Advanced Search (OLGA)

Gene: Gapdh (glyceraldehyde-3-phosphate dehydrogenase) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Gapdh

Name:

glyceraldehyde-3-phosphate dehydrogenase

RGD ID:

8733110

Description:

ENCODES a protein that exhibits aspartic-type endopeptidase inhibitor activity (ortholog); disordered domain specific binding (ortholog); enzyme binding (ortholog); INVOLVED IN antimicrobial humoral immune response mediated by antimicrobial peptide (ortholog); cAMP/PKA signal transduction (ortholog); canonical glycolysis (ortholog); PARTICIPATES IN electron transport chain pathway; Fanconi syndrome pathway; fructose-1,6-bisphosphatase deficiency pathway; ASSOCIATED WITH Acute Coronary Syndrome (ortholog); Alzheimer's disease (ortholog); Animal Disease Models (ortholog); FOUND IN cytoplasm (ortholog); cytosol (ortholog); GAIT complex (ortholog)

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	4,162,467 - 4,166,783 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	4,162,467 - 4,166,783 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	Alzheimer's disease	susceptibility	ISO	GAPDH (Homo sapiens)	9068941	DNA:SNP:5' utr:rs3741916 (human)	RGD	PMID:20864222 and REF_RGD_ID:13792611
Gapdh	Chinchilla	Alzheimer's disease		ISO	GAPDH (Homo sapiens)	9068941	protein:increased S-glutathionylation and decreased activity:inferior parietal cortex	RGD	PMID:17387692 and REF_RGD_ID:13792613
Gapdh	Chinchilla	Alzheimer's disease		ISO	Gapdh (Mus musculus)	9068941	protein:decreased activity:cerebral cortex and cerebellum	RGD	PMID:17324518 and REF_RGD_ID:13792614
Gapdh	Chinchilla	Alzheimer's disease	onset	ISO	GAPDH (Homo sapiens)	9068941	DNA:snps:5' utr more ...	RGD	PMID:15507493 and REF_RGD_ID:1358618
Gapdh	Chinchilla	Alzheimer's disease		ISO	GAPDH (Homo sapiens)	9068941		RGD	PMID:28087189 and REF_RGD_ID:13792604
Gapdh	Chinchilla	Alzheimer's disease		ISO	GAPDH (Homo sapiens)	9068941	DNA:SNPs more ...	RGD	PMID:18340469 and REF_RGD_ID:13792612
Gapdh	Chinchilla	Alzheimer's disease		ISO	Gapdh (Rattus norvegicus)	9068941	protein:decreased activity:cerebral cortex and hippocampus	RGD	PMID:17324518 and REF_RGD_ID:13792614
Gapdh	Chinchilla	brain glioma		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:26032618 and REF_RGD_ID:13792685
Gapdh	Chinchilla	COVID-19		ISO	GAPDH (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744
Gapdh	Chinchilla	diabetic retinopathy		ISO	Gapdh (Rattus norvegicus)	9068941	associated with Diabetes Mellitus and Experimental	RGD	PMID:18852331 and REF_RGD_ID:2315975
Gapdh	Chinchilla	epilepsy		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:30143487 and REF_RGD_ID:13792618
Gapdh	Chinchilla	Experimental Diabetes Mellitus	treatment	ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27655796 and REF_RGD_ID:13792671
Gapdh	Chinchilla	Huntington's disease		ISO	Gapdh (Mus musculus)	9068941		RGD	PMID:26268247 and REF_RGD_ID:13792684
Gapdh	Chinchilla	lymphangioleiomyomatosis		ISO	GAPDH (Homo sapiens)	9068941	protein:increased expression:lung (human)	RGD	PMID:29885404 and REF_RGD_ID:152995523
Gapdh	Chinchilla	middle cerebral artery infarction		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:25882840 and REF_RGD_ID:13792686
Gapdh	Chinchilla	Myocardial Reperfusion Injury	treatment	ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27129213 and REF_RGD_ID:11574725
Gapdh	Chinchilla	obesity	treatment	ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27987997 and REF_RGD_ID:13792668
Gapdh	Chinchilla	oral squamous cell carcinoma		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27375172 and REF_RGD_ID:13792673
Gapdh	Chinchilla	Pregnancy in Diabetics		ISO	Gapdh (Rattus norvegicus)	9068941	associated with Diabetes Mellitus more ...	RGD	PMID:12716756 and REF_RGD_ID:2315979
Gapdh	Chinchilla	rheumatic heart disease		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:26823728 and REF_RGD_ID:13792679
Gapdh	Chinchilla	Spinal Cord Injuries	treatment	ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27256506 and REF_RGD_ID:13792677
Gapdh	Chinchilla	Spinal Cord Reperfusion Injury	treatment	ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:30195603 and REF_RGD_ID:13792615
Gapdh	Chinchilla	type 2 diabetes mellitus		ISO	Gapdh (Mus musculus)	9068941	protein:decreased acetylation	RGD	PMID:28258188 and REF_RGD_ID:13792662
Gapdh	Chinchilla	Viral Bronchiolitis	severity	ISO	GAPDH (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:26541527 and REF_RGD_ID:40902860

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	Hyperphosphatemic Familial Tumoral Calcinosis 1		ISO	GAPDH (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tumoral calcinosis more ...	ClinVar	PMID:25378588 and PMID:29389098
Gapdh	Chinchilla	lymphoproliferative syndrome 2		ISO	GAPDH (Homo sapiens)	8554872	ClinVar Annotator: match by term: Lymphoproliferative syndrome 2	ClinVar	PMID:28492532
Gapdh	Chinchilla	peroxisome biogenesis disorder 2B		ISO	GAPDH (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peroxisome biogenesis disorder 2B	ClinVar	PMID:28492532
Gapdh	Chinchilla	primary autosomal recessive microcephaly 21		ISO	GAPDH (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly 21 more ...	ClinVar	PMID:25741868
Gapdh	Chinchilla	Temtamy syndrome		ISO	GAPDH (Homo sapiens)	8554872	ClinVar Annotator: match by term: Temtamy syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	Acute Coronary Syndrome		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21751358
Gapdh	Chinchilla	Animal Disease Models		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Gapdh	Chinchilla	Colorectal Neoplasms		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:25944804
Gapdh	Chinchilla	Esophageal Neoplasms		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:15986332
Gapdh	Chinchilla	hepatocellular carcinoma		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:16767786 and PMID:21472284
Gapdh	Chinchilla	Hypoxia		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:19579223
Gapdh	Chinchilla	lung adenocarcinoma		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Gapdh	Chinchilla	Mouth Neoplasms		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:15274141
Gapdh	Chinchilla	Necrosis		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: therapeutic	CTD	PMID:25725130
Gapdh	Chinchilla	osteoarthritis		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18784066
Gapdh	Chinchilla	osteoporosis		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18924182
Gapdh	Chinchilla	Parkinsonism		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:29886133
Gapdh	Chinchilla	squamous cell carcinoma		ISO	GAPDH (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:15274141

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	antimicrobial humoral immune response mediated by antimicrobial peptide	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:22832495	UniProt	PMID:22832495
Gapdh	Chinchilla	cAMP/PKA signal transduction		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:28258188 and REF_RGD_ID:13792662
Gapdh	Chinchilla	canonical glycolysis	involved_in	ISO	Gapdh (Mus musculus)	9068941	PMID:10777777 and PMID:28918937	MGI	PMID:10777777 and PMID:28918937
Gapdh	Chinchilla	canonical glycolysis	involved_in	ISO	Gapdh (Mus musculus)	9068941	PMID:12581789	MGI	PMID:12581789
Gapdh	Chinchilla	cellular response to type II interferon	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:15479637	UniProt	PMID:15479637
Gapdh	Chinchilla	female pregnancy		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:27312951 and REF_RGD_ID:13792674
Gapdh	Chinchilla	gluconeogenesis		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:15720133 more ...
Gapdh	Chinchilla	gluconeogenesis	involved_in	ISO	Gapdh (Mus musculus)	9068941	PMID:28258188	MGI	PMID:28258188
Gapdh	Chinchilla	glycolytic process		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:28258188 and REF_RGD_ID:13792662
Gapdh	Chinchilla	microtubule cytoskeleton organization	involved_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15312048	UniProt	PMID:15312048 and REF_RGD_ID:8553423
Gapdh	Chinchilla	negative regulation of endopeptidase activity	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:22832495	UniProt	PMID:22832495
Gapdh	Chinchilla	negative regulation of translation	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:23071094	UniProt	PMID:23071094
Gapdh	Chinchilla	negative regulation of translation	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:15479637	UniProt	PMID:15479637
Gapdh	Chinchilla	negative regulation of translation	involved_in	ISO	Gapdh (Mus musculus)	9068941	PMID:23071094	UniProt	PMID:23071094
Gapdh	Chinchilla	negative regulation of vascular associated smooth muscle cell apoptotic process		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:28404743 and REF_RGD_ID:13792653
Gapdh	Chinchilla	neuron apoptotic process	involved_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	nitric oxide mediated signal transduction	involved_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:19607794	UniProt	PMID:19607794 and REF_RGD_ID:8553565
Gapdh	Chinchilla	peptidyl-cysteine S-trans-nitrosylation	involved_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381
Gapdh	Chinchilla	positive regulation of canonical NF-kappaB signal transduction	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:23332158	UniProt	PMID:23332158
Gapdh	Chinchilla	positive regulation of cytokine production	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:22832495	UniProt	PMID:22832495
Gapdh	Chinchilla	positive regulation of type I interferon production	involved_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:27387501	UniProt	PMID:27387501
Gapdh	Chinchilla	protein stabilization	involved_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	response to ethanol		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:12700235 and REF_RGD_ID:12801493

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	cytoplasm	located_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:11785981 and PMID:24507776	CAFA	PMID:11785981 and PMID:24507776
Gapdh	Chinchilla	cytoplasm	located_in	ISO	Gapdh (Mus musculus)	9068941	PMID:15159393 more ...	MGI	PMID:15159393 more ...
Gapdh	Chinchilla	cytoplasm	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15312048	UniProt	PMID:15312048 and REF_RGD_ID:8553423
Gapdh	Chinchilla	cytosol	is_active_in	ISO	Gapdh (Mus musculus)	9068941	PMID:21347706 more ...	MGI	PMID:21347706 more ...
Gapdh	Chinchilla	cytosol	located_in	ISO	Gapdh (Mus musculus)	9068941	PMID:21413931 more ...	MGI	PMID:21413931 more ...
Gapdh	Chinchilla	cytosol	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	cytosol	located_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:24101517	MGI	GO_REF:0000052 and PMID:24101517
Gapdh	Chinchilla	cytosol	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:19607794	UniProt	PMID:19607794 and REF_RGD_ID:8553565
Gapdh	Chinchilla	cytosol	part_of	ISO	GAPDH (Homo sapiens)	9068941	PMID:28404743	CACAO	PMID:28404743
Gapdh	Chinchilla	GAIT complex	part_of	ISO	GAPDH (Homo sapiens)	9068941	PMID:15479637 and PMID:23071094	UniProt	PMID:15479637 and PMID:23071094
Gapdh	Chinchilla	GAIT complex	part_of	ISO	Gapdh (Mus musculus)	9068941	PMID:23071094	MGI	PMID:23071094
Gapdh	Chinchilla	glutamatergic synapse	is_active_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:9371836	SynGO	PMID:9371836 and REF_RGD_ID:13702148
Gapdh	Chinchilla	intracellular membrane-bounded organelle	located_in	ISO	GAPDH (Homo sapiens)	9068941		HPA	GO_REF:0000052
Gapdh	Chinchilla	lipid droplet	located_in	ISO	GAPDH (Homo sapiens)	9068941	PMID:14741744	UniProt	PMID:14741744
Gapdh	Chinchilla	microtubule cytoskeleton	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15312048	UniProt	PMID:15312048 and REF_RGD_ID:8553423
Gapdh	Chinchilla	nuclear membrane	located_in	ISO	GAPDH (Homo sapiens)	9068941		HPA	GO_REF:0000052
Gapdh	Chinchilla	nucleus	part_of	ISO	GAPDH (Homo sapiens)	9068941	PMID:28404743	CACAO	PMID:28404743
Gapdh	Chinchilla	nucleus	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381
Gapdh	Chinchilla	nucleus	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:19607794	UniProt	PMID:19607794 and REF_RGD_ID:8553565
Gapdh	Chinchilla	nucleus	located_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	plasma membrane	located_in	ISO	GAPDH (Homo sapiens)	9068941		HPA	GO_REF:0000052
Gapdh	Chinchilla	plasma membrane	located_in	ISO	Gapdh (Mus musculus)	9068941	PMID:18698006	MGI	PMID:18698006
Gapdh	Chinchilla	postsynaptic density, intracellular component	is_active_in	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:9371836	SynGO	PMID:9371836 and REF_RGD_ID:13702148
Gapdh	Chinchilla	ribonucleoprotein complex	part_of	ISO	GAPDH (Homo sapiens)	9068941	PMID:15479637	UniProt	PMID:15479637

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	aspartic-type endopeptidase inhibitor activity	enables	ISO	GAPDH (Homo sapiens)	9068941	PMID:22832495	UniProt	PMID:22832495
Gapdh	Chinchilla	disordered domain specific binding	enables	ISO	UniProtKB:P21758	9068941	PMID:11785981	CAFA	PMID:11785981
Gapdh	Chinchilla	enzyme binding	enables	ISO	UniProtKB:Q8VCN5	9068941	PMID:19903941	UniProt	PMID:19903941
Gapdh	Chinchilla	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	enables	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	enables	ISO	Gapdh (Mus musculus)	9068941	PMID:15665293	MGI	PMID:15665293
Gapdh	Chinchilla	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	enables	ISO	MGI:2183515	9068941	PMID:3796661	MGI	PMID:3796661
Gapdh	Chinchilla	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	enables	ISO	Gapdh (Mus musculus)	9068941	PMID:176725 more ...	UniProt	PMID:176725 more ...
Gapdh	Chinchilla	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:15720133 and REF_RGD_ID:2302795
Gapdh	Chinchilla	identical protein binding		ISO	Gapdh (Rattus norvegicus)	9068941	homodimerization and homotetramerization	RGD	PMID:27129213 and REF_RGD_ID:11574725
Gapdh	Chinchilla	identical protein binding	enables	ISO	UniProtKB:P04406	9068941	PMID:20392205 and PMID:21988832	IntAct	PMID:20392205 and PMID:21988832
Gapdh	Chinchilla	microtubule binding	enables	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:15312048	UniProt	PMID:15312048 and REF_RGD_ID:8553423
Gapdh	Chinchilla	peptidyl-cysteine S-nitrosylase activity	enables	ISO	Gapdh (Rattus norvegicus)	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P70288	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P42695	9068941	PMID:29028794	IntAct	PMID:29028794
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P42858	9068941	PMID:17500595	IntAct	PMID:17500595
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P21754 more ...	9068941	PMID:23355646	CAFA	PMID:23355646
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P05109 and UniProtKB:P35228	9068941	PMID:25417112	IntAct	PMID:25417112
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:O00471 more ...	9068941	PMID:32814053	IntAct	PMID:32814053
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P41743	9068941	PMID:11724794	UniProt	PMID:11724794
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P15927	9068941	PMID:16169070	IntAct	PMID:16169070
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P00533	9068941	PMID:16799092 more ...	IntAct	PMID:16799092 more ...
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P61023	9068941	PMID:15312048	IntAct	PMID:15312048 and REF_RGD_ID:8553423
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9BSI4	9068941	PMID:21044950	IntAct	PMID:21044950
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:D3ZUQ0	9068941	PMID:19607794	UniProt	PMID:19607794 and REF_RGD_ID:8553565
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:O95292	9068941	PMID:17540579	UniProt	PMID:17540579
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P23819	9068941	PMID:27461448	IntAct	PMID:27461448
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P47196	9068941	PMID:20488185	IntAct	PMID:20488185 and REF_RGD_ID:8554327
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q920M9	9068941	PMID:15951807	UniProt	PMID:15951807 and REF_RGD_ID:8554488
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P19357	9068941	PMID:16396496	IntAct	PMID:16396496 and REF_RGD_ID:8553682
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q920M9	9068941	PMID:19607794	UniProt	PMID:19607794 and REF_RGD_ID:8553565
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P97313	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q80Z30	9068941	PMID:15680915	IntAct	PMID:15680915 and REF_RGD_ID:8553307
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:O14556	9068941	PMID:28514442 and PMID:33961781	IntAct	PMID:28514442 and PMID:33961781
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P00441	9068941	PMID:29128334	IntAct	PMID:29128334
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P12004	9068941	PMID:20849852	IntAct	PMID:20849852
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P23381	9068941	PMID:15628863	UniProt	PMID:15628863
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q12933	9068941	PMID:23332158	UniProt	PMID:23332158
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q13114	9068941	PMID:27387501	UniProt	PMID:27387501
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q08460	9068941	PMID:19423573	IntAct	PMID:19423573
Gapdh	Chinchilla	protein binding		ISO	Gnat1 (Rattus norvegicus)	9068941		RGD	PMID:18028335 and REF_RGD_ID:2302128
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P48147	9068941	PMID:23348613	IntAct	PMID:23348613
Gapdh	Chinchilla	protein binding		ISO	Slc4a1 (Rattus norvegicus)	9068941		RGD	PMID:20980406 and REF_RGD_ID:10450535
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:P00558	9068941	PMID:20392205	IntAct	PMID:20392205
Gapdh	Chinchilla	protein binding	enables	ISO	UniProtKB:Q923E4	9068941	PMID:20972425	UniProt	PMID:20972425 and REF_RGD_ID:8554381

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	gluconeogenesis pathway		ISO	Gapdh (Rattus norvegicus)	9068941		RGD	PMID:15720133 and REF_RGD_ID:2302795

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gapdh	Chinchilla	electron transport chain pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00355
Gapdh	Chinchilla	Fanconi syndrome pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00572
Gapdh	Chinchilla	fructose-1,6-bisphosphatase deficiency pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00562
Gapdh	Chinchilla	gluconeogenesis pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00128
Gapdh	Chinchilla	glycogen storage disease type Ia pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00374 and SMP:00581
Gapdh	Chinchilla	glycogen storage disease type Ib pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00573
Gapdh	Chinchilla	glycogen storage disease type VII pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00531
Gapdh	Chinchilla	glycolysis pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00040
Gapdh	Chinchilla	nicotinamide adenine dinucleotide metabolic pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00124
Gapdh	Chinchilla	phosphoenolpyruvate carboxykinase deficiency pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00560
Gapdh	Chinchilla	triosephosphate isomerase deficiency pathway		ISO	GAPDH (Homo sapiens)	9068941		SMPDB	SMP:00563

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

PMID:22301074	PMID:30032202

Gapdh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	4,162,467 - 4,166,783 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	4,162,467 - 4,166,783 (+)	NCBI	ChiLan1.0	ChiLan1.0

GAPDH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	6,534,517 - 6,538,371 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	6,534,512 - 6,538,374 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	6,643,683 - 6,647,537 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	6,513,918 - 6,517,797 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	6,513,944 - 6,517,797	NCBI
Celera	12	8,260,518 - 8,264,397 (+)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	6,497,829 - 6,501,781 (+)	NCBI		HuRef
CHM1_1	12	6,642,592 - 6,646,544 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	6,544,873 - 6,548,727 (+)	NCBI		T2T-CHM13v2.0

Gapdh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	125,138,812 - 125,143,450 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	125,138,678 - 125,143,430 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	125,161,852 - 125,166,467 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	125,161,715 - 125,166,467 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	125,111,870 - 125,115,601 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	125,128,554 - 125,131,222 (-)	NCBI		MGSCv36	mm8
Celera	6	126,831,711 - 126,835,442 (-)	NCBI		Celera
Cytogenetic Map	6	F2	NCBI
cM Map	6	59.32	NCBI

Gapdh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,648,592 - 159,653,436 (-)	NCBI		GRCr8
mRatBN7.2	4	157,962,312 - 157,967,158 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,962,343 - 157,966,235 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	4	157,676,336 - 157,680,322 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	224,693,580 - 224,697,455 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	161,282,215 - 161,286,090 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	146,699,388 - 146,703,263 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

GAPDH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	12,096,075 - 12,100,140 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	12,092,832 - 12,096,897 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	6,665,218 - 6,669,170 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	6,583,895 - 6,587,729 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	6,583,895 - 6,587,729 (+)	Ensembl	panpan1.1		panPan2

LOC100688969
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	51,925,654 - 51,926,724 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	42,758,798 - 42,759,848 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	52,892,500 - 52,893,549 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	X	50,867,280 - 50,868,330 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	52,198,694 - 52,199,710 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	52,119,573 - 52,120,589 (+)	NCBI		UU_Cfam_GSD_1.0

Gapdh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	102,575,598 - 102,580,238 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936709	1,243,147 - 1,247,903 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936709	1,243,149 - 1,247,782 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GAPDH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	64,129,679 - 64,133,991 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	64,129,678 - 64,135,194 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	66,446,302 - 66,449,510 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	5	q12-q21	NCBI

GAPDH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	6,569,029 - 6,572,877 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666063	1,653,527 - 1,657,405 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gapdh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	3,257,853 - 3,261,735 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624860	3,257,805 - 3,261,736 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005378778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01013601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDI01257956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000020311 ⟹ ENSCLAP00000020116

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955413	4,162,467 - 4,166,783 (+)	Ensembl

Ensembl Acc Id:

ENSCLAT00000020312 ⟹ ENSCLAP00000020117

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955413	4,164,950 - 4,165,259 (+)	Ensembl

RefSeq Acc Id:

XM_005378778 ⟹ XP_005378835

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955413	4,162,467 - 4,166,783 (+)	NCBI

Sequence:

show sequence

GCCCTACCGCTATAAAGGGAGGCTGCAGCCTGCGCCGGCGCTCTCTGCTCCTGCGTGCCCGCCGGTAGCCGTTCTTTTCTATCTGCGCCAGGTGGAGAAGCAGCGCCAGCCGCGATCCAGACACGATG
GTGAAGGTCGGAGTGAACGGATTTGGCCGTATTGGACGCCTGGTCACCAGGGCTGCTTTTAACTCTGGCAAAGTGGATGTTGTGGCCATCAATGACCCCTTCATTGACCTCAACTACATGGTCTACAT
GTTCCAGTATGATTCCACCCACGGCAAGTTCCATGGCACCGTCAAGGCTGAGCACGGGAAGCTTGTCATCAACGGCAAGGCCATCACCATCTTCCAAGAGCGAGATCCCGCCAACATCAAGTGGGGTG
ATGCTGGCGCTGAATACGTGGTGGAGTCCACTGGTGTCTTTACCACCATGGAGAAGGCCGGGGCTCACTTGAAGGGTGGTGCCAAGAGGGTCATCATCTCTGCCCCTTCTGCCGATGCCCCCATGTTT
GTGATGGGTGTGAATCATGAGAAATATGACAACTCCCTCAAGATTGTCAGCAATGCTTCCTGCACCACCAACTGCTTAGCTCCGCTGGCCAAGGTCATCCATGACAACTTTGGCATCGTGGAGGGACT
CATGACCACAGTCCACGCCATCACTGCCACCCAGAAGACTGTGGACGGCCCCTCTGGGAAGCTGTGGCGTGACGGCCGTGGGGCTGCCCAGAACATCATCCCCGCGTCCACTGGCGCTGCTAAGGCTG
TGGGCAAGGTCATCCCGGAGCTGAACGGGAAACTCACGGGCATGGCCTTCCGCGTGCCCACTCCCAACGTGTCAGTGGTGGATCTGACCTGCCGCCTGGAGAAAGCGGCCAAATACGATGACATCAAG
AAGGTGGTAAAGCAGGCATCAGAAGGCCCCCTCAAAGGCATCCTGGGCTACACTGAGGACCAGGTTGTCTCCTGTGACTTCAACAGTGACACCCACTCTTCTACCTTTGACGCTGGGGCTGGCATTGC
CCTCAATGACCACTTTGTCAAGCTGATTTCCTGGTATGACAATGAGTTCGGCTACAGCAACAGGGTGGTGGACCTCATGGTCCACATGGCCTCCAAGGAGTAAGCGGCCCCCCACCACAGCCCAGCGA
GACCAGAGGGAGAGGCCTTGCTGTAGAAGTCACTGCCCCACTCAGCCCCAACACTGAGAATCTCCCCTCACAGCTTCCATCCCAGGCCCCCTGGAGAAGGGGCGGGGCCTAGGGAGCCCTGGCTCATT
GCACACCACCAATAAAGCCCACTGAACCCA

hide sequence


Protein RefSeqs	XP_005378835	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000020116
	ENSCLAP00000020116.1
	ENSCLAP00000020117.1

RefSeq Acc Id:

XP_005378835 ⟸ XM_005378778

- UniProtKB:

A0A8C2VT31 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAEHGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPM
FVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDI
KKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE

hide sequence

Ensembl Acc Id:

ENSCLAP00000020117 ⟸ ENSCLAT00000020312

Ensembl Acc Id:

ENSCLAP00000020116 ⟸ ENSCLAT00000020311

Protein Domains

Glyceraldehyde 3-phosphate dehydrogenase NAD(P)

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000013783	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000020311	ENTREZGENE
	ENSCLAT00000020311.1	UniProtKB/TrEMBL
	ENSCLAT00000020312.1	UniProtKB/TrEMBL
Gene3D-CATH	Dihydrodipicolinate Reductase, domain 2	UniProtKB/TrEMBL
	NAD(P)-binding Rossmann-like Domain	UniProtKB/TrEMBL
InterPro	GlycerAld/Erythrose_P_DH	UniProtKB/TrEMBL
	GlycerAld_3-P_DH_AS	UniProtKB/TrEMBL
	GlycerAld_3-P_DH_cat	UniProtKB/TrEMBL
	GlycerAld_3-P_DH_NAD(P)-bd	UniProtKB/TrEMBL
	Glyceraldehyde-3-P_DH_1	UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/TrEMBL
NCBI Gene	Gapdh	ENTREZGENE
PANTHER	GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE	UniProtKB/TrEMBL
	PTHR10836	UniProtKB/TrEMBL
Pfam	Gp_dh_C	UniProtKB/TrEMBL
	Gp_dh_N	UniProtKB/TrEMBL
PIRSF	GAP_DH	UniProtKB/TrEMBL
PRINTS	G3PDHDRGNASE	UniProtKB/TrEMBL
PROSITE	GAPDH	UniProtKB/TrEMBL
SMART	Gp_dh_N	UniProtKB/TrEMBL
Superfamily-SCOP	Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain	UniProtKB/TrEMBL
	SSF51735	UniProtKB/TrEMBL
UniProt	A0A8C2VT31	ENTREZGENE, UniProtKB/TrEMBL
	A0A8C2YSJ0_CHILA	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB