Symbol:
Cpq
Name:
carboxypeptidase Q
RGD ID:
628610
Description:
Predicted to enable metallodipeptidase activity and protein homodimerization activity. Involved in proteolysis; thyroid hormone generation; and tissue regeneration. Located in several cellular components, including Golgi apparatus; endoplasmic reticulum; and lysosome. Orthologous to human CPQ (carboxypeptidase Q); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 1-nitropropane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hematopoietic lineage switch 2 related protein; hls2-rp; LAL; lal-1; liver annexin like-1; liver annexin-like protein 1; Pgcp; plasma glutamate carboxypeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPQ (carboxypeptidase Q) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cpq (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpq (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CPQ (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPQ (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpq (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPQ (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CPQ (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpq (carboxypeptidase Q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CPQ (carboxypeptidase Q)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cpq (carboxypeptidase Q)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cpq
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 66,148,973 - 66,719,189 (+) NCBI GRCr8 mRatBN7.2 7 64,264,025 - 64,830,867 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 64,264,081 - 64,724,546 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 66,153,454 - 66,613,812 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 68,355,666 - 68,815,486 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 68,144,621 - 68,604,278 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 71,709,174 - 72,167,413 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 71,709,157 - 72,167,417 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 72,004,374 - 72,338,527 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 7 71,880,847 - 71,975,396 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 68,430,069 - 68,900,500 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 68,450,798 - 68,921,230 (+) NCBI Celera 7 61,386,725 - 61,844,888 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpq Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CPQ mRNA] CTD PMID:31150632 Cpq Rat 1,2-dimethylhydrazine multiple interactions ISO Cpq (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CPQ mRNA CTD PMID:22206623 Cpq Rat 1,2-dimethylhydrazine decreases expression ISO Cpq (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PGCP mRNA CTD PMID:22206623 Cpq Rat 1,4-dioxane decreases expression ISO Cpq (Mus musculus) 6480464 1 and 4-dioxane results in decreased expression of CPQ mRNA CTD PMID:33693819 Cpq Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of CPQ mRNA CTD PMID:25380136 Cpq Rat 1-nitropropane decreases expression EXP 6480464 1-nitropropane results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CPQ mRNA CTD PMID:32145629 Cpq Rat 17beta-estradiol decreases expression ISO Cpq (Mus musculus) 6480464 Estradiol results in decreased expression of CPQ mRNA CTD PMID:39298647 Cpq Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Cpq (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Cpq Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cpq (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPQ mRNA CTD PMID:19770486 and PMID:33956508 Cpq Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CPQ mRNA CTD PMID:34747641 Cpq Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cpq (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PGCP mRNA CTD PMID:15034205 Cpq Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPQ mRNA CTD PMID:21215274 Cpq Rat 2,4-diaminotoluene decreases expression EXP 6480464 2 and 4-diaminotoluene results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CPQ mRNA CTD PMID:21346803 Cpq Rat 2,6-diaminotoluene decreases expression EXP 6480464 2 and 6-diaminotoluene results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CPQ mRNA CTD PMID:21346803 Cpq Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 2-nitro-p-phenylenediamine decreases expression EXP 6480464 2-nitro-4-phenylenediamine results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 2-nitropropane decreases expression EXP 6480464 2-nitropropane results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Cpq Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of CPQ mRNA CTD PMID:27914987 Cpq Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Cpq (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PGCP mRNA CTD PMID:26251327 Cpq Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of CPQ protein CTD PMID:26597043 Cpq Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of CPQ mRNA CTD PMID:19162173 Cpq Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of CPQ mRNA CTD PMID:25380136 Cpq Rat 4,4'-sulfonyldiphenol decreases expression ISO Cpq (Mus musculus) 6480464 bisphenol S results in decreased expression of CPQ mRNA CTD PMID:39298647 Cpq Rat 4,4'-sulfonyldiphenol increases expression ISO CPQ (Homo sapiens) 6480464 bisphenol S results in increased expression of CPQ protein CTD PMID:34186270 Cpq Rat 4-acetylaminofluorene decreases expression EXP 6480464 4-acetylaminofluorene results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 4-hydroxyphenyl retinamide decreases expression ISO Cpq (Mus musculus) 6480464 Fenretinide results in decreased expression of CPQ mRNA CTD PMID:28973697 Cpq Rat 4-nitro-1,2-phenylenediamine decreases expression EXP 6480464 1 and 2-diamino-4-nitrobenzene results in decreased expression of CPQ mRNA CTD PMID:17070881 Cpq Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of CPQ mRNA CTD PMID:31881176 Cpq Rat aflatoxin B1 affects expression ISO CPQ (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CPQ protein CTD PMID:20106945 Cpq Rat aflatoxin B1 decreases methylation ISO CPQ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CPQ intron CTD PMID:30157460 Cpq Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of PGCP mRNA CTD PMID:23630614 Cpq Rat aflatoxin B1 decreases expression ISO CPQ (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CPQ mRNA CTD PMID:21641981 Cpq Rat aflatoxin B1 decreases expression ISO Cpq (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of CPQ mRNA CTD PMID:19770486 Cpq Rat Aflatoxin B2 alpha decreases methylation ISO CPQ (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of CPQ intron CTD PMID:30157460 Cpq Rat aldehydo-D-glucose multiple interactions ISO Cpq (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in decreased expression of CPQ mRNA] CTD PMID:33448797 Cpq Rat aldehydo-D-glucose decreases expression ISO Cpq (Mus musculus) 6480464 Glucose results in decreased expression of CPQ mRNA CTD PMID:33448797 Cpq Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CPQ mRNA CTD PMID:16483693 Cpq Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CPQ mRNA CTD PMID:30779732 Cpq Rat aristolochic acid A decreases expression ISO CPQ (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CPQ mRNA CTD PMID:33212167 Cpq Rat arsane affects methylation ISO CPQ (Homo sapiens) 6480464 Arsenic affects the methylation of PGCP gene CTD PMID:25304211 Cpq Rat arsenic atom affects methylation ISO CPQ (Homo sapiens) 6480464 Arsenic affects the methylation of PGCP gene CTD PMID:25304211 Cpq Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CPQ gene CTD PMID:28931070 Cpq Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat benzo[a]pyrene decreases expression ISO Cpq (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CPQ mRNA and Benzo(a)pyrene results in decreased expression of PGCP mRNA CTD PMID:15034205 and PMID:19770486 Cpq Rat benzo[a]pyrene affects methylation ISO CPQ (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CPQ intron and Benzo(a)pyrene affects the methylation of PGCP promoter CTD PMID:27901495 and PMID:30157460 Cpq Rat benzo[a]pyrene increases methylation ISO CPQ (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PGCP 5' UTR CTD PMID:27901495 Cpq Rat benzo[a]pyrene decreases expression ISO CPQ (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CPQ mRNA CTD PMID:21632981 more ... Cpq Rat benzo[a]pyrene increases expression ISO Cpq (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CPQ mRNA CTD PMID:22228805 Cpq Rat benzo[a]pyrene multiple interactions ISO Cpq (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of PGCP mRNA] CTD PMID:15034205 Cpq Rat bis(2-ethylhexyl) phthalate decreases expression ISO CPQ (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of CPQ protein CTD PMID:31163220 Cpq Rat bis(2-ethylhexyl) phthalate increases expression ISO Cpq (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CPQ mRNA CTD PMID:33754040 Cpq Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PGCP mRNA CTD PMID:25181051 Cpq Rat bisphenol A decreases expression ISO CPQ (Homo sapiens) 6480464 bisphenol A results in decreased expression of CPQ protein CTD PMID:34186270 Cpq Rat bisphenol A multiple interactions ISO CPQ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CPQ gene CTD PMID:31601247 Cpq Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CPQ mRNA CTD PMID:34947998 Cpq Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPQ mRNA CTD PMID:32145629 Cpq Rat bisphenol A increases expression ISO Cpq (Mus musculus) 6480464 bisphenol A results in increased expression of CPQ protein CTD PMID:28279065 Cpq Rat bisphenol AF increases expression ISO CPQ (Homo sapiens) 6480464 bisphenol AF results in increased expression of CPQ protein CTD PMID:34186270 Cpq Rat Bisphenol B increases expression ISO CPQ (Homo sapiens) 6480464 bisphenol B results in increased expression of CPQ protein CTD PMID:34186270 Cpq Rat bisphenol F increases expression ISO CPQ (Homo sapiens) 6480464 bisphenol F results in increased expression of CPQ protein CTD PMID:34186270 Cpq Rat butanal decreases expression ISO CPQ (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PGCP mRNA CTD PMID:26079696 Cpq Rat carbon nanotube decreases expression ISO Cpq (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cpq Rat cisplatin multiple interactions ISO CPQ (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CPQ mRNA CTD PMID:27392435 Cpq Rat cisplatin decreases expression ISO CPQ (Homo sapiens) 6480464 Cisplatin results in decreased expression of CPQ mRNA CTD PMID:27392435 Cpq Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of CPQ mRNA CTD PMID:30556269 Cpq Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of CPQ mRNA CTD PMID:30556269 Cpq Rat copper(II) sulfate decreases expression ISO CPQ (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CPQ mRNA CTD PMID:19549813 Cpq Rat cyclosporin A decreases expression ISO CPQ (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CPQ mRNA CTD PMID:20106945 Cpq Rat cyclosporin A decreases expression ISO Cpq (Mus musculus) 6480464 Cyclosporine results in decreased expression of CPQ mRNA CTD PMID:19770486 Cpq Rat D-glucose multiple interactions ISO Cpq (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in decreased expression of CPQ mRNA] CTD PMID:33448797 Cpq Rat D-glucose decreases expression ISO Cpq (Mus musculus) 6480464 Glucose results in decreased expression of CPQ mRNA CTD PMID:33448797 Cpq Rat Dibutyl phosphate affects expression ISO CPQ (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CPQ mRNA CTD PMID:37042841 Cpq Rat dicrotophos decreases expression ISO CPQ (Homo sapiens) 6480464 dicrotophos results in decreased expression of CPQ mRNA CTD PMID:28302478 Cpq Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PGCP mRNA CTD PMID:25152437 Cpq Rat dorsomorphin multiple interactions ISO CPQ (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPQ mRNA CTD PMID:27188386 Cpq Rat doxorubicin decreases expression ISO CPQ (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CPQ mRNA CTD PMID:29803840 Cpq Rat ethanol increases expression ISO Cpq (Mus musculus) 6480464 Ethanol results in increased expression of CPQ mRNA CTD PMID:30319688 Cpq Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of CPQ mRNA CTD PMID:18035473 Cpq Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PGCP mRNA CTD PMID:24136188 Cpq Rat folic acid multiple interactions ISO Cpq (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CPQ mRNA CTD PMID:22206623 Cpq Rat folic acid decreases expression ISO CPQ (Homo sapiens) 6480464 Folic Acid results in decreased expression of CPQ mRNA CTD PMID:21867686 Cpq Rat fucoxanthin multiple interactions ISO Cpq (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in decreased expression of CPQ mRNA] CTD PMID:33448797 Cpq Rat fulvestrant multiple interactions ISO CPQ (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CPQ gene CTD PMID:31601247 Cpq Rat furan increases methylation EXP 6480464 furan results in increased methylation of CPQ gene CTD PMID:22079235 Cpq Rat furan decreases expression EXP 6480464 furan results in decreased expression of CPQ mRNA and furan results in decreased expression of PGCP mRNA CTD PMID:25539665 and PMID:26194646 Cpq Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CPQ protein CTD PMID:22061828 Cpq Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PGCP mRNA CTD PMID:24136188 Cpq Rat glucose decreases expression ISO Cpq (Mus musculus) 6480464 Glucose results in decreased expression of CPQ mRNA CTD PMID:33448797 Cpq Rat glucose multiple interactions ISO Cpq (Mus musculus) 6480464 fucoxanthin inhibits the reaction [Glucose results in decreased expression of CPQ mRNA] CTD PMID:33448797 Cpq Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of CPQ gene CTD PMID:35440735 Cpq Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of PGCP mRNA CTD PMID:26302742 Cpq Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat lead(0) affects expression ISO CPQ (Homo sapiens) 6480464 Lead affects the expression of CPQ mRNA CTD PMID:28903495 Cpq Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PGCP mRNA CTD PMID:30467583 Cpq Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CPQ gene CTD PMID:35440735 Cpq Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of CPQ mRNA CTD PMID:19041683 and PMID:19638242 Cpq Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of CPQ mRNA CTD PMID:25380136 Cpq Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of CPQ protein CTD PMID:19716841 Cpq Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PGCP mRNA CTD PMID:24136188 Cpq Rat nickel atom decreases expression ISO CPQ (Homo sapiens) 6480464 Nickel results in decreased expression of CPQ mRNA CTD PMID:24768652 Cpq Rat nickel sulfate increases expression ISO CPQ (Homo sapiens) 6480464 nickel sulfate results in increased expression of PGCP mRNA CTD PMID:22714537 Cpq Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PGCP mRNA CTD PMID:24136188 Cpq Rat O-methyleugenol decreases expression ISO CPQ (Homo sapiens) 6480464 methyleugenol results in decreased expression of CPQ mRNA CTD PMID:32234424 Cpq Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat ozone multiple interactions ISO CPQ (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CPQ mRNA CTD PMID:35430440 Cpq Rat paracetamol affects expression ISO Cpq (Mus musculus) 6480464 Acetaminophen affects the expression of CPQ mRNA CTD PMID:17562736 Cpq Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CPQ mRNA CTD PMID:33387578 Cpq Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CPQ mRNA CTD PMID:19162173 Cpq Rat phenylmercury acetate multiple interactions ISO CPQ (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPQ mRNA CTD PMID:27188386 Cpq Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat potassium chromate decreases expression ISO CPQ (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PGCP mRNA CTD PMID:22714537 Cpq Rat progesterone affects response to substance ISO CPQ (Homo sapiens) 6480464 CPQ gene SNP affects the susceptibility to Progesterone CTD PMID:25622337 Cpq Rat propanal decreases expression ISO CPQ (Homo sapiens) 6480464 propionaldehyde results in decreased expression of PGCP mRNA CTD PMID:26079696 Cpq Rat quercetin decreases expression ISO CPQ (Homo sapiens) 6480464 Quercetin results in decreased expression of CPQ mRNA CTD PMID:21632981 Cpq Rat resveratrol multiple interactions ISO CPQ (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PGCP mRNA CTD PMID:23557933 Cpq Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CPQ mRNA CTD PMID:28374803 Cpq Rat SB 431542 multiple interactions ISO CPQ (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CPQ mRNA CTD PMID:27188386 Cpq Rat silicon dioxide decreases expression ISO CPQ (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of CPQ mRNA CTD PMID:25895662 Cpq Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CPQ protein CTD PMID:29459688 Cpq Rat sodium arsenite increases expression ISO CPQ (Homo sapiens) 6480464 sodium arsenite results in increased expression of CPQ mRNA CTD PMID:38568856 Cpq Rat sodium dichromate decreases expression ISO Cpq (Mus musculus) 6480464 sodium bichromate results in decreased expression of CPQ mRNA CTD PMID:22561333 Cpq Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of CPQ mRNA CTD PMID:25993096 Cpq Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of CPQ mRNA CTD PMID:22561333 Cpq Rat tert-butyl hydroperoxide decreases expression ISO CPQ (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of CPQ mRNA CTD PMID:15336504 Cpq Rat tetrachloromethane affects expression ISO Cpq (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of CPQ mRNA CTD PMID:17484886 Cpq Rat tetrachloromethane decreases expression ISO Cpq (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CPQ mRNA CTD PMID:31919559 Cpq Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CPQ mRNA CTD PMID:31150632 Cpq Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CPQ mRNA] CTD PMID:31150632 Cpq Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of CPQ mRNA CTD PMID:19483382 Cpq Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CPQ mRNA and Thioacetamide results in decreased expression of PGCP mRNA CTD PMID:23411599 and PMID:34492290 Cpq Rat titanium dioxide decreases expression ISO Cpq (Mus musculus) 6480464 titanium dioxide results in decreased expression of CPQ mRNA CTD PMID:23557971 Cpq Rat trimellitic anhydride decreases expression ISO Cpq (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of CPQ mRNA CTD PMID:19042947 Cpq Rat triphenyl phosphate affects expression ISO CPQ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CPQ mRNA CTD PMID:37042841 Cpq Rat valproic acid decreases methylation ISO CPQ (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CPQ gene CTD PMID:29154799 Cpq Rat valproic acid increases expression ISO CPQ (Homo sapiens) 6480464 Valproic Acid results in increased expression of CPQ mRNA CTD PMID:28001369 Cpq Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of CPQ gene CTD PMID:31079544 Cpq Rat zinc atom increases expression ISO CPQ (Homo sapiens) 6480464 Zinc deficiency results in increased expression of CPQ mRNA CTD PMID:18356318 Cpq Rat zinc(0) increases expression ISO CPQ (Homo sapiens) 6480464 Zinc deficiency results in increased expression of CPQ mRNA CTD PMID:18356318 Cpq Rat zoledronic acid decreases expression ISO CPQ (Homo sapiens) 6480464 zoledronic acid results in decreased expression of PGCP mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 1,4-dioxane (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropropane (EXP) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-diaminotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-nitro-p-phenylenediamine (EXP) 2-nitropropane (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-acetylaminofluorene (EXP) 4-hydroxyphenyl retinamide (ISO) 4-nitro-1,2-phenylenediamine (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) amiodarone (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) carbon nanotube (ISO) cisplatin (ISO) clofibrate (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) D-glucose (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) fucoxanthin (ISO) fulvestrant (ISO) furan (EXP) gentamycin (EXP) glafenine (EXP) glucose (ISO) glyphosate (EXP) L-ethionine (EXP) lead(0) (ISO) methapyrilene (EXP) methoxychlor (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nickel atom (ISO) nickel sulfate (ISO) nimesulide (EXP) O-methyleugenol (ISO) omeprazole (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) pirinixic acid (EXP) potassium chromate (ISO) progesterone (ISO) propanal (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Cellular Component
cytoplasm (IEA,ISO,ISS) endoplasmic reticulum (IDA,IEA) extracellular region (IEA) extracellular space (IBA,IDA,IEA,ISO) Golgi apparatus (IDA,IEA,ISO) lysosome (IDA,IEA,ISO)
1.
lal-1: a differentially expressed novel gene during proliferation in liver regeneration and in hepatoma cells.
Della Fazia MA, etal., Genes Cells 2002 Nov;7(11):1183-90.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
GOA pipeline
RGD automated data pipeline
4.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.
Cathepsin C and plasma glutamate carboxypeptidase secreted from Fischer rat thyroid cells liberate thyroxin from the N-terminus of thyroglobulin.
Suban D, etal., Biochimie. 2012 Mar;94(3):719-26. doi: 10.1016/j.biochi.2011.10.018. Epub 2011 Nov 20.
Cpq Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 66,148,973 - 66,719,189 (+) NCBI GRCr8 mRatBN7.2 7 64,264,025 - 64,830,867 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 64,264,081 - 64,724,546 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 66,153,454 - 66,613,812 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 68,355,666 - 68,815,486 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 68,144,621 - 68,604,278 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 71,709,174 - 72,167,413 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 71,709,157 - 72,167,417 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 72,004,374 - 72,338,527 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 7 71,880,847 - 71,975,396 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 68,430,069 - 68,900,500 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 68,450,798 - 68,921,230 (+) NCBI Celera 7 61,386,725 - 61,844,888 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
CPQ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 96,645,242 - 97,143,501 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 96,645,242 - 97,149,654 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 97,657,470 - 98,155,729 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 97,726,675 - 98,224,900 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 97,726,674 - 98,224,898 NCBI Celera 8 93,843,723 - 94,341,990 (+) NCBI Celera Cytogenetic Map 8 q22.1 NCBI HuRef 8 92,862,971 - 93,361,718 (+) NCBI HuRef CHM1_1 8 97,697,957 - 98,196,225 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 97,770,966 - 98,269,215 (+) NCBI T2T-CHM13v2.0
Cpq Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 33,083,275 - 33,594,698 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 33,083,275 - 33,594,698 (+) Ensembl GRCm39 Ensembl GRCm38 15 33,083,129 - 33,594,552 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 33,083,129 - 33,594,552 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 33,012,884 - 33,524,307 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 33,027,787 - 33,539,093 (+) NCBI MGSCv36 mm8 Celera 15 33,743,973 - 34,239,581 (+) NCBI Celera Cytogenetic Map 15 B3.1 NCBI cM Map 15 13.74 NCBI
Cpq Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 12,585,722 - 13,024,655 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 12,585,829 - 13,020,935 (+) NCBI ChiLan1.0 ChiLan1.0
CPQ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 113,971,190 - 114,596,821 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 89,510,729 - 90,136,463 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 93,264,536 - 93,883,201 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 95,461,027 - 95,974,029 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 95,599,177 - 95,974,029 (+) Ensembl panpan1.1 panPan2
CPQ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 41,058,641 - 41,461,567 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 41,058,306 - 41,461,563 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 29 41,286,374 - 41,655,798 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 41,130,486 - 41,655,802 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 41,328,033 - 41,695,262 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 41,296,426 - 41,666,684 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 41,790,780 - 42,130,099 (+) NCBI UU_Cfam_GSD_1.0
Cpq Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 38,063,459 - 38,513,392 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 45,485,926 - 45,848,416 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 45,489,562 - 45,848,412 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CPQ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 39,480,676 - 39,967,629 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 39,492,663 - 39,855,959 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 42,482,480 - 42,670,723 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 4 42,758,536 - 42,938,686 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CPQ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 91,604,736 - 92,095,671 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 91,738,987 - 92,097,126 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 48,675,637 - 49,182,115 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpq
.
Predicted Target Of
Count of predictions: 114 Count of miRNA genes: 93 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000008211 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
RH127776
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 64,724,226 - 64,724,425 (+) MAPPER mRatBN7.2 Rnor_6.0 7 72,167,091 - 72,167,289 NCBI Rnor6.0 Rnor_5.0 7 72,338,211 - 72,338,409 UniSTS Rnor5.0 RGSC_v3.4 7 68,900,184 - 68,900,382 UniSTS RGSC3.4 Celera 7 61,844,572 - 61,844,770 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008211 ⟹ ENSRNOP00000008211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 64,264,159 - 64,724,546 (+) Ensembl Rnor_6.0 Ensembl 7 71,709,157 - 72,167,417 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112011 ⟹ ENSRNOP00000095981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 64,264,081 - 64,634,621 (+) Ensembl
RefSeq Acc Id:
NM_031640 ⟹ NP_113828
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 66,149,398 - 66,609,736 (+) NCBI mRatBN7.2 7 64,264,180 - 64,724,543 (+) NCBI Rnor_6.0 7 71,709,339 - 72,167,407 (+) NCBI Rnor_5.0 7 71,880,847 - 71,975,396 (+) NCBI Rnor_5.0 7 72,004,374 - 72,338,527 (+) NCBI RGSC_v3.4 7 68,430,069 - 68,900,500 (+) RGD Celera 7 61,386,725 - 61,844,888 (+) RGD
Sequence:
GAGTTGCGGTTGCTGCTCTGCAGAACCTCGTGACCAGGTATTCCGATTTGGAGTCCTTGAATTAAAAACAACCATGGAGCATGTCATTGGAGACAGCAAGAAGAAAAGAAACTAGGGACAATGAGGTT
hide sequence
RefSeq Acc Id:
XM_008765417 ⟹ XP_008763639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 66,148,973 - 66,609,739 (+) NCBI mRatBN7.2 7 64,264,027 - 64,724,549 (+) NCBI Rnor_6.0 7 71,709,174 - 72,167,413 (+) NCBI
Sequence:
GGAGGGCTCCACAGCTTCCCAGGCACGTGAAGAAGGCAGGCCTGCAGACTCGGGGCTCAGGGCTGTTCCTGAGGCGTCTGGAGGCCCGCCCTGTGGATCCAGCACTTCAGAGCGACCTCCCGGTCCCG
hide sequence
RefSeq Acc Id:
XM_039079808 ⟹ XP_038935736
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 66,149,032 - 66,719,189 (+) NCBI mRatBN7.2 7 64,264,025 - 64,830,867 (+) NCBI
RefSeq Acc Id:
NP_113828 ⟸ NM_031640
- Peptide Label:
precursor
- UniProtKB:
A0A8I6AKX5 (UniProtKB/TrEMBL)
- Sequence:
MRFLFFLFVAVVHLFSLGSGKAIYKSGVSQRTFQEIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWGRGEESAVMVVPRIH
hide sequence
RefSeq Acc Id:
XP_008763639 ⟸ XM_008765417
- Peptide Label:
isoform X1
- UniProtKB:
Q9JLV0 (UniProtKB/Swiss-Prot), Q9Z1Y1 (UniProtKB/Swiss-Prot), Q6IRK9 (UniProtKB/Swiss-Prot), A6HQY8 (UniProtKB/TrEMBL), A0A8I6AKX5 (UniProtKB/TrEMBL)
- Sequence:
MRFLFFLFVAVVHLFSLGSGKAIYKSGVSQRTFQEIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMVVPRIH
hide sequence
Ensembl Acc Id:
ENSRNOP00000008211 ⟸ ENSRNOT00000008211
RefSeq Acc Id:
XP_038935736 ⟸ XM_039079808
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AKX5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095981 ⟸ ENSRNOT00000112011
RGD ID: 13695277 Promoter ID: EPDNEW_R5802 Type: initiation region Name: Cpq_1 Description: carboxypeptidase Q SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 71,709,318 - 71,709,378 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-05
Cpq
carboxypeptidase Q
Pgcp
plasma glutamate carboxypeptidase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Pgcp
plasma glutamate carboxypeptidase
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Pgcp
plasma glutamate carboxypeptidase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
transcript undetectable in normal liver, but over-expressed in liver regeneration
633681
