Symbol:
Kdm3a
Name:
lysine demethylase 3A
RGD ID:
708351
Description:
Predicted to enable several functions, including histone H3K9me/H3K9me2 demethylase activity; iron ion binding activity; and nuclear androgen receptor binding activity. Involved in male gonad development; positive regulation of gene expression; and response to hypoxia. Predicted to be located in cytoplasm; male germ cell nucleus; and nucleoplasm. Predicted to be part of histone deacetylase complex. Predicted to be active in chromatin. Human ortholog(s) of this gene implicated in cervical cancer and colon cancer. Orthologous to human KDM3A (lysine demethylase 3A); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
[histone H3]-dimethyl-L-lysine(9) demethylase 3A; jmjC domain-containing histone demethylation protein 2A; Jmjd1; Jmjd1a; jumonji domain containing 1; jumonji domain containing 1A; jumonji domain-containing protein 1A; LOC312440; lysine (K)-specific demethylase 3A; lysine-specific demethylase 3A; probable zinc finger protein; testis-specific gene A protein; zinc finger protein TSGA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KDM3A (lysine demethylase 3A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Kdm3a (lysine (K)-specific demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kdm3a (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KDM3A (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KDM3A (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kdm3a (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KDM3A (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KDM3A (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kdm3a (lysine demethylase 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Kdm3a (lysine (K)-specific demethylase 3A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KDM3A (lysine demethylase 3A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
JHDM2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kdm3a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Candidate Gene For:
Eae35
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 105,189,208 - 105,233,526 (-) NCBI GRCr8 mRatBN7.2 4 103,630,907 - 103,675,073 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 103,630,908 - 103,675,073 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 109,015,136 - 109,059,356 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 104,790,259 - 104,834,479 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 103,400,828 - 103,444,990 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 99,503,160 - 99,547,315 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 99,503,176 - 99,546,905 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 164,282,422 - 164,326,579 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 104,866,501 - 104,911,355 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 105,110,981 - 105,155,233 (-) NCBI Celera 4 92,789,151 - 92,833,037 (-) NCBI Celera Cytogenetic Map 4 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdm3a Rat 1,2-dimethylhydrazine decreases expression ISO Kdm3a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KDM3A mRNA CTD PMID:22206623 Kdm3a Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO KDM3A (Homo sapiens) 6480464 Metribolone promotes the reaction [KDM3A protein binds to KLK3 enhancer] and Metribolone promotes the reaction [KDM3A protein binds to NKX3-1 enhancer] CTD PMID:16603237 Kdm3a Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO KDM3A (Homo sapiens) 6480464 Metribolone results in increased expression of KDM3A protein CTD PMID:16603237 Kdm3a Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO Kdm3a (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Kdm3a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kdm3a (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of KDM3A mRNA CTD PMID:25975270 Kdm3a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KDM3A mRNA CTD PMID:33387578 Kdm3a Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Kdm3a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KDM3A mRNA CTD PMID:26251327 Kdm3a Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of KDM3A mRNA CTD PMID:19162173 Kdm3a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KDM3A mRNA CTD PMID:25825206 Kdm3a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KDM3A mRNA CTD PMID:30047161 Kdm3a Rat acrolein multiple interactions ISO KDM3A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of KDM3A mRNA CTD PMID:32845096 Kdm3a Rat adefovir pivoxil decreases expression ISO KDM3A (Homo sapiens) 6480464 adefovir dipivoxil results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat aflatoxin B1 increases expression ISO Kdm3a (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of KDM3A mRNA CTD PMID:19770486 Kdm3a Rat aflatoxin B1 decreases methylation ISO KDM3A (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of KDM3A gene CTD PMID:27153756 Kdm3a Rat all-trans-retinoic acid increases expression ISO KDM3A (Homo sapiens) 6480464 Tretinoin results in increased expression of KDM3A mRNA CTD PMID:33167477 Kdm3a Rat allethrin decreases expression EXP 6480464 Allethrins results in decreased expression of KDM3A mRNA CTD PMID:28181402 Kdm3a Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of KDM3A protein CTD PMID:34896426 Kdm3a Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KDM3A mRNA CTD PMID:30047161 Kdm3a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KDM3A mRNA CTD PMID:16483693 Kdm3a Rat antimycin A decreases expression ISO KDM3A (Homo sapiens) 6480464 Antimycin A results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat apigenin increases expression ISO Kdm3a (Mus musculus) 6480464 Apigenin results in increased expression of KDM3A mRNA CTD PMID:22359648 Kdm3a Rat aristolochic acid A decreases expression ISO KDM3A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KDM3A mRNA CTD PMID:33212167 Kdm3a Rat arsenite(3-) multiple interactions ISO KDM3A (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to KDM3A mRNA] CTD PMID:32406909 Kdm3a Rat arsenous acid increases expression ISO KDM3A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KDM3A mRNA CTD PMID:20458559 Kdm3a Rat azoxystrobin decreases expression ISO KDM3A (Homo sapiens) 6480464 azoxystrobin results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat benzo[a]pyrene increases expression ISO Kdm3a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KDM3A mRNA CTD PMID:22228805 Kdm3a Rat benzo[a]pyrene diol epoxide I decreases expression ISO KDM3A (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Kdm3a Rat benzo[a]pyrene diol epoxide I increases expression ISO KDM3A (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Kdm3a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KDM3A mRNA CTD PMID:25181051 Kdm3a Rat bisphenol A affects expression ISO KDM3A (Homo sapiens) 6480464 bisphenol A affects the expression of KDM3A mRNA CTD PMID:30903817 Kdm3a Rat butanal decreases expression ISO KDM3A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of KDM3A mRNA CTD PMID:26079696 Kdm3a Rat cadmium dichloride decreases expression ISO KDM3A (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat caffeine decreases phosphorylation ISO KDM3A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of KDM3A protein CTD PMID:35688186 Kdm3a Rat carbamazepine affects expression ISO KDM3A (Homo sapiens) 6480464 Carbamazepine affects the expression of KDM3A mRNA CTD PMID:25979313 Kdm3a Rat carbon nanotube decreases expression ISO Kdm3a (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kdm3a Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of KDM3A mRNA CTD PMID:19395590 Kdm3a Rat chloroacetaldehyde decreases expression ISO KDM3A (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat cidofovir anhydrous decreases expression ISO KDM3A (Homo sapiens) 6480464 Cidofovir results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat cisplatin decreases expression ISO KDM3A (Homo sapiens) 6480464 Cisplatin results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat cisplatin multiple interactions ISO KDM3A (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KDM3A mRNA CTD PMID:27392435 Kdm3a Rat clodronic acid decreases expression ISO KDM3A (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat cobalt dichloride multiple interactions ISO KDM3A (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of KDM3A mRNA] CTD PMID:22202117 Kdm3a Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of KDM3A mRNA CTD PMID:24386269 Kdm3a Rat cobalt dichloride increases expression ISO KDM3A (Homo sapiens) 6480464 cobaltous chloride results in increased expression of KDM3A mRNA and cobaltous chloride results in increased expression of KDM3A protein CTD PMID:19320972 more ... Kdm3a Rat cocaine increases expression ISO Kdm3a (Mus musculus) 6480464 Cocaine results in increased expression of KDM3A mRNA CTD PMID:18355967 Kdm3a Rat cocaine multiple interactions ISO Kdm3a (Mus musculus) 6480464 FOS protein mutant form inhibits the reaction [Cocaine results in increased expression of KDM3A mRNA] CTD PMID:18355967 Kdm3a Rat copper atom multiple interactions ISO KDM3A (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of KDM3A mRNA CTD PMID:20971185 Kdm3a Rat copper(0) multiple interactions ISO KDM3A (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of KDM3A mRNA CTD PMID:20971185 Kdm3a Rat copper(II) chloride increases expression ISO KDM3A (Homo sapiens) 6480464 cupric chloride results in increased expression of KDM3A mRNA CTD PMID:17211630 Kdm3a Rat copper(II) sulfate increases expression ISO KDM3A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KDM3A mRNA CTD PMID:19549813 Kdm3a Rat coumestrol decreases expression ISO KDM3A (Homo sapiens) 6480464 Coumestrol results in decreased expression of KDM3A mRNA CTD PMID:19167446 Kdm3a Rat crocidolite asbestos decreases expression ISO Kdm3a (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of KDM3A mRNA CTD PMID:29279043 Kdm3a Rat cyclosporin A increases expression ISO KDM3A (Homo sapiens) 6480464 Cyclosporine results in increased expression of KDM3A mRNA CTD PMID:20106945 Kdm3a Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of KDM3A protein CTD PMID:34896426 Kdm3a Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of KDM3A protein CTD PMID:34896426 Kdm3a Rat desferrioxamine B increases expression ISO KDM3A (Homo sapiens) 6480464 Deferoxamine results in increased expression of KDM3A protein CTD PMID:23546878 Kdm3a Rat diarsenic trioxide increases expression ISO KDM3A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KDM3A mRNA CTD PMID:20458559 Kdm3a Rat diazinon increases methylation ISO KDM3A (Homo sapiens) 6480464 Diazinon results in increased methylation of KDM3A gene CTD PMID:22964155 Kdm3a Rat Dibutyl phosphate affects expression ISO KDM3A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KDM3A mRNA CTD PMID:37042841 Kdm3a Rat dicrotophos decreases expression ISO KDM3A (Homo sapiens) 6480464 dicrotophos results in decreased expression of KDM3A mRNA CTD PMID:28302478 Kdm3a Rat dioxygen multiple interactions ISO KDM3A (Homo sapiens) 6480464 Oxygen deficiency promotes the reaction [HIF3A protein binds to KDM3A promoter] and Oxygen deficiency promotes the reaction [KDM3A protein binds to SPRY2 promoter] CTD PMID:20881000 and PMID:34826399 Kdm3a Rat dioxygen increases expression ISO KDM3A (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of KDM3A mRNA and Oxygen deficiency results in increased expression of KDM3A protein CTD PMID:20042640 more ... Kdm3a Rat dioxygen increases expression ISO Kdm3a (Mus musculus) 6480464 Oxygen deficiency results in increased expression of KDM3A mRNA and Oxygen deficiency results in increased expression of KDM3A protein CTD PMID:20880076 and PMID:20881000 Kdm3a Rat doxorubicin decreases expression ISO KDM3A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KDM3A mRNA CTD PMID:29803840 Kdm3a Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of KDM3A mRNA CTD PMID:17920746 Kdm3a Rat ethanol multiple interactions ISO KDM3A (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of KDM3A mRNA CTD PMID:23378141 Kdm3a Rat fenpyroximate decreases expression ISO KDM3A (Homo sapiens) 6480464 fenpyroximate results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of KDM3A protein CTD PMID:34896426 Kdm3a Rat folic acid multiple interactions ISO KDM3A (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of KDM3A mRNA CTD PMID:23378141 Kdm3a Rat folpet increases expression ISO Kdm3a (Mus musculus) 6480464 folpet results in increased expression of KDM3A mRNA CTD PMID:31558096 Kdm3a Rat FR900359 affects phosphorylation ISO KDM3A (Homo sapiens) 6480464 FR900359 affects the phosphorylation of KDM3A protein CTD PMID:37730182 Kdm3a Rat gallic acid increases expression ISO KDM3A (Homo sapiens) 6480464 Gallic Acid results in increased expression of KDM3A mRNA CTD PMID:34408198 Kdm3a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KDM3A mRNA CTD PMID:22061828 and PMID:33387578 Kdm3a Rat GSK-J4 increases expression ISO KDM3A (Homo sapiens) 6480464 GSK-J4 results in increased expression of KDM3A mRNA CTD PMID:29301935 Kdm3a Rat hydrogen peroxide affects expression ISO KDM3A (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of KDM3A mRNA CTD PMID:23410634 Kdm3a Rat ifosfamide decreases expression ISO KDM3A (Homo sapiens) 6480464 Ifosfamide results in decreased expression of KDM3A mRNA CTD PMID:25596134 Kdm3a Rat iron atom multiple interactions ISO KDM3A (Homo sapiens) 6480464 [[Iron co-treated with Ketoglutaric Acids] results in increased activity of KDM3A protein] which results in decreased methylation of H3-4 protein CTD PMID:16603237 Kdm3a Rat iron(0) multiple interactions ISO KDM3A (Homo sapiens) 6480464 [[Iron co-treated with Ketoglutaric Acids] results in increased activity of KDM3A protein] which results in decreased methylation of H3-4 protein CTD PMID:16603237 Kdm3a Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of KDM3A mRNA CTD PMID:36653537 Kdm3a Rat L-ascorbic acid multiple interactions ISO KDM3A (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [nickel chloride results in increased expression of KDM3A mRNA] and Ascorbic Acid inhibits the reaction [nickel chloride results in increased expression of KDM3A protein] CTD PMID:22318714 Kdm3a Rat lead diacetate decreases expression ISO KDM3A (Homo sapiens) 6480464 lead acetate results in decreased expression of KDM3A mRNA CTD PMID:38568856 Kdm3a Rat leflunomide increases expression ISO KDM3A (Homo sapiens) 6480464 leflunomide results in increased expression of KDM3A mRNA CTD PMID:28988120 Kdm3a Rat menadione affects expression ISO KDM3A (Homo sapiens) 6480464 Vitamin K 3 affects the expression of KDM3A mRNA CTD PMID:23410634 Kdm3a Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of KDM3A mRNA CTD PMID:30047161 Kdm3a Rat motexafin gadolinium increases expression ISO KDM3A (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of KDM3A mRNA CTD PMID:16357179 Kdm3a Rat N-methyl-4-phenylpyridinium decreases expression ISO Kdm3a (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of KDM3A mRNA CTD PMID:17475336 Kdm3a Rat nickel atom multiple interactions ISO KDM3A (Homo sapiens) 6480464 HIF1A mRNA affects the reaction [Nickel results in increased expression of KDM3A mRNA] more ... CTD PMID:20881000 Kdm3a Rat nickel atom increases expression ISO Kdm3a (Mus musculus) 6480464 Nickel results in increased expression of KDM3A protein CTD PMID:20881000 Kdm3a Rat nickel atom increases expression ISO KDM3A (Homo sapiens) 6480464 Nickel results in increased expression of KDM3A mRNA and Nickel results in increased expression of KDM3A protein CTD PMID:20881000 Kdm3a Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of KDM3A mRNA CTD PMID:22110744 Kdm3a Rat nickel dichloride increases expression ISO KDM3A (Homo sapiens) 6480464 nickel chloride results in increased expression of KDM3A mRNA and nickel chloride results in increased expression of KDM3A protein CTD PMID:17312168 more ... Kdm3a Rat nickel dichloride multiple interactions ISO KDM3A (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [nickel chloride results in increased expression of KDM3A mRNA] and Ascorbic Acid inhibits the reaction [nickel chloride results in increased expression of KDM3A protein] CTD PMID:22318714 Kdm3a Rat nickel sulfate increases expression ISO KDM3A (Homo sapiens) 6480464 nickel sulfate results in increased expression of KDM3A protein CTD PMID:23546878 Kdm3a Rat nitric oxide increases expression ISO KDM3A (Homo sapiens) 6480464 Nitric Oxide results in increased expression of KDM3A mRNA and Nitric Oxide results in increased expression of KDM3A protein CTD PMID:23546878 Kdm3a Rat ozone multiple interactions ISO KDM3A (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of KDM3A mRNA and [Air Pollutants results in increased abundance of Ozone] which affects the expression of KDM3A mRNA CTD PMID:32845096 and PMID:35430440 Kdm3a Rat paracetamol affects expression ISO Kdm3a (Mus musculus) 6480464 Acetaminophen affects the expression of KDM3A mRNA CTD PMID:17562736 Kdm3a Rat paracetamol multiple interactions ISO Kdm3a (Mus musculus) 6480464 MAP3K5 protein affects the reaction [Acetaminophen results in increased expression of KDM3A mRNA] CTD PMID:18700144 Kdm3a Rat phenobarbital affects expression ISO KDM3A (Homo sapiens) 6480464 Phenobarbital affects the expression of KDM3A mRNA CTD PMID:19159669 Kdm3a Rat phenobarbital affects expression ISO Kdm3a (Mus musculus) 6480464 Phenobarbital affects the expression of KDM3A mRNA CTD PMID:23091169 Kdm3a Rat picoxystrobin decreases expression ISO KDM3A (Homo sapiens) 6480464 picoxystrobin results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of KDM3A mRNA CTD PMID:30047161 Kdm3a Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of KDM3A protein CTD PMID:34896426 Kdm3a Rat pyrimidifen decreases expression ISO KDM3A (Homo sapiens) 6480464 pyrimidifen results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat quercetin decreases expression ISO KDM3A (Homo sapiens) 6480464 Quercetin results in decreased expression of KDM3A mRNA CTD PMID:21632981 Kdm3a Rat quercitrin increases expression ISO KDM3A (Homo sapiens) 6480464 quercitrin results in increased expression of KDM3A mRNA CTD PMID:25193878 Kdm3a Rat rotenone decreases expression ISO KDM3A (Homo sapiens) 6480464 Rotenone results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat sodium arsenite decreases expression ISO KDM3A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KDM3A mRNA CTD PMID:28595984 Kdm3a Rat sodium arsenite increases expression ISO KDM3A (Homo sapiens) 6480464 sodium arsenite results in increased expression of KDM3A mRNA and sodium arsenite results in increased expression of KDM3A protein CTD PMID:30528433 and PMID:38568856 Kdm3a Rat sodium arsenite affects expression ISO KDM3A (Homo sapiens) 6480464 sodium arsenite affects the expression of KDM3A mRNA CTD PMID:34032870 Kdm3a Rat sodium arsenite decreases expression ISO Kdm3a (Mus musculus) 6480464 sodium arsenite results in decreased expression of KDM3A mRNA CTD PMID:28414027 Kdm3a Rat sodium dichromate increases expression ISO KDM3A (Homo sapiens) 6480464 sodium bichromate results in increased expression of KDM3A mRNA CTD PMID:17685462 Kdm3a Rat sodium fluoride increases expression ISO Kdm3a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of KDM3A protein CTD PMID:28918527 Kdm3a Rat sunitinib increases expression ISO KDM3A (Homo sapiens) 6480464 Sunitinib results in increased expression of KDM3A mRNA CTD PMID:31533062 Kdm3a Rat tanespimycin multiple interactions ISO KDM3A (Homo sapiens) 6480464 [tanespimycin co-treated with VER 155008] results in decreased expression of KDM3A protein CTD PMID:31370342 Kdm3a Rat tebufenpyrad decreases expression ISO KDM3A (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of KDM3A mRNA CTD PMID:33512557 Kdm3a Rat tert-butyl hydroperoxide affects expression ISO KDM3A (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of KDM3A mRNA CTD PMID:23410634 Kdm3a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KDM3A mRNA CTD PMID:34492290 Kdm3a Rat titanium dioxide decreases methylation ISO Kdm3a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KDM3A gene and titanium dioxide results in decreased methylation of KDM3A promoter CTD PMID:35295148 Kdm3a Rat troglitazone decreases expression ISO Kdm3a (Mus musculus) 6480464 troglitazone results in decreased expression of KDM3A mRNA CTD PMID:28973697 Kdm3a Rat urethane increases expression ISO KDM3A (Homo sapiens) 6480464 Urethane results in increased expression of KDM3A mRNA CTD PMID:28818685 Kdm3a Rat valproic acid affects expression ISO KDM3A (Homo sapiens) 6480464 Valproic Acid affects the expression of KDM3A mRNA CTD PMID:25979313 Kdm3a Rat valproic acid increases expression ISO KDM3A (Homo sapiens) 6480464 Valproic Acid results in increased expression of KDM3A mRNA CTD PMID:37505509 Kdm3a Rat valproic acid decreases expression ISO KDM3A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of KDM3A mRNA CTD PMID:23179753 and PMID:27188386 Kdm3a Rat vandetanib increases expression ISO KDM3A (Homo sapiens) 6480464 vandetanib results in increased expression of KDM3A mRNA CTD PMID:16052530 Kdm3a Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of KDM3A mRNA CTD PMID:23034163 Kdm3a Rat zinc acetate increases expression ISO KDM3A (Homo sapiens) 6480464 Zinc Acetate results in increased expression of KDM3A mRNA CTD PMID:16357179 Kdm3a Rat zinc dichloride multiple interactions ISO KDM3A (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of KDM3A mRNA] CTD PMID:22202117 Kdm3a Rat zoledronic acid increases expression ISO KDM3A (Homo sapiens) 6480464 zoledronic acid results in increased expression of KDM3A mRNA CTD PMID:25596134
1,2-dimethylhydrazine (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 6-propyl-2-thiouracil (EXP) acrolein (ISO) adefovir pivoxil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) apigenin (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) chloroacetaldehyde (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (EXP,ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) desferrioxamine B (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) doxorubicin (ISO) ethanol (EXP,ISO) fenpyroximate (ISO) fenvalerate (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) gallic acid (ISO) gentamycin (EXP) GSK-J4 (ISO) hydrogen peroxide (ISO) ifosfamide (ISO) iron atom (ISO) iron(0) (ISO) ketoconazole (EXP) L-ascorbic acid (ISO) lead diacetate (ISO) leflunomide (ISO) menadione (ISO) methimazole (EXP) motexafin gadolinium (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) nickel dichloride (EXP,ISO) nickel sulfate (ISO) nitric oxide (ISO) ozone (ISO) paracetamol (ISO) phenobarbital (ISO) picoxystrobin (ISO) propiconazole (EXP) pyrethrins (EXP) pyrimidifen (ISO) quercetin (ISO) quercitrin (ISO) rotenone (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sodium fluoride (ISO) sunitinib (ISO) tanespimycin (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) thioacetamide (EXP) titanium dioxide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vandetanib (ISO) vinclozolin (EXP) zinc acetate (ISO) zinc dichloride (ISO) zoledronic acid (ISO)
Biological Process
androgen receptor signaling pathway (IEA,ISO) cell differentiation (IEA) cellular response to leukemia inhibitory factor (IEA,ISO) chromatin organization (IEA) chromatin remodeling (IEA) demethylation (IEA) formaldehyde biosynthetic process (IEA,ISO) hormone-mediated signaling pathway (IEA,ISO) male gonad development (IEP) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of gene expression (IMP) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of stem cell differentiation (IEA,ISO) regulation of stem cell population maintenance (IEA,ISO) regulation of transcription by RNA polymerase II (IBA) response to hypoxia (IEP) spermatid nucleus elongation (IEA,ISO) spermatogenesis (IEA,ISO)
1.
Systematic knockdown of epigenetic enzymes identifies a novel histone demethylase PHF8 overexpressed in prostate cancer with an impact on cell proliferation, migration and invasion.
Bjorkman M, etal., Oncogene. 2012 Jul 19;31(29):3444-56. doi: 10.1038/onc.2011.512. Epub 2011 Nov 28.
2.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
3.
Upregulation of MiR-155 in nasopharyngeal carcinoma is partly driven by LMP1 and LMP2A and downregulates a negative prognostic marker JMJD1A.
Du ZM, etal., PLoS One. 2011 Apr 26;6(4):e19137. doi: 10.1371/journal.pone.0019137.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Analysis of a murine male germ cell-specific transcript that encodes a putative zinc finger protein.
Hoog C, etal., Mol Reprod Dev 1991 Nov;30(3):173-81.
6.
Regulation of the histone demethylase JMJD1A by hypoxia-inducible factor 1 alpha enhances hypoxic gene expression and tumor growth.
Krieg AJ, etal., Mol Cell Biol. 2010 Jan;30(1):344-53. doi: 10.1128/MCB.00444-09. Epub .
7.
Histone demethylase JHDM2A is involved in male infertility and obesity.
Okada Y, etal., J Androl. 2010 Jan-Feb;31(1):75-8. doi: 10.2164/jandrol.109.008052. Epub 2009 Oct 29.
8.
Inhibition of histone demethylase JMJD1A improves anti-angiogenic therapy and reduces tumor-associated macrophages.
Osawa T, etal., Cancer Res. 2013 May 15;73(10):3019-28. doi: 10.1158/0008-5472.CAN-12-3231. Epub 2013 Mar 14.
9.
The histone demethylase KDM3A is a microRNA-22-regulated tumor promoter in Ewing Sarcoma.
Parrish JK, etal., Oncogene. 2013 Dec 23. doi: 10.1038/onc.2013.541.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
14.
Genetic alterations and changes in expression of histone demethylases in prostate cancer.
Suikki HE, etal., Prostate. 2010 Jun 1;70(8):889-98. doi: 10.1002/pros.21123.
15.
Role of Jhdm2a in regulating metabolic gene expression and obesity resistance.
Tateishi K, etal., Nature. 2009 Apr 9;458(7239):757-61. doi: 10.1038/nature07777. Epub 2009 Feb 4.
16.
Hypoxia upregulates the histone demethylase JMJD1A via HIF-1.
Wellmann S, etal., Biochem Biophys Res Commun. 2008 Aug 8;372(4):892-7. doi: 10.1016/j.bbrc.2008.05.150. Epub 2008 Jun 4.
17.
Role of the hypoxia-related gene, JMJD1A, in hepatocellular carcinoma: clinical impact on recurrence after hepatic resection.
Yamada D, etal., Ann Surg Oncol. 2012 Jul;19 Suppl 3:S355-64. doi: 10.1245/s10434-011-1797-x. Epub 2011 May 24.
Kdm3a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 105,189,208 - 105,233,526 (-) NCBI GRCr8 mRatBN7.2 4 103,630,907 - 103,675,073 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 103,630,908 - 103,675,073 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 109,015,136 - 109,059,356 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 104,790,259 - 104,834,479 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 103,400,828 - 103,444,990 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 99,503,160 - 99,547,315 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 99,503,176 - 99,546,905 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 164,282,422 - 164,326,579 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 104,866,501 - 104,911,355 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 105,110,981 - 105,155,233 (-) NCBI Celera 4 92,789,151 - 92,833,037 (-) NCBI Celera Cytogenetic Map 4 q32 NCBI
KDM3A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 86,437,044 - 86,492,716 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 86,440,647 - 86,492,716 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 86,668,494 - 86,719,839 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 86,521,865 - 86,573,350 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 86,580,100 - 86,631,497 NCBI Celera 2 86,496,309 - 86,547,889 (+) NCBI Celera Cytogenetic Map 2 p11.2 NCBI HuRef 2 86,565,835 - 86,617,601 (+) NCBI HuRef CHM1_1 2 86,598,317 - 86,649,908 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 86,439,057 - 86,494,729 (+) NCBI T2T-CHM13v2.0
Kdm3a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 71,565,954 - 71,609,963 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 71,565,956 - 71,609,974 (-) Ensembl GRCm39 Ensembl GRCm38 6 71,588,970 - 71,632,990 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 71,588,972 - 71,632,990 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 71,538,966 - 71,582,899 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 71,518,550 - 71,562,078 (-) NCBI MGSCv36 mm8 Celera 6 73,672,792 - 73,716,729 (-) NCBI Celera Cytogenetic Map 6 C1 NCBI cM Map 6 32.18 NCBI
Kdm3a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 1,171,827 - 1,218,607 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 1,164,384 - 1,218,607 (-) NCBI ChiLan1.0 ChiLan1.0
KDM3A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 39,887,164 - 39,938,601 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 39,889,925 - 39,941,362 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 86,497,531 - 86,548,772 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 88,043,712 - 88,094,244 (+) NCBI panpan1.1 PanPan1.1 panPan2
KDM3A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 38,690,962 - 38,744,507 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 38,690,979 - 38,743,739 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 38,374,227 - 38,430,299 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 39,421,459 - 39,477,555 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 39,423,705 - 39,477,460 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 38,587,497 - 38,643,573 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 38,623,889 - 38,679,943 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 38,971,898 - 39,027,987 (-) NCBI UU_Cfam_GSD_1.0
Kdm3a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 79,760,595 - 79,805,238 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936712 1,053,210 - 1,096,961 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936712 1,053,210 - 1,097,845 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KDM3A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 58,302,949 - 58,354,945 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 58,300,109 - 58,355,000 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 61,060,319 - 61,116,654 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KDM3A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 20,668,215 - 20,721,854 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 20,668,821 - 20,720,759 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 91,765,741 - 91,830,044 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdm3a
.
Predicted Target Of
Count of predictions: 100 Count of miRNA genes: 75 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000045279 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 2317588 Eae27 Experimental allergic encephalomyelitis QTL 27 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 103194805 112478794 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 8662350 Eae35 Experimental allergic encephalomyelitis QTL 35 6.2 blood tumor necrosis factor amount (VT:0008552) inflammatory exudate tumor necrosis factor level (CMO:0001435) 4 100834579 103761084 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat
AU046560
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 105,193,597 - 105,193,749 (+) Marker Load Pipeline mRatBN7.2 4 103,635,296 - 103,635,448 (+) MAPPER mRatBN7.2 Rnor_6.0 4 99,507,550 - 99,507,701 NCBI Rnor6.0 Rnor_5.0 4 164,286,812 - 164,286,963 UniSTS Rnor5.0 RGSC_v3.4 4 104,870,875 - 104,871,026 UniSTS RGSC3.4 Celera 4 92,793,525 - 92,793,676 UniSTS Cytogenetic Map 4 q33 UniSTS
RH141531
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 103,638,292 - 103,638,501 (+) MAPPER mRatBN7.2 Rnor_6.0 4 99,510,546 - 99,510,754 NCBI Rnor6.0 Rnor_5.0 4 164,289,808 - 164,290,016 UniSTS Rnor5.0 RGSC_v3.4 4 104,873,871 - 104,874,079 UniSTS RGSC3.4 Celera 4 92,796,521 - 92,796,729 UniSTS RH 3.4 Map 4 631.6 UniSTS Cytogenetic Map 4 q33 UniSTS
AU049619
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 105,193,552 - 105,193,822 (+) Marker Load Pipeline mRatBN7.2 4 103,635,251 - 103,635,521 (+) MAPPER mRatBN7.2 Rnor_6.0 4 99,507,505 - 99,507,774 NCBI Rnor6.0 Rnor_5.0 4 164,286,767 - 164,287,036 UniSTS Rnor5.0 RGSC_v3.4 4 104,870,830 - 104,871,099 UniSTS RGSC3.4 Celera 4 92,793,480 - 92,793,749 UniSTS Cytogenetic Map 4 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045279 ⟹ ENSRNOP00000041218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 103,630,908 - 103,675,073 (-) Ensembl Rnor_6.0 Ensembl 4 99,503,176 - 99,546,488 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077447 ⟹ ENSRNOP00000072073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 103,631,485 - 103,666,274 (-) Ensembl Rnor_6.0 Ensembl 4 99,503,640 - 99,546,905 (-) Ensembl
RefSeq Acc Id:
NM_001389240 ⟹ NP_001376169
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 105,189,208 - 105,233,370 (-) NCBI mRatBN7.2 4 103,630,907 - 103,675,073 (-) NCBI
RefSeq Acc Id:
NM_175764 ⟹ NP_786940
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 105,189,219 - 105,233,111 (-) NCBI mRatBN7.2 4 103,630,918 - 103,674,814 (-) NCBI Rnor_6.0 4 99,503,176 - 99,547,063 (-) NCBI Rnor_5.0 4 164,282,422 - 164,326,579 (-) NCBI RGSC_v3.4 4 104,866,501 - 104,911,355 (-) RGD Celera 4 92,789,151 - 92,833,037 (-) RGD
Sequence:
ATGGGGGCGGCCGAGGTCGGAGGCGGCCCGAAAAGACGAAGCGCCGACGGGGACCGGTGGAGTGACACCCCCGCAGGTGGCCCTGGCTGTCCGGGACCATTCGAGCTGTTTCTCACACTGACGTTACC
hide sequence
RefSeq Acc Id:
XM_006236637 ⟹ XP_006236699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 105,189,219 - 105,233,526 (-) NCBI mRatBN7.2 4 103,630,907 - 103,675,062 (-) NCBI Rnor_6.0 4 99,503,171 - 99,547,277 (-) NCBI Rnor_5.0 4 164,282,422 - 164,326,579 (-) NCBI
Sequence:
TGTGCGTGTCTTGTGTGAGAGAGCTCTTGAACCAAGTCAGAGCTAGAGTCGGCTGGGCGGCTGG
hide sequence
RefSeq Acc Id:
XM_039107568 ⟹ XP_038963496
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 105,189,219 - 105,220,382 (-) NCBI mRatBN7.2 4 103,630,907 - 103,662,089 (-) NCBI
RefSeq Acc Id:
NP_786940 ⟸ NM_175764
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2K220 (UniProtKB/TrEMBL)
- Sequence:
MYKSLLDKAGLGSITSVRFLGDQQSVFVSKDLLKPIQDVNSLRLSLTDNQTVSKEFQALIVKHLDESHLLQGDKNLVGSEVRIYSLDPSTQWFSATVVHGNPSSKTLQVNCEEIPALKIVDPALIHVE
hide sequence
RefSeq Acc Id:
XP_006236699 ⟸ XM_006236637
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K220 (UniProtKB/TrEMBL), D3ZLJ9 (UniProtKB/TrEMBL), A6IA85 (UniProtKB/TrEMBL)
- Sequence:
MVLTLGESWPVLVGKRFLSLSAAEGSDGGHDNWDLERVAEWPWLSGTIRAVSHTDVTKKDLKVC
hide sequence
Ensembl Acc Id:
ENSRNOP00000041218 ⟸ ENSRNOT00000045279
Ensembl Acc Id:
ENSRNOP00000072073 ⟸ ENSRNOT00000077447
RefSeq Acc Id:
NP_001376169 ⟸ NM_001389240
- Peptide Label:
isoform 1
- UniProtKB:
D3ZLJ9 (UniProtKB/TrEMBL), A6IA85 (UniProtKB/TrEMBL), A0A0G2K220 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963496 ⟸ XM_039107568
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K220 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Kdm3a
lysine demethylase 3A
Kdm3a
lysine (K)-specific demethylase 3A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-05-06
Kdm3a
lysine (K)-specific demethylase 3A
Jmjd1a
jumonji domain containing 1A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Jmjd1a
jumonji domain containing 1A
Jmjd1
jumonji domain containing 1
Symbol and Name updated
1299863 APPROVED
2004-02-11
Jmjd1
jumonji domain containing 1
LOC312440
probable zinc finger protein
Symbol and Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
Note Type
Note
Reference
gene_expression
expressed exclusively in male germ cells
1299385
