641617 Ercc1 Rat benzo[a]pyrene affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein affects the susceptibility to Benzo(a)pyrene CTD PMID:22382310 Ercc1 Rat benzo[a]pyrene increases expression ISO ERCC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ERCC1 mRNA and Benzo(a)pyrene results in increased expression of ERCC1 protein CTD PMID:19748547 and PMID:21632981 Ercc1 Rat benzo[a]pyrene diol epoxide I increases expression ISO ERCC1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ercc1 Rat benzo[a]pyrene diol epoxide I affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene SNP affects the susceptibility to 7 more ... CTD PMID:30453383 Ercc1 Rat beta-lapachone increases expression ISO ERCC1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ERCC1 mRNA CTD PMID:38218311 Ercc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ERCC1 mRNA CTD PMID:25181051 Ercc1 Rat bisphenol F decreases expression ISO Ercc1 (Mus musculus) 6480464 bisphenol F results in decreased expression of ERCC1 mRNA CTD PMID:38685157 Ercc1 Rat cadmium dichloride decreases expression ISO Ercc1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of ERCC1 mRNA CTD PMID:15501611 Ercc1 Rat cadmium dichloride increases expression ISO ERCC1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ERCC1 mRNA and Cadmium Chloride results in increased expression of ERCC1 protein CTD PMID:26220685 and PMID:38568856 Ercc1 Rat cadmium dichloride decreases expression ISO ERCC1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ERCC1 mRNA and Cadmium Chloride results in decreased expression of ERCC1 protein CTD PMID:22112500 and PMID:26472689 Ercc1 Rat cadmium dichloride multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased activity of [DNMT1 protein co-treated with DNMT3A protein]] which results in decreased expression of ERCC1 mRNA more ... CTD PMID:22112500 Ercc1 Rat cadmium dichloride increases methylation ISO ERCC1 (Homo sapiens) 6480464 Cadmium Chloride results in increased methylation of ERCC1 promoter CTD PMID:22112500 Ercc1 Rat cadmium dichloride increases expression ISO Ercc1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of ERCC1 mRNA CTD PMID:11958953 Ercc1 Rat cadmium dichloride multiple interactions ISO Ercc1 (Mus musculus) 6480464 MT1 affects the reaction [Cadmium Chloride results in increased expression of ERCC1 mRNA] and MT2 affects the reaction [Cadmium Chloride results in increased expression of ERCC1 mRNA] CTD PMID:11958953 Ercc1 Rat camptothecin multiple interactions ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein promotes the reaction [veliparib promotes the reaction [Camptothecin results in increased expression of H2AX protein]] CTD PMID:21227924 Ercc1 Rat camptothecin decreases expression ISO ERCC1 (Homo sapiens) 6480464 Camptothecin results in decreased expression of ERCC1 mRNA CTD PMID:24792648 Ercc1 Rat carbon nanotube increases expression ISO Ercc1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ERCC1 mRNA CTD PMID:25554681 Ercc1 Rat chlorpyrifos increases expression ISO Ercc1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ERCC1 mRNA CTD PMID:37019170 Ercc1 Rat choline multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ERCC1 gene CTD PMID:20938992 Ercc1 Rat cisplatin affects expression ISO ERCC1 (Homo sapiens) 6480464 Cisplatin affects the expression of ERCC1 mRNA and Cisplatin affects the expression of ERCC1 protein CTD PMID:21750216 and PMID:24799992 Ercc1 Rat cisplatin multiple interactions EXP 6480464 Lovastatin promotes the reaction [Cisplatin results in increased expression of ERCC1 mRNA] CTD PMID:26739623 Ercc1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ERCC1 mRNA CTD PMID:26739623 Ercc1 Rat cisplatin increases expression ISO ERCC1 (Homo sapiens) 6480464 Cisplatin results in increased expression of ERCC1 mRNA and Cisplatin results in increased expression of ERCC1 protein CTD PMID:21165580 more ... Ercc1 Rat cisplatin decreases response to substance ISO Ercc1 (Mus musculus) 6480464 ERCC1 results in decreased susceptibility to Cisplatin CTD PMID:21722328 Ercc1 Rat cisplatin increases response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein results in increased susceptibility to Cisplatin CTD PMID:21076943 Ercc1 Rat cisplatin decreases response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein results in decreased susceptibility to Cisplatin and ERCC1 results in decreased susceptibility to Cisplatin CTD PMID:21093896 more ... Ercc1 Rat cisplatin multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Cisplatin co-treated with Fluorouracil] results in decreased expression of ERCC1 mRNA more ... CTD PMID:15173087 more ... Ercc1 Rat cobalt atom multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Cobalt co-treated with Organometallic Compounds] results in increased expression of ERCC1 mRNA CTD PMID:22147119 Ercc1 Rat cobalt atom increases expression ISO Ercc1 (Mus musculus) 6480464 Cobalt results in increased expression of ERCC1 mRNA CTD PMID:22147119 Ercc1 Rat cobalt dichloride decreases expression ISO ERCC1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ERCC1 mRNA CTD PMID:19320972 and PMID:19376846 Ercc1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ERCC1 mRNA CTD PMID:24386269 Ercc1 Rat copper(II) chloride increases expression ISO ERCC1 (Homo sapiens) 6480464 cupric chloride results in increased expression of ERCC1 mRNA CTD PMID:38568856 Ercc1 Rat copper(II) sulfate increases expression ISO ERCC1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ERCC1 mRNA CTD PMID:19549813 Ercc1 Rat curcumin multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Curcumin results in decreased expression of ERCC1 protein] which results in increased susceptibility to Cisplatin more ... CTD PMID:21493726 and PMID:22228707 Ercc1 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Streptozocin results in increased expression of ERCC1 mRNA] CTD PMID:22228707 Ercc1 Rat curcumin decreases expression ISO ERCC1 (Homo sapiens) 6480464 Curcumin results in decreased expression of ERCC1 mRNA and Curcumin results in decreased expression of ERCC1 protein CTD PMID:17596214 more ... Ercc1 Rat cyclophosphamide affects expression EXP 6480464 Cyclophosphamide affects the expression of ERCC1 mRNA CTD PMID:11906922 Ercc1 Rat cyclosporin A increases expression ISO ERCC1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ERCC1 mRNA CTD PMID:20106945 Ercc1 Rat cyproconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ERCC1 mRNA CTD PMID:29038839 Ercc1 Rat D-glucose increases expression ISO ERCC1 (Homo sapiens) 6480464 Glucose results in increased expression of ERCC1 mRNA and Glucose results in increased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat D-glucose multiple interactions ISO ERCC1 (Homo sapiens) 6480464 3-aminobenzamide inhibits the reaction [Glucose results in increased expression of ERCC1 mRNA] more ... CTD PMID:22228707 Ercc1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of ERCC1 mRNA CTD PMID:33729688 Ercc1 Rat disodium selenite increases expression ISO ERCC1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of ERCC1 mRNA CTD PMID:18175754 Ercc1 Rat dorsomorphin multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERCC1 mRNA CTD PMID:27188386 Ercc1 Rat doxorubicin increases expression ISO Ercc1 (Mus musculus) 6480464 Doxorubicin results in increased expression of ERCC1 mRNA CTD PMID:22712078 Ercc1 Rat doxorubicin increases expression ISO ERCC1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ERCC1 mRNA CTD PMID:36634904 Ercc1 Rat elemental selenium increases expression ISO ERCC1 (Homo sapiens) 6480464 Selenium results in increased expression of ERCC1 mRNA CTD PMID:19244175 Ercc1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ERCC1 mRNA CTD PMID:29391264 Ercc1 Rat epoxiconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ERCC1 mRNA CTD PMID:29038839 Ercc1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ERCC1 mRNA CTD PMID:34547370 Ercc1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ERCC1 mRNA CTD PMID:24136188 Ercc1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ERCC1 mRNA CTD PMID:24136188 Ercc1 Rat folic acid multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ERCC1 gene and Folic Acid inhibits the reaction [Benzo(a)pyrene results in decreased expression of ERCC1 mRNA] CTD PMID:20938992 and PMID:30020114 Ercc1 Rat folic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Folic Acid co-treated with Benzo(a)pyrene] results in increased expression of ERCC1 mRNA and Folic Acid inhibits the reaction [Benzo(a)pyrene results in decreased expression of ERCC1 protein] CTD PMID:30020114 Ercc1 Rat fonofos affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 polymorphism affects the susceptibility to Fonofos CTD PMID:22102698 Ercc1 Rat furan increases expression EXP 6480464 furan results in increased expression of ERCC1 mRNA CTD PMID:22079235 Ercc1 Rat gefitinib multiple interactions ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene polymorphism affects the susceptibility to [gefitinib co-treated with Cisplatin] CTD PMID:21264830 Ercc1 Rat gefitinib affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene polymorphism affects the susceptibility to gefitinib CTD PMID:21264830 Ercc1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ERCC1 mRNA CTD PMID:33387578 Ercc1 Rat glucose increases expression ISO ERCC1 (Homo sapiens) 6480464 Glucose results in increased expression of ERCC1 mRNA and Glucose results in increased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat glucose multiple interactions ISO ERCC1 (Homo sapiens) 6480464 3-aminobenzamide inhibits the reaction [Glucose results in increased expression of ERCC1 mRNA] more ... CTD PMID:22228707 Ercc1 Rat hexadecanoic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Arsenic] affects the expression of ERCC1 mRNA CTD PMID:33736254 Ercc1 Rat hydrogen peroxide multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Quinic Acid analog] results in increased expression of ERCC1 mRNA CTD PMID:21751221 Ercc1 Rat irinotecan decreases expression ISO ERCC1 (Homo sapiens) 6480464 Irinotecan results in decreased expression of ERCC1 protein CTD PMID:11593056 Ercc1 Rat isotretinoin decreases expression ISO ERCC1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ERCC1 mRNA CTD PMID:20436886 Ercc1 Rat L-methionine multiple interactions ISO Ercc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ERCC1 gene CTD PMID:20938992 Ercc1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of ERCC1 mRNA CTD PMID:33862172 Ercc1 Rat lead nitrate multiple interactions ISO Ercc1 (Mus musculus) 6480464 lead nitrate affects the reaction [ERCC1 affects the expression of MT1 mRNA] and lead nitrate affects the reaction [ERCC1 affects the expression of MT2 mRNA] CTD PMID:11891201 Ercc1 Rat lipopolysaccharide multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in decreased expression of ERCC1 mRNA CTD PMID:22777745 Ercc1 Rat lithium chloride increases expression ISO ERCC1 (Homo sapiens) 6480464 Lithium Chloride results in increased expression of ERCC1 mRNA CTD PMID:15711924 Ercc1 Rat lovastatin multiple interactions EXP 6480464 Lovastatin promotes the reaction [Cisplatin results in increased expression of ERCC1 mRNA] CTD PMID:26739623 Ercc1 Rat lovastatin increases expression EXP 6480464 Lovastatin results in increased expression of ERCC1 mRNA CTD PMID:26739623 Ercc1 Rat MeIQx decreases expression ISO ERCC1 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:22100608 Ercc1 Rat melatonin increases expression ISO ERCC1 (Homo sapiens) 6480464 Melatonin results in increased expression of ERCC1 protein CTD PMID:24799992 Ercc1 Rat methylseleninic acid increases expression ISO ERCC1 (Homo sapiens) 6480464 methylselenic acid results in increased expression of ERCC1 mRNA CTD PMID:12517777 Ercc1 Rat microcystin RR decreases expression ISO ERCC1 (Homo sapiens) 6480464 microcystin RR results in decreased expression of ERCC1 protein CTD PMID:19111056 Ercc1 Rat myristicin decreases expression ISO ERCC1 (Homo sapiens) 6480464 myristicin results in decreased expression of ERCC1 mRNA CTD PMID:24792648 Ercc1 Rat N-acetyl-L-cysteine multiple interactions ISO ERCC1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Acetaminophen results in increased expression of ERCC1 mRNA] CTD PMID:33971260 Ercc1 Rat oxaliplatin multiple interactions ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene polymorphism affects the susceptibility to [Fluorouracil co-treated with oxaliplatin] and ERCC1 gene SNP affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with oxaliplatin] CTD PMID:15213713 more ... Ercc1 Rat oxaliplatin increases expression ISO ERCC1 (Homo sapiens) 6480464 oxaliplatin results in increased expression of ERCC1 mRNA CTD PMID:16773204 Ercc1 Rat oxaliplatin affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 gene polymorphism affects the susceptibility to oxaliplatin and ERCC1 protein affects the susceptibility to oxaliplatin CTD PMID:15041737 more ... Ercc1 Rat ozone multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ERCC1 mRNA more ... CTD PMID:32699268 Ercc1 Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Ozone]] which results in decreased methylation of ERCC1 gene and [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Ozone]] which results in increased expression of ERCC1 mRNA CTD PMID:36423397 Ercc1 Rat paracetamol affects expression ISO Ercc1 (Mus musculus) 6480464 Acetaminophen affects the expression of ERCC1 mRNA CTD PMID:17562736 Ercc1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ERCC1 mRNA CTD PMID:33387578 Ercc1 Rat paracetamol multiple interactions ISO ERCC1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Acetaminophen results in increased expression of ERCC1 mRNA] CTD PMID:33971260 Ercc1 Rat paracetamol increases expression ISO ERCC1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ERCC1 mRNA CTD PMID:33971260 Ercc1 Rat paraquat affects splicing ISO ERCC1 (Homo sapiens) 6480464 Paraquat affects the splicing of ERCC1 mRNA CTD PMID:23613995 Ercc1 Rat PD 0325901 decreases expression ISO ERCC1 (Homo sapiens) 6480464 mirdametinib results in decreased expression of ERCC1 mRNA CTD PMID:21996734 Ercc1 Rat PD 0325901 multiple interactions ISO ERCC1 (Homo sapiens) 6480464 mirdametinib inhibits the reaction [Cisplatin results in increased expression of ERCC1 mRNA] and mirdametinib inhibits the reaction [Cisplatin results in increased expression of ERCC1 protein] CTD PMID:21996734 Ercc1 Rat pemetrexed multiple interactions ISO ERCC1 (Homo sapiens) 6480464 Pemetrexed inhibits the reaction [resveratrol results in increased stability of and results in increased expression of ERCC1 mRNA] and Pemetrexed inhibits the reaction [resveratrol results in increased stability of and results in increased expression of ERCC1 protein] CTD PMID:23912706 Ercc1 Rat pemetrexed decreases expression ISO ERCC1 (Homo sapiens) 6480464 Pemetrexed results in decreased expression of ERCC1 mRNA and Pemetrexed results in decreased expression of ERCC1 protein CTD PMID:23912706 Ercc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ercc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of ERCC1 mRNA CTD PMID:36331819 Ercc1 Rat PhIP decreases expression ISO ERCC1 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of ERCC1 mRNA CTD PMID:22100608 Ercc1 Rat pinosylvin increases expression ISO ERCC1 (Homo sapiens) 6480464 pinosylvin results in increased expression of ERCC1 mRNA CTD PMID:23333577 Ercc1 Rat pirinixic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ERCC1 mRNA CTD PMID:19710929 Ercc1 Rat platinum affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein affects the susceptibility to Platinum CTD PMID:15788669 Ercc1 Rat platinum(0) affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein affects the susceptibility to Platinum CTD PMID:15788669 Ercc1 Rat prochloraz multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ERCC1 mRNA CTD PMID:29038839 Ercc1 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of ERCC1 mRNA CTD PMID:22431067 Ercc1 Rat quercetin increases expression ISO ERCC1 (Homo sapiens) 6480464 Quercetin results in increased expression of ERCC1 mRNA CTD PMID:21632981 Ercc1 Rat quercitrin decreases expression ISO ERCC1 (Homo sapiens) 6480464 quercitrin results in decreased expression of ERCC1 mRNA CTD PMID:25193878 Ercc1 Rat rac-lactic acid decreases expression ISO ERCC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ERCC1 mRNA CTD PMID:30851411 Ercc1 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of ERCC1 mRNA CTD PMID:33775663 Ercc1 Rat resveratrol multiple interactions ISO ERCC1 (Homo sapiens) 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [resveratrol results in increased expression of ERCC1 mRNA] more ... CTD PMID:23912706 Ercc1 Rat resveratrol affects response to substance ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein affects the susceptibility to resveratrol CTD PMID:23912706 Ercc1 Rat SB 203580 increases expression ISO ERCC1 (Homo sapiens) 6480464 SB 203580 results in increased expression of ERCC1 mRNA CTD PMID:21165580 Ercc1 Rat SB 203580 multiple interactions ISO ERCC1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [tanshinone results in decreased expression of ERCC1 mRNA] CTD PMID:21165580 Ercc1 Rat SB 431542 multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERCC1 mRNA CTD PMID:27188386 Ercc1 Rat sclareol multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [sclareol co-treated with Cisplatin] results in decreased expression of ERCC1 protein CTD PMID:33164868 Ercc1 Rat sclareol decreases expression ISO ERCC1 (Homo sapiens) 6480464 sclareol results in decreased expression of ERCC1 protein CTD PMID:33164868 Ercc1 Rat selenium atom increases expression ISO ERCC1 (Homo sapiens) 6480464 Selenium results in increased expression of ERCC1 mRNA CTD PMID:19244175 Ercc1 Rat sodium arsenate increases expression ISO Ercc1 (Mus musculus) 6480464 sodium arsenate results in increased expression of ERCC1 mRNA CTD PMID:11353140 Ercc1 Rat sodium arsenite multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cisplatin] results in increased expression of ERCC1 protein CTD PMID:21696631 Ercc1 Rat sodium arsenite increases expression ISO ERCC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ERCC1 mRNA CTD PMID:38568856 Ercc1 Rat sodium arsenite increases expression ISO Ercc1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ERCC1 mRNA CTD PMID:11353140 Ercc1 Rat sodium arsenite decreases expression ISO ERCC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ERCC1 mRNA and sodium arsenite results in decreased expression of ERCC1 protein CTD PMID:21776218 and PMID:29705342 Ercc1 Rat sodium dichromate decreases expression ISO ERCC1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of ERCC1 mRNA CTD PMID:17685462 Ercc1 Rat sterigmatocystin increases expression EXP 6480464 Sterigmatocystin results in increased expression of ERCC1 mRNA CTD PMID:34126181 Ercc1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ERCC1 mRNA and Streptozocin results in increased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat streptozocin multiple interactions EXP 6480464 3-aminobenzamide inhibits the reaction [Streptozocin results in increased expression of ERCC1 mRNA] and Curcumin inhibits the reaction [Streptozocin results in increased expression of ERCC1 mRNA] CTD PMID:22228707 Ercc1 Rat sunitinib decreases expression ISO ERCC1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ERCC1 mRNA CTD PMID:31533062 Ercc1 Rat Tanshinone I multiple interactions ISO ERCC1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [tanshinone results in decreased expression of ERCC1 mRNA] CTD PMID:21165580 Ercc1 Rat Tanshinone I decreases expression ISO ERCC1 (Homo sapiens) 6480464 tanshinone results in decreased expression of ERCC1 mRNA CTD PMID:21165580 Ercc1 Rat tetrachloromethane increases expression ISO Ercc1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ERCC1 mRNA CTD PMID:15056808 Ercc1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ERCC1 mRNA] CTD PMID:31150632 Ercc1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ERCC1 mRNA CTD PMID:31150632 Ercc1 Rat tetraphene increases expression ISO ERCC1 (Homo sapiens) 6480464 benz(a)anthracene results in increased expression of ERCC1 mRNA CTD PMID:22236718 Ercc1 Rat theaflavin multiple interactions ISO Ercc1 (Mus musculus) 6480464 [theaflavin co-treated with polylactic acid-polyglycolic acid copolymer analog] inhibits the reaction [9 more ... CTD PMID:23717041 Ercc1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ERCC1 mRNA CTD PMID:34492290 Ercc1 Rat titanium dioxide increases methylation ISO Ercc1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ERCC1 promoter CTD PMID:35295148 Ercc1 Rat titanium dioxide decreases methylation ISO Ercc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ERCC1 gene and titanium dioxide results in decreased methylation of ERCC1 promoter CTD PMID:35295148 Ercc1 Rat trans-pinosylvin increases expression ISO ERCC1 (Homo sapiens) 6480464 pinosylvin results in increased expression of ERCC1 mRNA CTD PMID:23333577 Ercc1 Rat trichostatin A multiple interactions ISO ERCC1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Glucose results in increased expression of ERCC1 mRNA] and trichostatin A inhibits the reaction [Glucose results in increased expression of ERCC1 protein] CTD PMID:22228707 Ercc1 Rat trichostatin A decreases expression ISO ERCC1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ERCC1 mRNA and trichostatin A results in decreased expression of ERCC1 protein CTD PMID:22228707 Ercc1 Rat triclosan affects expression ISO ERCC1 (Homo sapiens) 6480464 Triclosan affects the expression of ERCC1 mRNA CTD PMID:31714634 Ercc1 Rat triphenyl phosphate affects expression ISO ERCC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ERCC1 mRNA CTD PMID:37042841 Ercc1 Rat trovafloxacin decreases expression ISO Ercc1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ERCC1 mRNA CTD PMID:35537566 Ercc1 Rat usnic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [usnic acid co-treated with Lipopolysaccharides] results in decreased expression of ERCC1 mRNA CTD PMID:22777745 Ercc1 Rat valproic acid affects expression ISO Ercc1 (Mus musculus) 6480464 Valproic Acid affects the expression of ERCC1 mRNA CTD PMID:17292431 Ercc1 Rat valproic acid multiple interactions ISO ERCC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ERCC1 mRNA CTD PMID:27188386 Ercc1 Rat valproic acid decreases expression ISO ERCC1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ERCC1 mRNA CTD PMID:26272509 Ercc1 Rat valproic acid affects expression ISO ERCC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ERCC1 mRNA CTD PMID:25979313 Ercc1 Rat vancomycin decreases expression ISO Ercc1 (Mus musculus) 6480464 Vancomycin results in decreased expression of ERCC1 mRNA CTD PMID:18930951 Ercc1 Rat veliparib multiple interactions ISO ERCC1 (Homo sapiens) 6480464 ERCC1 protein promotes the reaction [veliparib promotes the reaction [Camptothecin results in increased expression of H2AX protein]] CTD PMID:21227924 Ercc1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ERCC1 mRNA CTD PMID:23034163 Ercc1 Rat vitamin E increases expression ISO ERCC1 (Homo sapiens) 6480464 Vitamin E results in increased expression of ERCC1 mRNA CTD PMID:19244175 Ercc1 Rat Y-27632 increases expression ISO ERCC1 (Homo sapiens) 6480464 Y 27632 results in increased expression of ERCC1 mRNA CTD PMID:20878077 Ercc1 Rat zinc atom increases expression ISO ERCC1 (Homo sapiens) 6480464 Zinc results in increased expression of ERCC1 mRNA CTD PMID:15226459 Ercc1 Rat zinc sulfate increases expression ISO ERCC1 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of ERCC1 mRNA CTD PMID:15226459 Ercc1 Rat zinc(0) increases expression ISO ERCC1 (Homo sapiens) 6480464 Zinc results in increased expression of ERCC1 mRNA CTD PMID:15226459
Imported Annotations - KEGG (archival)
(+)-pilocarpine (EXP) (+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (-)-quinic acid (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-aminobenzamide (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-formyltetrahydrofolic acid (ISO) 7,12-dimethyltetraphene (ISO) acrolein (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) alpha-pinene (ISO) amphibole asbestos (ISO) arsane (ISO) arsenic atom (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium dichloride (ISO) camptothecin (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP,ISO) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) curcumin (EXP,ISO) cyclophosphamide (EXP) cyclosporin A (ISO) cyproconazole (EXP) D-glucose (ISO) dioxygen (EXP) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (EXP) ethanol (EXP) finasteride (EXP) flutamide (EXP) folic acid (ISO) fonofos (ISO) furan (EXP) gefitinib (ISO) gentamycin (EXP) glucose (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) irinotecan (ISO) isotretinoin (ISO) L-methionine (ISO) lead diacetate (EXP) lead nitrate (ISO) lipopolysaccharide (ISO) lithium chloride (ISO) lovastatin (EXP) MeIQx (ISO) melatonin (ISO) methylseleninic acid (ISO) microcystin RR (ISO) myristicin (ISO) N-acetyl-L-cysteine (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) PD 0325901 (ISO) pemetrexed (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (ISO) pinosylvin (ISO) pirinixic acid (ISO) platinum (ISO) platinum(0) (ISO) prochloraz (EXP) pyrazinecarboxamide (EXP) quercetin (ISO) quercitrin (ISO) rac-lactic acid (ISO) resveratrol (EXP,ISO) SB 203580 (ISO) SB 431542 (ISO) sclareol (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sterigmatocystin (EXP) streptozocin (EXP) sunitinib (ISO) Tanshinone I (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) theaflavin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trans-pinosylvin (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) usnic acid (ISO) valproic acid (ISO) vancomycin (ISO) veliparib (ISO) vinclozolin (EXP) vitamin E (ISO) Y-27632 (ISO) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
1.
DNA repair gene XPD and XRCC1 polymorphisms and the risk of childhood acute lymphoblastic leukemia.
Batar B, etal., Leuk Res. 2009 Jun;33(6):759-63. doi: 10.1016/j.leukres.2008.11.005. Epub 2008 Dec 19.
2.
SNPs and taxane toxicity in breast cancer patients.
Boso V, etal., Pharmacogenomics. 2014;15(15):1845-58. doi: 10.2217/pgs.14.127.
3.
Polymorphisms of cancer-related genes and risk of multipleprimary malignancies involving colorectal cancer
Cao P, etal., Turk J Med Sci. 2017 Nov 13;47(5):1549-1554. doi: 10.3906/sag-1612-119.
4.
DNA damage drives accelerated bone aging via an NF-kappaB-dependent mechanism.
Chen Q, etal., J Bone Miner Res. 2013 May;28(5):1214-28. doi: 10.1002/jbmr.1851.
5.
Impact on response and survival of DNA repair single nucleotide polymorphisms in relapsed or refractory multiple myeloma patients treated with thalidomide.
Cibeira MT, etal., Leuk Res. 2011 Sep;35(9):1178-83. doi: 10.1016/j.leukres.2011.02.009. Epub 2011 Mar 23.
6.
Differential toxicity biomarkers for irinotecan- and oxaliplatin-containing chemotherapy in colorectal cancer.
Cortejoso L, etal., Cancer Chemother Pharmacol. 2013 Jun;71(6):1463-72. doi: 10.1007/s00280-013-2145-6. Epub 2013 Mar 31.
7.
Phase 1a/1b and pharmacogenetic study of docetaxel, oxaliplatin and capecitabine in patients with advanced cancer of the stomach or the gastroesophageal junction.
Deenen MJ, etal., Cancer Chemother Pharmacol. 2015 Dec;76(6):1285-95. doi: 10.1007/s00280-015-2872-y. Epub 2015 Oct 23.
8.
DNA adduct formation and oxidative stress in colon and liver of Big Blue rats after dietary exposure to diesel particles.
Dybdahl M, etal., Carcinogenesis. 2003 Nov;24(11):1759-66. Epub 2003 Aug 14.
9.
Tumour regression and ERCC1 nuclear protein expression predict clinical outcome in patients with gastro-oesophageal cancer treated with neoadjuvant chemotherapy.
Fareed KR, etal., Br J Cancer. 2010 May 25;102(11):1600-7. doi: 10.1038/sj.bjc.6605686. Epub 2010 May 11.
10.
Overexpression of the two nucleotide excision repair genes ERCC1 and XPC in human hepatocellular carcinoma.
Fautrel A, etal., J Hepatol. 2005 Aug;43(2):288-93. doi: 10.1016/j.jhep.2005.02.020. Epub 2005 Apr 25.
11.
Dynamic regulation of cerebral DNA repair genes by psychological stress.
Forsberg K, etal., Mutat Res Genet Toxicol Environ Mutagen. 2015 Jan 15;778:37-43. doi: 10.1016/j.mrgentox.2014.12.003. Epub 2014 Dec 27.
12.
Expression of DNA repair genes in ovarian cancer samples: biological and clinical considerations.
Ganzinelli M, etal., Eur J Cancer. 2011 May;47(7):1086-94. doi: 10.1016/j.ejca.2010.11.029. Epub 2011 Jan 7.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Association of four ERCC1 and ERCC2 SNPs with survival of bone tumour patients.
Hao T, etal., Asian Pac J Cancer Prev. 2012;13(8):3821-4.
16.
Myelofibrosis in Philadelphia chromosome-negative myeloproliferative neoplasms is associated with aberrant karyotypes.
Hauck G, etal., Cancer Genet. 2013 Apr;206(4):116-23. doi: 10.1016/j.cancergen.2013.02.002. Epub 2013 Apr 6.
17.
Excision repair cross-complementing 1 expression protects against ischemic injury following middle cerebral artery occlusion in the rat brain.
He KY, etal., Gene Ther. 2009 Jul;16(7):840-8. Epub 2009 May 14.
18.
Evaluation of cell proliferation, apoptosis, and DNA-repair genes as potential biomarkers for ethanol-induced CNS alterations.
Hicks SD, etal., BMC Neurosci. 2012 Oct 25;13:128. doi: 10.1186/1471-2202-13-128.
19.
A phase II study of neoadjuvant combination chemotherapy with docetaxel, cisplatin, and S-1 for locally advanced resectable gastric cancer: nucleotide excision repair (NER) as potential chemoresistance marker.
Hirakawa M, etal., Cancer Chemother Pharmacol. 2013 Mar;71(3):789-97. doi: 10.1007/s00280-013-2073-5. Epub 2013 Jan 22.
20.
A phase II study of biweekly paclitaxel and cisplatin chemotherapy for recurrent or metastatic esophageal squamous cell carcinoma: ERCC1 expression predicts response to chemotherapy.
Huang J, etal., Med Oncol. 2013 Mar;30(1):343. doi: 10.1007/s12032-012-0343-4. Epub 2012 Dec 21.
21.
ERCC1 and ERCC2 polymorphisms and risk of idiopathic azoospermia in a Chinese population.
Ji G, etal., Reprod Biomed Online. 2008 Jul;17(1):36-41.
22.
Defective transcription initiation causes postnatal growth failure in a mouse model of nucleotide excision repair (NER) progeria.
Kamileri I, etal., Proc Natl Acad Sci U S A. 2012 Feb 21;109(8):2995-3000. doi: 10.1073/pnas.1114941109. Epub 2012 Feb 8.
23.
DNA damage triggers a chronic autoinflammatory response, leading to fat depletion in NER progeria.
Karakasilioti I, etal., Cell Metab. 2013 Sep 3;18(3):403-15. doi: 10.1016/j.cmet.2013.08.011.
24.
Genetic polymorphisms and the efficacy and toxicity of cisplatin-based chemotherapy in ovarian cancer patients.
Khrunin AV, etal., Pharmacogenomics J. 2010 Feb;10(1):54-61. Epub 2009 Sep 29.
25.
Association of GSTT1 polymorphism with acute myeloid leukemia risk is dependent on smoking status.
Kim HN, etal., Leuk Lymphoma. 2012 Apr;53(4):681-7. doi: 10.3109/10428194.2011.625576. Epub 2012 Jan 3.
26.
Polymorphisms of ERCC1 genotype associated with response to imatinib therapy in chronic phase chronic myeloid leukemia.
Kong JH, etal., Int J Hematol. 2012 Sep;96(3):327-33. doi: 10.1007/s12185-012-1142-6. Epub 2012 Jul 21.
27.
High expression of ERCC1, FLT1, NME4 and PCNA associated with poor prognosis and advanced stages in myelodysplastic syndrome.
Kracmarova A, etal., Leuk Lymphoma. 2008 Jul;49(7):1297-305. doi: 10.1080/10428190802129918.
28.
Relationship between ERCC1 polymorphisms, disease progression, and survival in the Gynecologic Oncology Group Phase III Trial of intraperitoneal versus intravenous cisplatin and paclitaxel for stage III epithelial ovarian cancer.
Krivak TC, etal., J Clin Oncol. 2008 Jul 20;26(21):3598-606. doi: 10.1200/JCO.2008.16.1323.
29.
Polymorphisms in DNA repair genes and therapeutic outcomes of AML patients from SWOG clinical trials.
Kuptsova N, etal., Blood. 2007 May 1;109(9):3936-44. Epub 2006 Dec 29.
30.
Genetic variability in drug transport, metabolism or DNA repair affecting toxicity of chemotherapy in ovarian cancer.
Lambrechts S, etal., BMC Pharmacol Toxicol. 2015 Feb 27;16:2. doi: 10.1186/s40360-015-0001-5.
31.
Genetic polymorphisms of selected DNA repair genes, estrogen and progesterone receptor status, and breast cancer risk.
Lee KM, etal., Clin Cancer Res. 2005 Jun 15;11(12):4620-6.
32.
Expression profiles of DNA repair-related genes in rat target organs under subchronic cadmium exposure.
Lei YX, etal., Genet Mol Res. 2015 Jan 26;14(1):515-24. doi: 10.4238/2015.January.26.5.
33.
Association of DNA repair gene polymorphisms with response to chemotherapy and prognosis of gastric cancer in a Chinese population.
Li J, etal., Tumour Biol. 2014 Aug;35(8):7569-74. doi: 10.1007/s13277-014-1959-0. Epub 2014 May 4.
34.
Effects of sucrose and cornstarch on 2-amino-3-methylimidazo[4,5-f]quinoline (IQ)-induced colon and liver carcinogenesis in F344 rats.
Lindecrona RH, etal., Cancer Lett. 2004 Jun 8;209(1):17-24.
35.
Polymorphisms of multiple genes involved in NER pathway predict prognosis of gastric cancer.
Liu J, etal., Oncotarget. 2016 Jul 26;7(30):48130-48142. doi: 10.18632/oncotarget.10173.
36.
Molecular analysis of DNA repair gene methylation and protein expression during chemical-induced rat lung carcinogenesis.
Liu WB, etal., Biochem Biophys Res Commun. 2011 May 20;408(4):595-601. doi: 10.1016/j.bbrc.2011.04.067. Epub 2011 Apr 21.
37.
Laryngeal cancer risk and common single nucleotide polymorphisms in nucleotide excision repair pathway genes ERCC1, ERCC2, ERCC3, ERCC4, ERCC5 and XPA.
Lu B, etal., Gene. 2014 May 25;542(1):64-8. doi: 10.1016/j.gene.2014.02.043. Epub 2014 Feb 26.
38.
Influence of ERCC1 and ERCC4 polymorphisms on response to prognosis in gastric cancer treated with FOLFOX-based chemotherapy.
Lu ZM, etal., Tumour Biol. 2014 Apr;35(4):2941-8. doi: 10.1007/s13277-013-1378-7. Epub 2013 Dec 8.
39.
Prognostic Value of Excision Repair Cross-Complementing mRNA Expression in Gastric Cancer.
Luo SS, etal., Biomed Res Int. 2018 Oct 17;2018:6204684. doi: 10.1155/2018/6204684. eCollection 2018.
40.
Deficiency of DNA repair nuclease ERCC1-XPF promotes prostate cancer progression in a tissue recombination model.
Matoka DJ, etal., Prostate. 2012 Aug 1;72(11):1214-22. doi: 10.1002/pros.22472. Epub 2011 Dec 27.
41.
Randomized phase II study evaluating veliparib (ABT-888) with temozolomide in patients with metastatic melanoma.
Middleton MR, etal., Ann Oncol. 2015 Oct;26(10):2173-9. doi: 10.1093/annonc/mdv308. Epub 2015 Jul 22.
42.
Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
Monzo M, etal., Blood. 2006 Jun 15;107(12):4871-9. Epub 2006 Feb 28.
43.
Association of ERCC1 and ERCC2 polymorphisms with colorectal cancer risk in a Chinese population.
Ni M, etal., Sci Rep. 2014 Feb 17;4:4112. doi: 10.1038/srep04112.
44.
DNA repair by ERCC1 in non-small-cell lung cancer and cisplatin-based adjuvant chemotherapy.
Olaussen KA, etal., N Engl J Med. 2006 Sep 7;355(10):983-91.
45.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
46.
Genetic polymorphisms and haplotypes of DNA repair genes in childhood acute lymphoblastic leukemia.
Pakakasama S, etal., Pediatr Blood Cancer. 2007 Jan;48(1):16-20.
47.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
48.
ERCC1 and BRCA1 mRNA expressions are associated with clinical outcome of non-small cell lung cancer treated with platinum-based chemotherapy.
Qin X, etal., Tumour Biol. 2014 May;35(5):4697-704. doi: 10.1007/s13277-014-1615-8. Epub 2014 Jan 18.
49.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
50.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
51.
Comprehensive gene review and curation
RGD comprehensive gene curation
52.
Association between polymorphisms of ERCC1 and XPD and survival in non-small-cell lung cancer patients treated with cisplatin combination chemotherapy.
Ryu JS, etal., Lung Cancer. 2004 Jun;44(3):311-6.
53.
The multi-replication protein A (RPA) system--a new perspective.
Sakaguchi K, etal., FEBS J. 2009 Feb;276(4):943-63. doi: 10.1111/j.1742-4658.2008.06841.x. Epub 2009 Jan 12.
54.
Single nucleotide polymorphisms of nucleotide excision repair pathway are significantly associated with outcomes of platinum-based chemotherapy in lung cancer.
Song X, etal., Sci Rep. 2017 Sep 18;7(1):11785. doi: 10.1038/s41598-017-08257-7.
55.
The genotype distribution of the XRCC1, XRCC3, and XPD DNA repair genes and their role for the development of acute myeloblastic leukemia.
Sorour A, etal., Genet Test Mol Biomarkers. 2013 Mar;17(3):195-201. doi: 10.1089/gtmb.2012.0278. Epub 2013 Feb 11.
56.
Acute myeloid leukemia outcome: role of nucleotide excision repair polymorphisms in intermediate risk patients.
Strom SS, etal., Leuk Lymphoma. 2010 Apr;51(4):598-605. doi: 10.3109/10428190903582804.
57.
Involvement of ERCC1 in the pathogenesis of osteoarthritis through the modulation of apoptosis and cellular senescence.
Takayama K, etal., J Orthop Res. 2014 Oct;32(10):1326-32. doi: 10.1002/jor.22656. Epub 2014 Jun 25.
58.
ERCC1/BRCA1 expression and gene polymorphisms as prognostic and predictive factors in advanced NSCLC treated with or without cisplatin.
Tiseo M, etal., Br J Cancer. 2013 Apr 30;108(8):1695-703. doi: 10.1038/bjc.2013.127. Epub 2013 Apr 2.
59.
Polymorphisms of the NER pathway genes, ERCC1 and XPD are associated with esophageal adenocarcinoma risk.
Tse D, etal., Cancer Causes Control. 2008 Dec;19(10):1077-83. doi: 10.1007/s10552-008-9171-4. Epub 2008 May 14.
60.
ERCC1 codon 118 polymorphism is a predictive factor for the tumor response to oxaliplatin/5-fluorouracil combination chemotherapy in patients with advanced colorectal cancer.
Viguier J, etal., Clin Cancer Res. 2005 Sep 1;11(17):6212-7.
61.
Nucleotide excision repair gene expression in the rat conceptus during organogenesis.
Vinson RK and Hales BF, Mutat Res. 2001 Jul 12;486(2):113-23.
62.
Accelerated aging of intervertebral discs in a mouse model of progeria.
Vo N, etal., J Orthop Res. 2010 Dec;28(12):1600-7. doi: 10.1002/jor.21153.
63.
Effect of increased intake of dietary animal fat and fat energy on oxidative damage, mutation frequency, DNA adduct level and DNA repair in rat colon and liver.
Vogel U, etal., Free Radic Res. 2003 Sep;37(9):947-56.
64.
Genotoxic stress and activation of novel DNA repair enzymes in human endothelial cells and in the retinas and kidneys of streptozotocin diabetic rats.
Wang C, etal., Diabetes Metab Res Rev. 2012 May;28(4):329-37. doi: 10.1002/dmrr.2279.
65.
Polymorphisms in ERCC1 and susceptibility to childhood acute lymphoblastic leukemia in a Chinese population.
Wang SL, etal., Leuk Res. 2006 Nov;30(11):1341-5. Epub 2006 May 24.
66.
Role of single nucleotide polymorphisms of DNA repair genes in susceptibility to pancreatic cancer in Chinese population.
Ying MF and Zhao R, Genet Mol Res. 2016 Mar 18;15(1). doi: 10.4238/gmr.15017273.
67.
DNA repair pathway profiling and microsatellite instability in colorectal cancer.
Yu J, etal., Clin Cancer Res. 2006 Sep 1;12(17):5104-11. doi: 10.1158/1078-0432.CCR-06-0547.
68.
The polymorphisms of miRNA-binding site in MLH3 and ERCC1 were linked to the risk of colorectal cancer in a case-control study.
Zhang Q, etal., Cancer Med. 2018 Apr;7(4):1264-1274. doi: 10.1002/cam4.1319. Epub 2018 Mar 8.
69.
Genetic variability of ERCC1 and ERCC2 genes involved in the nucleotide excision repair pathway influences the treatment outcome of gastric cancer.
Zheng DL, etal., Genet Mol Res. 2016 Apr 26;15(2). doi: 10.4238/gmr.15027384.
70.
Systematic review on the association between ERCC1 rs3212986 and ERCC2 rs13181 polymorphisms and glioma risk.
Zhou CX and Zhao JH, Genet Mol Res. 2015 Mar 31;14(1):2868-75. doi: 10.4238/2015.March.31.17.
Ercc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,099,308 - 88,135,966 (+) NCBI GRCr8 mRatBN7.2 1 78,971,310 - 79,007,963 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 78,996,390 - 79,007,963 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,385,658 - 84,396,816 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 92,943,314 - 92,954,535 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,140,755 - 86,151,914 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,256,973 - 80,268,198 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,256,973 - 80,268,198 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,523,234 - 81,534,459 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 78,711,249 - 78,722,474 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 78,787,675 - 78,800,533 (+) NCBI Celera 1 73,458,746 - 73,469,951 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
ERCC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 45,407,334 - 45,451,547 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 45,407,334 - 45,478,828 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 45,910,592 - 45,954,805 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 50,604,712 - 50,619,017 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 50,608,532 - 50,618,642 NCBI Celera 19 42,716,697 - 42,733,283 (-) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 42,340,919 - 42,357,653 (-) NCBI HuRef CHM1_1 19 45,913,883 - 45,930,469 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 48,234,581 - 48,278,793 (-) NCBI T2T-CHM13v2.0
Ercc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 19,079,016 - 19,090,449 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 19,078,703 - 19,090,449 (+) Ensembl GRCm39 Ensembl GRCm38 7 19,344,067 - 19,356,524 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 19,344,778 - 19,356,524 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 19,930,420 - 19,941,873 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 18,503,628 - 18,515,044 (+) NCBI MGSCv36 mm8 Celera 7 16,751,825 - 16,763,278 (+) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 9.6 NCBI
Ercc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 2,393,278 - 2,406,582 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 2,393,510 - 2,430,180 (-) NCBI ChiLan1.0 ChiLan1.0
ERCC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 51,568,054 - 51,639,947 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 53,439,598 - 53,511,447 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 42,356,039 - 42,427,754 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 50,951,674 - 50,994,600 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 50,951,674 - 50,968,430 (-) Ensembl panpan1.1 panPan2
ERCC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 110,130,353 - 110,146,660 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 110,130,481 - 110,146,602 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 109,614,480 - 109,631,191 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 110,662,831 - 110,679,536 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 110,662,958 - 110,679,533 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 110,338,665 - 110,355,163 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 109,972,731 - 109,989,322 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 110,842,133 - 110,858,633 (+) NCBI UU_Cfam_GSD_1.0
Ercc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 17,507,594 - 17,520,240 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936706 1,852,359 - 1,867,745 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936706 1,854,938 - 1,867,521 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ERCC1
ERCC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 38,857,067 - 38,900,177 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 38,854,803 - 38,872,967 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 18,458,810 - 18,478,494 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ercc1
.
Assembly: mRatBN7.2 Assembly: RGSC_v3.4 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 61 Count of miRNA genes: 57 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000024113 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
BE120839
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 79,008,387 - 79,008,538 (+) MAPPER mRatBN7.2 Rnor_6.0 1 80,268,623 - 80,268,773 NCBI Rnor6.0 Rnor_5.0 1 81,534,884 - 81,535,034 UniSTS Rnor5.0 RGSC_v3.4 1 78,722,899 - 78,723,049 UniSTS RGSC3.4 Celera 1 73,470,376 - 73,470,526 UniSTS RH 3.4 Map 1 794.6 UniSTS Cytogenetic Map 1 q21 UniSTS
ERCC1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 79,001,770 - 79,001,871 (+) MAPPER mRatBN7.2 Rnor_6.0 1 80,262,008 - 80,262,108 NCBI Rnor6.0 Rnor_5.0 1 81,528,269 - 81,528,369 UniSTS Rnor5.0 RGSC_v3.4 1 78,716,284 - 78,716,384 UniSTS RGSC3.4 Celera 1 73,463,775 - 73,463,875 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024113 ⟹ ENSRNOP00000024113
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 78,996,531 - 79,007,960 (+) Ensembl Rnor_6.0 Ensembl 1 80,256,973 - 80,268,198 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104471 ⟹ ENSRNOP00000087227
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 78,996,390 - 79,006,013 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117664 ⟹ ENSRNOP00000090301
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 78,998,625 - 79,007,963 (+) Ensembl
RefSeq Acc Id:
NM_001106228 ⟹ NP_001099698
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,124,741 - 88,135,966 (+) NCBI mRatBN7.2 1 78,996,736 - 79,007,963 (+) NCBI Rnor_6.0 1 80,256,973 - 80,268,198 (+) NCBI Rnor_5.0 1 81,523,234 - 81,534,459 (+) NCBI RGSC_v3.4 1 78,711,249 - 78,722,474 (+) RGD Celera 1 73,458,746 - 73,469,951 (+) RGD
Sequence:
GAAGTGAGTTTAGCAGGAGGCACGCCTGCCGCGCTGGCCGTGCTGGAGGTGCTGGCGTTGTATCGCCTCTATTCCCCCTGTGGTATTTTCTTCTAGGGATCGGGAAAGAGCAGGCCCCAGATGGACCC
hide sequence
RefSeq Acc Id:
XM_006228395 ⟹ XP_006228457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,124,921 - 88,135,964 (+) NCBI mRatBN7.2 1 78,996,912 - 79,007,962 (+) NCBI Rnor_6.0 1 80,257,156 - 80,268,197 (+) NCBI Rnor_5.0 1 81,523,234 - 81,534,459 (+) NCBI
Sequence:
TTGGCAGAGAGAGAAGCCAATCATTGCGGAGGCTGAGACTAGGCCGAGACTGGGCGGGACGAAC
hide sequence
RefSeq Acc Id:
XM_006228396 ⟹ XP_006228458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,125,009 - 88,135,964 (+) NCBI mRatBN7.2 1 78,997,007 - 79,007,962 (+) NCBI Rnor_6.0 1 80,257,287 - 80,268,197 (+) NCBI Rnor_5.0 1 81,523,234 - 81,534,459 (+) NCBI
Sequence:
CAGGTAGGCGGGTCTATAAGCCCTCTAGACCAATCTGGAGTGAGCAGGAGGAAACCGGTGGGCC
hide sequence
RefSeq Acc Id:
XM_039103935 ⟹ XP_038959863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,124,143 - 88,135,964 (+) NCBI mRatBN7.2 1 78,996,095 - 79,007,962 (+) NCBI
RefSeq Acc Id:
XM_039103939 ⟹ XP_038959867
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,099,308 - 88,135,964 (+) NCBI mRatBN7.2 1 78,971,310 - 79,007,962 (+) NCBI
RefSeq Acc Id:
NP_001099698 ⟸ NM_001106228
- UniProtKB:
D3ZAQ9 (UniProtKB/TrEMBL), A6J8M3 (UniProtKB/TrEMBL), A0A8I6GI31 (UniProtKB/TrEMBL)
- Sequence:
MDPGKDEENRPQPSGPPTRKKFVIPLEEDEAPSSGAKPLFKSSRNPTPTAASTHSAPLTYAEYAIAQPPGGAGATVPTGSEPATGDSPSQTLKAGTKSSSIIVSPRQRGNPVLKFVRSVPWEFGEVTP
hide sequence
RefSeq Acc Id:
XP_006228457 ⟸ XM_006228395
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAQ9 (UniProtKB/TrEMBL), A6J8M3 (UniProtKB/TrEMBL), A0A8I6GI31 (UniProtKB/TrEMBL)
- Sequence:
MDPGKDEENRPQPSGPPTRKKFVIPLEEDEAPSSGAKPLFKSSRNPTPTAASTHSAPLTYAEYA
hide sequence
RefSeq Acc Id:
XP_006228458 ⟸ XM_006228396
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAQ9 (UniProtKB/TrEMBL), A6J8M3 (UniProtKB/TrEMBL), A0A8I6GI31 (UniProtKB/TrEMBL)
- Sequence:
MDPGKDEENRPQPSGPPTRKKFVIPLEEDEAPSSGAKPLFKSSRNPTPTAASTHSAPLTYAEYAIAQPPGGAGATVPTGSEPATGDSPSQTLKAGTKSSSIIVSPRQRGNPVLKFVRSVPWEFGEVTP
hide sequence
Ensembl Acc Id:
ENSRNOP00000024113 ⟸ ENSRNOT00000024113
RefSeq Acc Id:
XP_038959867 ⟸ XM_039103939
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAQ9 (UniProtKB/TrEMBL), A6J8M3 (UniProtKB/TrEMBL), A0A8I6GI31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959863 ⟸ XM_039103935
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAQ9 (UniProtKB/TrEMBL), A6J8M3 (UniProtKB/TrEMBL), A0A8I6GI31 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000087227 ⟸ ENSRNOT00000104471
Ensembl Acc Id:
ENSRNOP00000090301 ⟸ ENSRNOT00000117664
RGD ID: 13689768 Promoter ID: EPDNEW_R292 Type: initiation region Name: Ercc1_1 Description: ERCC excision repair 1, endonuclease non-catalytic subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 80,256,990 - 80,257,050 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Ercc1
ERCC excision repair 1, endonuclease non-catalytic subunit
Ercc1
excision repair cross-complementation group 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-02-02
Ercc1
excision repair cross-complementation group 1
Ercc1
excision repair cross-complementing rodent repair deficiency, complementation group 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ercc1
excision repair cross-complementing rodent repair deficiency, complementation group 1
Ercc1_predicted
excision repair cross-complementing rodent repair deficiency, complementation group 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ercc1_predicted
excision repair cross-complementing rodent repair deficiency, complementation group 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
