Symbol:
Clcnkb
Name:
chloride voltage-gated channel Kb
RGD ID:
628639
Description:
Enables chloride channel activity. Involved in chloride transport. Predicted to be located in basolateral plasma membrane. Predicted to be part of chloride channel complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Bartter disease type 3; Bartter disease type 4b; Gitelman syndrome; and hypertension. Orthologous to human CLCNKB (chloride voltage-gated channel Kb); INTERACTS WITH (4-chloro-2-methylphenoxy)acetic acid; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
chloride channel K1-like; chloride channel K2; chloride channel Kb; chloride channel protein ClC-Kb; chloride channel, voltage-sensitive Kb; clC-K2; ClC-K2L; Clck2; Clcnk1l
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLCNKB (chloride voltage-gated channel Kb) HGNC
Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Clcnkb (chloride channel, voltage-sensitive Kb) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLCNKB (chloride voltage-gated channel Kb) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLCNK (chloride voltage-gated channel K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103225532 (chloride channel protein ClC-Kb) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CLCNKA (chloride voltage-gated channel Ka) HGNC
Ensembl, HomoloGene, OrthoDB, Panther, Treefam
Homo sapiens (human):
PLAAT3 (phospholipase A and acyltransferase 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CLCNKB (chloride voltage-gated channel Kb)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clcnkb (chloride channel, voltage-sensitive Kb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
clcnk (chloride channel K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ClC-a
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
clh-3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 158,993,073 - 159,005,618 (-) NCBI GRCr8 mRatBN7.2 5 153,710,086 - 153,733,162 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 153,710,094 - 153,732,153 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 156,396,936 - 156,408,682 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 158,170,222 - 158,181,968 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 158,159,402 - 158,171,149 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 159,950,384 - 159,973,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 159,950,392 - 159,962,676 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 163,670,926 - 163,694,123 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 160,294,294 - 160,305,991 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 160,304,482 - 160,316,179 (-) NCBI Celera 5 152,071,911 - 152,083,591 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clcnkb Rat (+)-catechin multiple interactions ISO CLCNKB (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of CLCNKB mRNA CTD PMID:24763279 Clcnkb Rat (4-chloro-2-methylphenoxy)acetic acid decreases activity EXP 6480464 2-Methyl-4-chlorophenoxyacetic Acid analog results in decreased activity of CLCNKB protein CTD PMID:15167890 Clcnkb Rat 1,1-dichloroethene decreases expression ISO Clcnkb (Mus musculus) 6480464 vinylidene chloride results in decreased expression of CLCNKB mRNA CTD PMID:26682919 Clcnkb Rat 1,2-dichloroethane increases expression ISO Clcnkb (Mus musculus) 6480464 ethylene dichloride results in increased expression of CLCNKB mRNA CTD PMID:28960355 Clcnkb Rat 17alpha-ethynylestradiol increases expression ISO Clcnkb (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CLCNKB mRNA CTD PMID:17942748 Clcnkb Rat 17alpha-ethynylestradiol multiple interactions ISO Clcnkb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLCNKB mRNA CTD PMID:17942748 Clcnkb Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of CLCNKB mRNA CTD PMID:32741896 Clcnkb Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of CLCNKB mRNA CTD PMID:32741896 Clcnkb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Clcnkb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CLCNKB mRNA CTD PMID:17942748 Clcnkb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CLCNKB mRNA CTD PMID:32109520 Clcnkb Rat 4,4'-diaminodiphenylmethane increases expression ISO Clcnkb (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CLCNKB mRNA CTD PMID:18648102 Clcnkb Rat 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid decreases activity EXP 6480464 4 more ... CTD PMID:15167890 Clcnkb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CLCNKB mRNA CTD PMID:24780913 Clcnkb Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CLCNKB mRNA CTD PMID:28959563 Clcnkb Rat Aflatoxin B2 alpha decreases methylation ISO CLCNKB (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of CLCNKB intron CTD PMID:30157460 Clcnkb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLCNKB mRNA CTD PMID:16483693 Clcnkb Rat benzo[a]pyrene decreases methylation ISO CLCNKB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CLCNKB promoter CTD PMID:27901495 Clcnkb Rat benzo[e]pyrene decreases methylation ISO CLCNKB (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of CLCNKB intron CTD PMID:30157460 Clcnkb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CLCNKB mRNA CTD PMID:25181051 Clcnkb Rat cadmium dichloride decreases expression ISO CLCNKB (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CLCNKB mRNA CTD PMID:38382870 Clcnkb Rat carbon nanotube increases expression ISO Clcnkb (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Clcnkb Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of CLCNKB mRNA CTD PMID:26577399 Clcnkb Rat entinostat increases expression ISO CLCNKB (Homo sapiens) 6480464 entinostat results in increased expression of CLCNKB mRNA CTD PMID:27188386 Clcnkb Rat furan increases expression EXP 6480464 furan results in increased expression of CLCNKB mRNA CTD PMID:25539665 and PMID:26194646 Clcnkb Rat graphite affects expression EXP 6480464 Graphite affects the expression of CLCNKB mRNA CTD PMID:29933104 Clcnkb Rat methamphetamine affects methylation ISO Clcnkb (Mus musculus) 6480464 Methamphetamine affects the methylation of CLCNKB promoter CTD PMID:26307267 Clcnkb Rat methamphetamine decreases expression ISO Clcnkb (Mus musculus) 6480464 Methamphetamine results in decreased expression of CLCNKB mRNA CTD PMID:26307267 Clcnkb Rat methapyrilene decreases methylation ISO CLCNKB (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of CLCNKB intron CTD PMID:30157460 Clcnkb Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CLCNKB mRNA CTD PMID:30047161 Clcnkb Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO CLCNKB (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Clcnkb Rat naphthalene increases expression ISO Clcnkb (Mus musculus) 6480464 naphthalene results in increased expression of CLCNKB mRNA CTD PMID:18978301 Clcnkb Rat nickel atom decreases expression ISO CLCNKB (Homo sapiens) 6480464 Nickel results in decreased expression of CLCNKB mRNA CTD PMID:25583101 Clcnkb Rat resveratrol multiple interactions ISO CLCNKB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CLCNKB mRNA CTD PMID:23557933 Clcnkb Rat rotenone increases expression ISO CLCNKB (Homo sapiens) 6480464 Rotenone results in increased expression of CLCNKB mRNA CTD PMID:29955902 Clcnkb Rat sarin increases expression EXP 6480464 Sarin results in increased expression of CLCNKB mRNA CTD PMID:16733813 Clcnkb Rat sodium arsenite affects methylation ISO CLCNKB (Homo sapiens) 6480464 sodium arsenite affects the methylation of CLCNKB gene CTD PMID:28589171 Clcnkb Rat sodium arsenite decreases expression ISO Clcnkb (Mus musculus) 6480464 sodium arsenite results in decreased expression of CLCNKB mRNA CTD PMID:37682722 Clcnkb Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of CLCNKB mRNA CTD PMID:32741896 Clcnkb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CLCNKB mRNA CTD PMID:34492290 Clcnkb Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of CLCNKB protein CTD PMID:32519852 Clcnkb Rat triptonide increases expression ISO Clcnkb (Mus musculus) 6480464 triptonide results in increased expression of CLCNKB mRNA CTD PMID:33045310 Clcnkb Rat valproic acid increases methylation ISO CLCNKB (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CLCNKB gene CTD PMID:29154799 Clcnkb Rat valproic acid affects expression ISO Clcnkb (Mus musculus) 6480464 Valproic Acid affects the expression of CLCNKB mRNA CTD PMID:17292431 Clcnkb Rat vancomycin increases expression ISO Clcnkb (Mus musculus) 6480464 Vancomycin results in increased expression of CLCNKB mRNA CTD PMID:18930951 Clcnkb Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CLCNKB mRNA CTD PMID:23034163 Clcnkb Rat zinc sulfate decreases expression ISO CLCNKB (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of CLCNKB mRNA CTD PMID:12756304 Clcnkb Rat zoledronic acid decreases expression ISO CLCNKB (Homo sapiens) 6480464 zoledronic acid results in decreased expression of CLCNKB mRNA CTD PMID:24714768
(+)-catechin (ISO) (4-chloro-2-methylphenoxy)acetic acid (EXP) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) Cuprizon (EXP) entinostat (ISO) furan (EXP) graphite (EXP) methamphetamine (ISO) methapyrilene (ISO) methimazole (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) naphthalene (ISO) nickel atom (ISO) resveratrol (ISO) rotenone (ISO) sarin (EXP) sodium arsenite (ISO) testosterone (EXP) thioacetamide (EXP) Triptolide (EXP) triptonide (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zinc sulfate (ISO) zoledronic acid (ISO)
1.
Two isoforms of a chloride channel predominantly expressed in thick ascending limb of Henle's loop and collecting ducts of rat kidney.
Adachi S, etal., J Biol Chem. 1994 Jul 1;269(26):17677-83.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Activating mutation of the renal epithelial chloride channel ClC-Kb predisposing to hypertension.
Jeck N, etal., Hypertension. 2004 Jun;43(6):1175-81. Epub 2004 May 17.
5.
Mutations in the chloride channel gene, CLCNKB, leading to a mixed Bartter-Gitelman phenotype.
Jeck N, etal., Pediatr Res 2000 Dec;48(6):754-8.
6.
Two highly homologous members of the ClC chloride channel family in both rat and human kidney.
Kieferle S, etal., Proc Natl Acad Sci U S A 1994 Jul 19;91(15):6943-7.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Mutations in the chloride channel gene, CLCNKB, cause Bartter's syndrome type III.
Simon DB, etal., Nat Genet 1997 Oct;17(2):171-8.
12.
No association with hypertension of CLCNKB and TNFRSF1B polymorphisms at a hypertension locus on chromosome 1p36.
Speirs HJ, etal., J Hypertens. 2005 Aug;23(8):1491-6.
Clcnkb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 158,993,073 - 159,005,618 (-) NCBI GRCr8 mRatBN7.2 5 153,710,086 - 153,733,162 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 153,710,094 - 153,732,153 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 156,396,936 - 156,408,682 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 158,170,222 - 158,181,968 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 158,159,402 - 158,171,149 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 159,950,384 - 159,973,576 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 159,950,392 - 159,962,676 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 163,670,926 - 163,694,123 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 160,294,294 - 160,305,991 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 160,304,482 - 160,316,179 (-) NCBI Celera 5 152,071,911 - 152,083,591 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
CLCNKB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 16,043,782 - 16,057,326 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 16,040,252 - 16,057,311 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 16,370,277 - 16,383,821 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 16,242,834 - 16,256,390 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 16,115,657 - 16,128,782 NCBI Celera 1 14,850,148 - 14,863,702 (+) NCBI Celera Cytogenetic Map 1 p36.13 NCBI HuRef 1 14,890,406 - 14,902,282 (+) NCBI HuRef CHM1_1 1 16,168,758 - 16,182,434 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 15,485,085 - 15,498,707 (+) NCBI T2T-CHM13v2.0
Clcnkb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 141,131,668 - 141,143,440 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 141,131,664 - 141,143,325 (-) Ensembl GRCm39 Ensembl GRCm38 4 141,404,357 - 141,416,055 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 141,404,353 - 141,416,014 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 140,960,272 - 140,971,903 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 140,676,436 - 140,688,057 (-) NCBI MGSCv36 mm8 Celera 4 143,220,859 - 143,232,479 (-) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 74.02 NCBI
CLCNKB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 210,863,650 - 210,876,660 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 210,112,249 - 210,125,260 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 15,180,858 - 15,194,757 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 16,174,570 - 16,188,166 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 16,174,570 - 16,188,166 (+) Ensembl panpan1.1 panPan2
CLCNK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 81,612,382 - 81,627,742 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 78,147,805 - 78,164,129 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 82,257,988 - 82,274,363 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 82,258,044 - 82,270,102 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 79,011,176 - 79,027,530 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 80,028,343 - 80,044,678 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 81,096,037 - 81,112,388 (-) NCBI UU_Cfam_GSD_1.0
LOC103225532 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 116,241,589 - 116,255,452 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 116,241,569 - 116,254,280 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023667320 3,151 - 17,253 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 172 Count of miRNA genes: 98 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000013550, ENSRNOT00000050729 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
BI279792
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 158,993,206 - 158,993,537 (+) Marker Load Pipeline mRatBN7.2 5 153,710,226 - 153,710,557 (+) MAPPER mRatBN7.2 Rnor_6.0 5 159,950,525 - 159,950,855 NCBI Rnor6.0 Rnor_5.0 5 163,671,067 - 163,671,397 UniSTS Rnor5.0 RGSC_v3.4 5 160,294,428 - 160,294,758 UniSTS RGSC3.4 Celera 5 152,072,045 - 152,072,375 UniSTS RH 3.4 Map 5 1053.7 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
105
75
74
43
25
43
6
202
97
85
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013550 ⟹ ENSRNOP00000013550
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 153,710,094 - 153,732,153 (-) Ensembl Rnor_6.0 Ensembl 5 159,950,392 - 159,962,676 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000050729 ⟹ ENSRNOP00000049598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 153,710,094 - 153,721,923 (-) Ensembl Rnor_6.0 Ensembl 5 159,950,392 - 159,962,218 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080462 ⟹ ENSRNOP00000074402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 159,960,720 - 159,961,560 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101714 ⟹ ENSRNOP00000082436
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 153,710,094 - 153,721,277 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118065 ⟹ ENSRNOP00000097182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 153,710,094 - 153,721,923 (-) Ensembl
RefSeq Acc Id:
NM_173103 ⟹ NP_775126
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,993,073 - 159,004,846 (-) NCBI mRatBN7.2 5 153,710,093 - 153,721,869 (-) NCBI Rnor_6.0 5 159,950,391 - 159,962,164 (-) NCBI Rnor_5.0 5 163,670,926 - 163,694,123 (-) NCBI RGSC_v3.4 5 160,294,294 - 160,305,991 (-) RGD Celera 5 152,071,911 - 152,083,591 (-) RGD
Sequence:
GGCACGCTGACAGAGAAACCATGGAGGAAATAGTGGGGCTTCGAGAGGGCTCGCCCAGGAAGCCAGTGCCTCTGCAAGAACTCTGGAGGCCGTGCCCACGAATCCGCAGAAACATCCAGGGGAGCCTA
hide sequence
RefSeq Acc Id:
XM_008764297 ⟹ XP_008762519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,993,073 - 159,004,894 (-) NCBI mRatBN7.2 5 153,710,086 - 153,721,917 (-) NCBI Rnor_6.0 5 159,950,384 - 159,963,109 (-) NCBI
Sequence:
CATGCACACGCCTATTTACACACACACACACACACACTTTCCTTTGTCTTCTCACTATGACATT
hide sequence
RefSeq Acc Id:
XM_063288467 ⟹ XP_063144537
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,993,073 - 159,005,618 (-) NCBI
RefSeq Acc Id:
XM_063288468 ⟹ XP_063144538
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,993,073 - 159,004,894 (-) NCBI
RefSeq Acc Id:
XM_063288469 ⟹ XP_063144539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,993,073 - 159,004,894 (-) NCBI
RefSeq Acc Id:
NP_775126 ⟸ NM_173103
- UniProtKB:
P51802 (UniProtKB/Swiss-Prot), A6ITT3 (UniProtKB/TrEMBL)
- Sequence:
MEEIVGLREGSPRKPVPLQELWRPCPRIRRNIQGSLEWLKERLFRVGEDWYFLVALGVLMALISYAMNFAIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALLSFSSGFSQSITPSSGGSGIPEVKT
hide sequence
RefSeq Acc Id:
XP_008762519 ⟸ XM_008764297
- Peptide Label:
isoform X3
- UniProtKB:
E9PTA8 (UniProtKB/TrEMBL), Q1W581 (UniProtKB/TrEMBL)
- Sequence:
MEEIVGLREGSPRKPVPLQELWRPCPRIRRNIQGSLEWLKERLFRVGEDWYFLVALGVLMALIS
hide sequence
Ensembl Acc Id:
ENSRNOP00000074402 ⟸ ENSRNOT00000080462
Ensembl Acc Id:
ENSRNOP00000013550 ⟸ ENSRNOT00000013550
Ensembl Acc Id:
ENSRNOP00000049598 ⟸ ENSRNOT00000050729
Ensembl Acc Id:
ENSRNOP00000082436 ⟸ ENSRNOT00000101714
Ensembl Acc Id:
ENSRNOP00000097182 ⟸ ENSRNOT00000118065
RefSeq Acc Id:
XP_063144537 ⟸ XM_063288467
- Peptide Label:
isoform X1
- UniProtKB:
A6ITT2 (UniProtKB/TrEMBL), A6ITT3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144539 ⟸ XM_063288469
- Peptide Label:
isoform X4
- UniProtKB:
Q1W581 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144538 ⟸ XM_063288468
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZU48 (UniProtKB/TrEMBL), A6ITT3 (UniProtKB/TrEMBL)
RGD ID: 13694229 Promoter ID: EPDNEW_R4749 Type: single initiation site Name: Clcnkb_1 Description: chloride voltage-gated channel Kb SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 159,962,182 - 159,962,242 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Clcnkb
chloride voltage-gated channel Kb
Clcnkb
chloride channel, voltage-sensitive Kb
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-16
Clcnkb
chloride channel, voltage-sensitive Kb
Clcnkb
chloride channel Kb
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Clcnkb
chloride channel Kb
Clcnk1l
chloride channel K1-like
Symbol and Name updated
1299863 APPROVED
2003-02-27
Clcnk1l
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
displays highest expression in the kidney
632474
