Orm1 (orosomucoid 1) - Rat Genome Database

Name: Orm1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Orm1 (orosomucoid 1) Rattus norvegicus

Analyze

Symbol:

Orm1

Name:

orosomucoid 1

RGD ID:

67390

Description:

Enables small molecule binding activity. Involved in several processes, including cellular response to hormone stimulus; cellular response to retinoic acid; and inflammatory response to antigenic stimulus. Located in extracellular space. Orthologous to several human genes including ORM1 (orosomucoid 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

AAG; AGP; Agpa1; alpha-1-acid glycoprotein; OMD; Orm; orosomucoid

RGD Orthologs

Human

Mouse

Chinchilla

Pig

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ORM1 (orosomucoid 1)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Orm1 (orosomucoid 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Orm1 (orosomucoid 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ORM1 (orosomucoid 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103218970 (alpha-1-acid glycoprotein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ORM2 (orosomucoid 2)	HGNC	EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Homo sapiens (human):	ORM2 (orosomucoid 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Orm1 (orosomucoid 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ORM1 (orosomucoid 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Orm3 (orosomucoid 3)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Orm2 (orosomucoid 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	76,766,637 - 76,776,149 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	76,772,941 - 76,776,154 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	79,172,063 - 79,175,233 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	80,989,208 - 80,992,378 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	80,964,702 - 80,967,872 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	79,179,668 - 79,182,820 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	79,179,417 - 79,182,820 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	83,293,902 - 83,297,054 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	80,325,042 - 80,328,194 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	80,330,154 - 80,333,307 (+)	NCBI
Celera	5	75,706,909 - 75,710,061 (+)	NCBI		Celera
RH 3.4 Map	5	578.8	RGD
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

Drug Hypersensitivity Syndrome (ISO)

Experimental Arthritis (IEP)

Liver Failure (ISO)

Stevens-Johnson syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(2E,4E)-hexa-2,4-dienoic acid (ISO)

(R,R,R)-alpha-tocopherol (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,7-dihydropurine-6-thione (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitro-1,2-phenylenediamine (ISO)

7,12-dimethyltetraphene (ISO)

8-anilinonaphthalene-1-sulfonic acid (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

atrazine (ISO)

azathioprine (EXP)

Benoxacor (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bexarotene (EXP)

biphenyl-2-ol (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (EXP,ISO)

carmustine (EXP)

CGP 52608 (ISO)

chlorpromazine (ISO)

cholic acid (ISO)

choline (ISO)

cisplatin (EXP,ISO)

clofibrate (ISO)

cobalt atom (ISO)

copper(II) sulfate (ISO)

corticosterone (EXP)

cycloheximide (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

DAUDA (ISO)

DDE (ISO)

dehydroepiandrosterone (EXP)

dexamethasone (EXP,ISO)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

diclofenac (EXP,ISO)

dimethyl sulfoxide (EXP)

dipyridamole (ISO)

dorsomorphin (ISO)

doxorubicin (EXP)

elemental selenium (EXP)

endosulfan (EXP)

epoxiconazole (ISO)

erythrosin B (ISO)

flavonoids (EXP)

furan (EXP)

glafenine (EXP)

graphite (EXP)

hexachlorobenzene (EXP)

indometacin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

leflunomide (ISO)

lidocaine (ISO)

lipopolysaccharide (EXP,ISO)

lithocholic acid (ISO)

mercaptopurine (EXP)

methotrexate (EXP)

methoxychlor (EXP)

Mezerein (ISO)

naphthalene (ISO)

nimesulide (EXP)

nitrofen (EXP)

nitrofurantoin (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

oleanolic acid (EXP)

oxycodone (EXP)

ozone (ISO)

palytoxin (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraoxon (EXP)

parathion (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (EXP,ISO)

phenylmercury acetate (ISO)

PhIP (ISO)

phorone (EXP)

piperonyl butoxide (ISO)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

propionic acid (ISO)

propranolol (EXP)

prostaglandin E2 (EXP)

purine-6-thiol (EXP)

quartz (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

rosuvastatin calcium (ISO)

rotenone (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

saccharin (ISO)

SB 431542 (ISO)

selenium atom (EXP)

senecionine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

streptozocin (EXP)

styrene oxide (ISO)

sulforaphane (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tin(II) chloride (anhydrous) (ISO)

tioguanine (EXP)

titanium dioxide (EXP,ISO)

tremolite asbestos (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

troglitazone (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (EXP)

vitamin K (EXP)

warfarin (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acute inflammatory response to antigenic stimulus (IEP)

acute-phase response (IEA)

animal organ regeneration (IEP)

cellular response to glucocorticoid stimulus (IEP)

cellular response to growth hormone stimulus (IEP)

cellular response to retinoic acid (IEP)

chronic inflammatory response to antigenic stimulus (IEP)

negative regulation of interleukin-6 production (ISO)

negative regulation of tumor necrosis factor production (ISO)

positive regulation of interleukin-1 beta production (ISO)

positive regulation of interleukin-1 production (ISO)

positive regulation of tumor necrosis factor production (ISO)

regulation of immune system process (IEA)

response to lipopolysaccharide (IEP)

response to organic cyclic compound (IEP)

response to vitamin E (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

extracellular space (IBA,IDA,IEA,ISO)

Molecular Function

amine binding (IDA)

protein binding (ISO)

small molecule binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Alpha-1-acid glycoprotein concentrations and protein binding of propranolol in Sprague-Dawley and Dark Agouti rat strains treated by phenobarbital.	Chauvelot-Moachon L, etal., J Pharmacol Exp Ther. 1988 Mar;244(3):1103-8.
2.	Effect of selenium and vitamin E deficiency on differential gene expression in rat liver.	Fischer A, etal., Biochem Biophys Res Commun. 2001 Jul 13;285(2):470-5.
3.	Inducible expression and regulation of the alpha 1-acid glycoprotein gene by alveolar macrophages: prostaglandin E2 and cyclic AMP act as new positive stimuli.	Fournier T, etal., J Immunol. 1999 Sep 1;163(5):2883-90.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Hepatic pharmacokinetics of propranolol in rats with adjuvant-induced systemic inflammation.	Hung DY, etal., Am J Physiol Gastrointest Liver Physiol. 2006 Feb;290(2):G343-51. Epub 2005 Sep 15.
6.	Liver gene regulation in rats following both 70 or 90% hepatectomy and endotoxin treatment.	Jensen SA J Gastroenterol Hepatol. 2001 May;16(5):525-30.
7.	Effects of 3-methylcholanthrene on gene expression profiling in the rat using cDNA microarray analyses.	Kondraganti SR, etal., Chem Res Toxicol. 2005 Nov;18(11):1634-41.
8.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.	NF-kappaB is involved in the induction of the rat hepatic alpha1-acid glycoprotein gene by phenobarbital.	Mejdoubi N, etal., Biochem Biophys Res Commun. 1999 Jan 8;254(1):93-9.
10.	Growth hormone inhibits rat liver alpha-1-acid glycoprotein gene expression in vivo and in vitro.	Mejdoubi N, etal., Hepatology. 1999 Jan;29(1):186-94.
11.	Retinoids increase alpha-1 acid glycoprotein expression at the transcriptional level through two distinct DR1 retinoic acid responsive elements.	Mouthiers A, etal., Biochim Biophys Acta. 2004 May 25;1678(2-3):135-44.
12.	Selective downregulation of hepatic cytochrome P450 expression and activity in a rat model of inflammatory pain.	Projean D, etal., Pharm Res. 2005 Jan;22(1):62-70.
13.	An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.	Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Nucleotide sequence of rat alpha 1-acid glycoprotein messenger RNA.	Ricca GA and Taylor JM, J Biol Chem 1981 Nov 10;256(21):11199-202.
18.	Kinetics of induction of alpha 1-acid glycoprotein.	Ricca GA, etal., Ann N Y Acad Sci 1982;389:88-105.
19.	Rat alpha 1-acid glycoprotein mRNA. Cloning of double-stranded cDNA and kinetics of induction of mRNA levels following acute inflammation.	Ricca GA, etal., J Biol Chem 1981 Oct 25;256(20):10362-8.
20.	FK506 (tacrolimus) increases rat alpha1-acid glycoprotein expression in liver and primary cultured hepatocytes.	Shimoishi K, etal., Eur J Pharmacol. 2001 May 25;420(2-3):91-5.
21.	Messenger RNA profiles in liver injury and stress: a comparison of lethal and nonlethal rat models.	Tygstrup N, etal., Biochem Biophys Res Commun 2002 Jan 11;290(1):518-25.

Additional References at PubMed

PMID:2943986	PMID:3838547	PMID:8774350	PMID:15502707	PMID:16502470	PMID:17234708	PMID:21669904	PMID:22516433	PMID:22916107	PMID:23376485	PMID:23533145	PMID:23973664
PMID:26740279	PMID:27068509	PMID:27559042	PMID:30707086	PMID:33134382

Genomics

Comparative Map Data

Orm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	76,766,637 - 76,776,149 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	76,772,941 - 76,776,154 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	79,172,063 - 79,175,233 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	80,989,208 - 80,992,378 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	80,964,702 - 80,967,872 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	79,179,668 - 79,182,820 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	79,179,417 - 79,182,820 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	83,293,902 - 83,297,054 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	80,325,042 - 80,328,194 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	80,330,154 - 80,333,307 (+)	NCBI
Celera	5	75,706,909 - 75,710,061 (+)	NCBI		Celera
RH 3.4 Map	5	578.8	RGD
Cytogenetic Map	5	q24	NCBI

ORM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	114,323,098 - 114,326,479 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	114,323,098 - 114,326,479 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	117,085,378 - 117,088,759 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	116,125,157 - 116,128,578 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	114,164,889 - 114,168,311	NCBI
Celera	9	87,732,978 - 87,736,434 (+)	NCBI		Celera
Cytogenetic Map	9	q32	NCBI
HuRef	9	86,691,053 - 86,694,374 (+)	NCBI		HuRef
CHM1_1	9	117,232,023 - 117,235,479 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	126,522,292 - 126,525,673 (+)	NCBI		T2T-CHM13v2.0

Orm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	63,262,793 - 63,266,400 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	63,262,797 - 63,266,400 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	63,344,556 - 63,348,163 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	63,344,560 - 63,348,163 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	63,005,600 - 63,009,196 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	62,830,927 - 62,834,523 (+)	NCBI		MGSCv36	mm8
Celera	4	62,001,528 - 62,005,125 (+)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	33.96	NCBI

Orm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955419	13,262,119 - 13,264,986 (-)	NCBI	ChiLan1.0	ChiLan1.0

ORM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	254,939,154 - 254,943,065 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	286,190,518 - 286,194,344 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	1	q210-q212	NCBI

LOC103218970
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	25,257,002 - 25,261,255 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	25,256,969 - 25,260,446 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	17,564,284 - 17,568,317 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Orm1
33 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	78
Count of miRNA genes:	71
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000010454
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1598845	Mcs14	Mammary carcinoma susceptibility QTL 14		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	76369776	80813390	Rat

Markers in Region

D5Arb8

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	76,775,487 - 76,775,749 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	79,182,160 - 79,182,421	NCBI	Rnor6.0
Rnor_5.0	5	83,296,394 - 83,296,655	UniSTS	Rnor5.0
RGSC_v3.4	5	80,327,533 - 80,327,795	RGD	RGSC3.4
RGSC_v3.4	5	80,327,534 - 80,327,795	UniSTS	RGSC3.4
RGSC_v3.1	5	80,332,646 - 80,332,908	RGD
Celera	5	75,709,401 - 75,709,662	UniSTS
Cytogenetic Map	5	q24	UniSTS

RH94673

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	76,776,202 - 76,776,374 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	79,182,875 - 79,183,046	NCBI	Rnor6.0
Rnor_5.0	5	83,297,109 - 83,297,280	UniSTS	Rnor5.0
RGSC_v3.4	5	80,328,249 - 80,328,420	UniSTS	RGSC3.4
Celera	5	75,710,116 - 75,710,287	UniSTS
RH 3.4 Map	5	578.8	UniSTS
Cytogenetic Map	5	q24	UniSTS

RH94674

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	76,772,592 - 76,772,772 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	79,179,265 - 79,179,444	NCBI	Rnor6.0
Rnor_5.0	5	83,293,499 - 83,293,678	UniSTS	Rnor5.0
RGSC_v3.4	5	80,324,639 - 80,324,818	UniSTS	RGSC3.4
Celera	5	75,706,506 - 75,706,685	UniSTS
Cytogenetic Map	5	q24	UniSTS

RH138430

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	76,774,739 - 76,776,114 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	79,181,412 - 79,182,786	NCBI	Rnor6.0
Rnor_5.0	5	83,295,646 - 83,297,020	UniSTS	Rnor5.0
RGSC_v3.4	5	80,326,786 - 80,328,160	UniSTS	RGSC3.4
Celera	5	75,708,653 - 75,710,027	UniSTS
RH 3.4 Map	11	655.2	UniSTS
Cytogenetic Map	5	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		3	3		3
Medium		19	18		18			2		5
Low	11	31	16	18	16	2	2	15	4	17	9	2
Below cutoff	20	4	4	1	4	6	6	12	22	17	2	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M10614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M11329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V01216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010454 ⟹ ENSRNOP00000010454

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	76,772,941 - 76,776,154 (+)	Ensembl
Rnor_6.0 Ensembl	5	79,179,417 - 79,182,820 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107594 ⟹ ENSRNOP00000081272

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	76,772,989 - 76,776,154 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112746 ⟹ ENSRNOP00000081825

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	76,772,941 - 76,775,549 (+)	Ensembl

RefSeq Acc Id:

NM_053288 ⟹ NP_445740

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	76,772,996 - 76,776,148 (+)	NCBI
Rnor_6.0	5	79,179,668 - 79,182,820 (+)	NCBI
Rnor_5.0	5	83,293,902 - 83,297,054 (+)	NCBI
RGSC_v3.4	5	80,325,042 - 80,328,194 (+)	RGD
Celera	5	75,706,909 - 75,710,061 (+)	RGD

Sequence:

show sequence

CTCTTCCTGGGCCGGTGCCTCTGAGTGTCTTCGGCATGGCGCTGCACATGGTTCTTGTCGTTTT
GAGCCTCCTGCCCTTGTTGGAAGCTCAGAACCCAGAACCTGCCAACATCACCCTAGGCATACCT
ATTACCAATGAGACCCTGAAATGGCTCTCAGACAAATGGTTTTACATGGGAGCAGCTTTCCGAG
ACCCCGTGTTCAAGCAGGCAGTTCAAACGATACAGACGGAATATTTTTACCTTACCCCCAACTT
GATAAACGACACAATTGAACTTCGGGAGTTTCAGACCACAGACGACCAGTGTGTCTATAACTTC
ACCCATCTAGGAGTCCAGAGAGAGAATGGGACCTTATCCAAGTGTGCAGGAGCAGTGAAAATCT
TTGCCCATTTGATAGTGCTGAAGAAACATGGGACCTTCATGCTTGCCTTTAACCTGACAGATGA
GAACCGGGGGCTGTCCTTCTATGCTAAAAAGCCAGACTTGTCCCCAGAGCTGCGGAAAATATTC
CAGCAGGCTGTCAAAGATGTGGGCATGGATGAATCAGAAATCGTATTTGTCGACTGGACAAAGG
ATAAGTGCAGTGAGCAGCAGAAGCAGCAGCTGGAGCTGGAGAAGGAGACTAAGAAGGAGACCAA
GAAGGATCCTTAGGCCAAGCATGAACTCAGCTCTCTGAACTCCGGGGACTGTCCCCATGCCCAC
TCTACCCCCACTCCTGTGCACCTCGATTCTATTTTCCACAATAATAAAGGTTTGGTTAAACAAT
C

hide sequence

RefSeq Acc Id:

XM_039109268 ⟹ XP_038965196

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	76,766,637 - 76,776,149 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_445740	(Get FASTA)	NCBI Sequence Viewer
	XP_038965196	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40699	(Get FASTA)	NCBI Sequence Viewer
	AAA40700	(Get FASTA)	NCBI Sequence Viewer
	AAA40701	(Get FASTA)	NCBI Sequence Viewer
	CAA24527	(Get FASTA)	NCBI Sequence Viewer
	EDM10527	(Get FASTA)	NCBI Sequence Viewer
	P02764	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_445740 ⟸ NM_053288
- Peptide Label:	precursor
- UniProtKB:	P02764 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MALHMVLVVLSLLPLLEAQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQ TEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGT FMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLE LEKETKKETKKDP hide sequence

RefSeq Acc Id:

ENSRNOP00000010454 ⟸ ENSRNOT00000010454

RefSeq Acc Id:	XP_038965196 ⟸ XM_039109268
- Peptide Label:	isoform X1
- UniProtKB:	P02764 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:

ENSRNOP00000081825 ⟸ ENSRNOT00000112746

RefSeq Acc Id:

ENSRNOP00000081272 ⟸ ENSRNOT00000107594

Protein Domains

Lipocln_cytosolic_FA-bd_dom

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02764-F1-model_v2	AlphaFold	P02764	1-205	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:67390	AgrOrtholog
BioCyc Gene	G2FUF-41070	BioCyc
Ensembl Genes	ENSRNOG00000007886	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000010454	ENTREZGENE
	ENSRNOP00000010454.2	UniProtKB/TrEMBL
	ENSRNOP00000081272.1	UniProtKB/TrEMBL
	ENSRNOP00000081825.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010454	ENTREZGENE
	ENSRNOT00000010454.5	UniProtKB/TrEMBL
	ENSRNOT00000107594.1	UniProtKB/TrEMBL
	ENSRNOT00000112746.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	A1A_glycop	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24614	UniProtKB/Swiss-Prot
NCBI Gene	24614	ENTREZGENE
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	ORM1	RGD
PhenoGen	Orm1	PhenoGen
PIRSF	AGP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	A1AGLPROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHF8_RAT	UniProtKB/TrEMBL
	A0A8I5ZRW3_RAT	UniProtKB/TrEMBL
	A0A8I5ZVI6_RAT	UniProtKB/TrEMBL
	A1AG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2003-04-28	Orm1	orosomucoid 1	Orm	Orosomucoid 1	Data Merged	628472	APPROVED
2003-04-09	Orm1	orosomucoid 1			Symbol and Name updated	629477	APPROVED
2003-03-06	Orm1	orosomucoid 1	Agpa1	alpha-1-acid glycoprotein	Data Merged	628472	PROVISIONAL
2002-06-10	Orm1				Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Orm	Orosomucoid 1			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Agpa1	alpha-1-acid glycoprotein			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	maybe induced during regeneration of hepatocytes after liver damage	61515
gene_expression	maybe induced during regeneration of hepatocytes after liver damage	70249
gene_regulation	induction regulated by glucocorticoids	729158

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD