Symbol:
Kif3a
Name:
kinesin family member 3a
RGD ID:
621536
Description:
Enables kinesin binding activity. Involved in positive regulation of establishment or maintenance of cell polarity regulating cell shape; positive regulation of transport; and response to silicon dioxide. Located in neuronal cell body; plasma membrane bounded cell projection cytoplasm; and ribbon synapse. Biomarker of silicosis. Orthologous to human KIF3A (kinesin family member 3A); PARTICIPATES IN Hedgehog signaling pathway; insulin responsive facilitative sugar transporter mediated glucose transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
kinesin-like protein KIF3A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KIF3A (kinesin family member 3A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Kif3a (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kif3a (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KIF3A (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KIF3A (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kif3a (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KIF3A (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KIF3A (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kif3a (kinesin family member 3A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KIF3A (kinesin family member 3A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kif3a (kinesin family member 3A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kif3a (kinesin family member 3A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Klp64D
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
klp-20
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kif3a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 38,226,388 - 38,263,062 (+) NCBI GRCr8 mRatBN7.2 10 37,725,930 - 37,761,183 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 37,725,970 - 37,759,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 42,418,009 - 42,451,222 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 41,908,061 - 41,941,287 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 37,411,789 - 37,445,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 38,918,705 - 38,953,958 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 38,918,748 - 38,952,785 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 38,700,206 - 38,734,498 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 39,029,351 - 39,062,570 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 39,057,446 - 39,068,547 (+) NCBI Celera 10 37,070,450 - 37,103,611 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kif3a Rat (-)-demecolcine increases expression ISO RGD:1352051 6480464 Demecolcine results in increased expression of KIF3A mRNA CTD PMID:23649840 Kif3a Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552608 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KIF3A mRNA CTD PMID:36331819 Kif3a Rat 1,2-dichloroethane increases expression ISO RGD:1552608 6480464 ethylene dichloride results in increased expression of KIF3A mRNA CTD PMID:28960355 Kif3a Rat 1,2-dimethylhydrazine increases expression ISO RGD:1552608 6480464 1,2-Dimethylhydrazine results in increased expression of KIF3A mRNA CTD PMID:22206623 Kif3a Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1552608 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of KIF3A mRNA CTD PMID:31388691 Kif3a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIF3A mRNA CTD PMID:19490992 Kif3a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552608 6480464 Tetrachlorodibenzodioxin affects the expression of KIF3A mRNA CTD PMID:21570461 Kif3a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of KIF3A mRNA CTD PMID:21346803 Kif3a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of KIF3A mRNA CTD PMID:21346803 Kif3a Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of KIF3A protein CTD PMID:34915118 Kif3a Rat 5-fluorouracil multiple interactions ISO RGD:1352051 6480464 KIF3A mRNA affects the susceptibility to [Paclitaxel co-treated with Fluorouracil co-treated with Doxorubicin co-treated with more ... CTD PMID:16896004 Kif3a Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KIF3A mRNA CTD PMID:31881176 Kif3a Rat acetylsalicylic acid increases expression ISO RGD:1352051 6480464 Aspirin results in increased expression of KIF3A mRNA CTD PMID:20922562 Kif3a Rat acetylsalicylic acid affects response to substance ISO RGD:1352051 6480464 KIF3A polymorphism affects the susceptibility to Aspirin CTD PMID:20922562 Kif3a Rat aflatoxin M1 decreases expression ISO RGD:1352051 6480464 Aflatoxin M1 results in decreased expression of KIF3A mRNA CTD PMID:30928695 Kif3a Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of KIF3A protein CTD PMID:16483693 Kif3a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KIF3A mRNA CTD PMID:16483693 Kif3a Rat Aroclor 1254 decreases expression ISO RGD:1552608 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KIF3A mRNA CTD PMID:23650126 Kif3a Rat arsenous acid increases expression ISO RGD:1352051 6480464 Arsenic Trioxide results in increased expression of KIF3A mRNA CTD PMID:20458559 Kif3a Rat benzo[a]pyrene affects methylation ISO RGD:1352051 6480464 Benzo(a)pyrene affects the methylation of KIF3A promoter CTD PMID:27901495 Kif3a Rat benzo[a]pyrene decreases methylation ISO RGD:1552608 6480464 Benzo(a)pyrene results in decreased methylation of KIF3A 3' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 Kif3a Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1552608 6480464 Diethylhexyl Phthalate results in decreased expression of KIF3A mRNA CTD PMID:33754040 Kif3a Rat bisphenol A decreases expression ISO RGD:1552608 6480464 bisphenol A results in decreased expression of KIF3A mRNA CTD PMID:26063408 Kif3a Rat bisphenol A increases methylation ISO RGD:1352051 6480464 bisphenol A results in increased methylation of KIF3A gene CTD PMID:31601247 Kif3a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KIF3A gene CTD PMID:28505145 Kif3a Rat bisphenol F decreases expression ISO RGD:1552608 6480464 bisphenol F results in decreased expression of KIF3A mRNA CTD PMID:38685157 Kif3a Rat carbon nanotube decreases expression ISO RGD:1552608 6480464 Nanotubes, Carbon analog results in decreased expression of KIF3A mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Kif3a Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of KIF3A mRNA; Cocaine results in increased expression of KIF3A more ... CTD PMID:17898221|PMID:25100957 Kif3a Rat crocidolite asbestos decreases methylation ISO RGD:1352051 6480464 Asbestos, Crocidolite results in decreased methylation of KIF3A gene CTD PMID:29523930 Kif3a Rat cyclophosphamide multiple interactions ISO RGD:1352051 6480464 KIF3A mRNA affects the susceptibility to [Paclitaxel co-treated with Fluorouracil co-treated with Doxorubicin co-treated with more ... CTD PMID:16896004 Kif3a Rat cyclosporin A increases expression ISO RGD:1352051 6480464 Cyclosporine results in increased expression of KIF3A mRNA CTD PMID:20106945 Kif3a Rat diarsenic trioxide increases expression ISO RGD:1352051 6480464 Arsenic Trioxide results in increased expression of KIF3A mRNA CTD PMID:20458559 Kif3a Rat doxorubicin multiple interactions ISO RGD:1352051 6480464 KIF3A mRNA affects the susceptibility to [Paclitaxel co-treated with Fluorouracil co-treated with Doxorubicin co-treated with more ... CTD PMID:16896004 Kif3a Rat ethanol multiple interactions ISO RGD:1552608 6480464 Ethanol affects the expression of and affects the splicing of KIF3A mRNA CTD PMID:30319688 Kif3a Rat ethanol affects response to substance ISO RGD:1552608 6480464 KIF3A protein affects the susceptibility to Ethanol CTD PMID:34492310 Kif3a Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of KIF3A mRNA CTD PMID:30307764 Kif3a Rat folic acid decreases expression ISO RGD:1552608 6480464 Folic Acid results in decreased expression of KIF3A mRNA CTD PMID:25629700 Kif3a Rat furan increases expression EXP 6480464 furan results in increased expression of KIF3A mRNA CTD PMID:25539665|PMID:27387713 Kif3a Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KIF3A mRNA CTD PMID:22061828|PMID:33387578 Kif3a Rat hydrogen peroxide increases expression ISO RGD:1352051 6480464 Hydrogen Peroxide results in increased expression of KIF3A mRNA CTD PMID:18951874 Kif3a Rat hydrogen peroxide affects expression ISO RGD:1352051 6480464 Hydrogen Peroxide affects the expression of KIF3A protein CTD PMID:21179406 Kif3a Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of KIF3A mRNA CTD PMID:21396975 Kif3a Rat mercury dichloride decreases expression ISO RGD:1352051 6480464 Mercuric Chloride results in decreased expression of KIF3A mRNA CTD PMID:27188386 Kif3a Rat N-ethyl-N-nitrosourea increases mutagenesis ISO RGD:1552608 6480464 Ethylnitrosourea results in increased mutagenesis of KIF3A gene CTD PMID:15755804|PMID:16724327 Kif3a Rat okadaic acid increases expression ISO RGD:1352051 6480464 Okadaic Acid results in increased expression of KIF3A mRNA CTD PMID:38832940 Kif3a Rat paclitaxel multiple interactions ISO RGD:1352051 6480464 KIF3A mRNA affects the susceptibility to [Paclitaxel co-treated with Fluorouracil co-treated with Doxorubicin co-treated with more ... CTD PMID:16896004 Kif3a Rat paracetamol affects expression ISO RGD:1552608 6480464 Acetaminophen affects the expression of KIF3A mRNA CTD PMID:17562736 Kif3a Rat paracetamol increases expression ISO RGD:1352051 6480464 Acetaminophen results in increased expression of KIF3A mRNA CTD PMID:22230336 Kif3a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552608 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KIF3A mRNA CTD PMID:36331819 Kif3a Rat pirinixic acid increases expression ISO RGD:1552608 6480464 pirinixic acid results in increased expression of KIF3A mRNA CTD PMID:23811191 Kif3a Rat quercetin decreases expression ISO RGD:1352051 6480464 Quercetin results in decreased expression of KIF3A mRNA CTD PMID:21632981 Kif3a Rat silicon dioxide increases expression ISO RGD:1552608 6480464 Silicon Dioxide results in increased expression of KIF3A mRNA CTD PMID:33720480 Kif3a Rat sodium arsenate increases expression ISO RGD:1552608 6480464 sodium arsenate results in increased expression of KIF3A mRNA CTD PMID:21795629 Kif3a Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of KIF3A mRNA CTD PMID:25993096 Kif3a Rat sunitinib increases expression ISO RGD:1352051 6480464 Sunitinib results in increased expression of KIF3A mRNA CTD PMID:31533062 Kif3a Rat tamoxifen decreases expression ISO RGD:1552608 6480464 Tamoxifen results in decreased expression of KIF3A mRNA CTD PMID:17555576 Kif3a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KIF3A mRNA CTD PMID:23411599|PMID:34492290 Kif3a Rat titanium dioxide decreases methylation ISO RGD:1552608 6480464 titanium dioxide results in decreased methylation of KIF3A gene CTD PMID:35295148 Kif3a Rat trichostatin A increases expression ISO RGD:1352051 6480464 trichostatin A results in increased expression of KIF3A mRNA CTD PMID:24935251 Kif3a Rat trichostatin A affects expression ISO RGD:1352051 6480464 trichostatin A affects the expression of KIF3A mRNA CTD PMID:28542535 Kif3a Rat triphenyl phosphate affects expression ISO RGD:1352051 6480464 triphenyl phosphate affects the expression of KIF3A mRNA CTD PMID:37042841 Kif3a Rat triptonide decreases expression ISO RGD:1552608 6480464 triptonide results in decreased expression of KIF3A mRNA CTD PMID:33045310 Kif3a Rat urethane increases expression ISO RGD:1352051 6480464 Urethane results in increased expression of KIF3A mRNA CTD PMID:28818685 Kif3a Rat valproic acid increases expression ISO RGD:1352051 6480464 Valproic Acid results in increased expression of KIF3A mRNA CTD PMID:24935251|PMID:29154799 Kif3a Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KIF3A mRNA CTD PMID:19015723 Kif3a Rat vorinostat decreases expression ISO RGD:1352051 6480464 vorinostat results in decreased expression of KIF3A mRNA CTD PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Kif3a Rat ATP binding enables IEA UniRule:UR000401007 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Kif3a Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Kif3a Rat ATP binding enables IEA InterPro:IPR001752|InterPro:IPR019821 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Kif3a Rat ATP hydrolysis activity enables IBA MGI:1098226|PANTHER:PTN000648413|PomBase:SPBC1685.15c|PomBase:SPBC2F12.13|RGD:621520|TAIR:locus:2152059|TAIR:locus:2157533|UniProtKB:C8V3Q8|UniProtKB:O97277|UniProtKB:Q57XC6|UniProtKB:Q6YZ52|UniProtKB:Q96Q89 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Kif3a Rat cytoskeletal motor activity enables IEA UniRule:UR000401007 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Kif3a Rat intraciliary transport particle B binding enables ISO RGD:1552608 1624291 PMID:12821668 RGD PMID:12821668 Kif3a Rat kinesin binding IPI RGD:621538 729208 RGD Kif3a Rat microtubule binding enables IEA InterPro:IPR001752 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Kif3a Rat microtubule binding enables ISO RGD:1552608 1624291 PMID:17360631 RGD PMID:17360631 Kif3a Rat microtubule binding enables IBA FB:FBgn0000352|FB:FBgn0001308|FB:FBgn0002948|MGI:107689|MGI:108391|MGI:109564|MGI:1098226|PANTHER:PTN000648413|PomBase:SPAC3A11.14c|PomBase:SPAC664.10|PomBase:SPBC1685.15c|PomBase:SPBC2F12.13|RGD:1304996|RGD:1306815|RGD:621538|RGD:621559|TAIR:locus:2082697|TAIR:locus:2129630|TAIR:locus:2136437|TAIR:locus:2152059|TAIR:locus:2157533|UniProtKB:C8V3Q8|UniProtKB:O00139|UniProtKB:P33176|UniProtKB:P48467|UniProtKB:Q02241|UniProtKB:Q57XC6|UniProtKB:Q8NI77|UniProtKB:Q96Q89|UniProtKB:Q99661|WB:WBGene00006831|WB:WBGene00006974|dictyBase:DDB_G0267396|dictyBase:DDB_G0274603|dictyBase:DDB_G0293198 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Kif3a Rat microtubule motor activity enables IEA InterPro:IPR001752|InterPro:IPR019821|InterPro:IPR027640 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Kif3a Rat microtubule motor activity enables IBA FB:FBgn0001308|FB:FBgn0002948|FB:FBgn0003545|FB:FBgn0004380|FB:FBgn0004387|FB:FBgn0019968|FB:FBgn0030268|MGI:108426|MGI:109596|MGI:1098226|MGI:1098229|MGI:1098264|MGI:2447024|PANTHER:PTN000648413|PomBase:SPAC3A11.14c|PomBase:SPAC664.10|PomBase:SPBC15D4.01c|PomBase:SPBC1685.15c|PomBase:SPBC2F12.13|RGD:621520|RGD:621559|SGD:S000003184|SGD:S000006076|TAIR:locus:2088065|TAIR:locus:2115713|TAIR:locus:2127378|TAIR:locus:2129455|TAIR:locus:2129630|TAIR:locus:2152059|UniProtKB:C8V3Q8|UniProtKB:G5EAS6|UniProtKB:O60333|UniProtKB:P28739|UniProtKB:P33176|UniProtKB:Q2M1P5|UniProtKB:Q6YZ52|UniProtKB:Q7Z4S6|UniProtKB:Q8NI77|UniProtKB:Q96L93|UniProtKB:Q96Q89|WB:WBGene00002222|WB:WBGene00002225|WB:WBGene00002230|WB:WBGene00003884|WB:WBGene00006831|WB:WBGene00006840|WB:WBGene00006974|dictyBase:DDB_G0267396|dictyBase:DDB_G0280967|dictyBase:DDB_G0281555|dictyBase:DDB_G0290963|dictyBase:DDB_G0291039|dictyBase:DDB_G0293198 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Kif3a Rat nucleotide binding enables IEA UniRule:UR000401007 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Kif3a Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Kif3a Rat protein binding IPI RGD:1310227 10047152 RGD Kif3a Rat protein binding enables ISO RGD:1352051 1624291 UniProtKB:O00203-1|UniProtKB:Q13286|UniProtKB:Q8TCI5|UniProtKB:Q92845|UniProtKB:Q9BXF6|UniProtKB:Q9D9W1|UniProtKB:Q9NRI5 PMID:16298999, PMID:17043677, PMID:19934039, PMID:20643351, PMID:22261744, PMID:24338362, PMID:24591568, PMID:26496610, PMID:27173435, PMID:28514442, PMID:31413325, PMID:33961781, PMID:35271311 RGD PMID:16298999|PMID:17043677|PMID:19934039|PMID:20643351|PMID:22261744|PMID:24338362|PMID:24591568|PMID:26496610|PMID:27173435|PMID:28514442|PMID:31413325|PMID:33961781|PMID:35271311 Kif3a Rat protein binding enables IPI UniProtKB:Q9UHG0 10047152 PMID:21698230 GO_Central Kif3a Rat protein binding enables ISO RGD:1552608 1624291 PR:Q61771|PR:Q99PW8|UniProtKB:O08788|UniProtKB:P70188|UniProtKB:P97343|UniProtKB:Q61771|UniProtKB:Q6A078|UniProtKB:Q8VI40 PMID:12821668, PMID:16632484, PMID:17825299, PMID:17898177, PMID:19015237, PMID:19384852, PMID:19940036, PMID:21909995, PMID:22632975, PMID:23386061, PMID:31746486 RGD PMID:12821668|PMID:16632484|PMID:17825299|PMID:17898177|PMID:19015237|PMID:19384852|PMID:19940036|PMID:21909995|PMID:22632975|PMID:23386061|PMID:31746486 Kif3a Rat protein phosphatase binding enables ISO RGD:1352051 1624291 UniProtKB:P49593 PMID:24338362 RGD PMID:24338362 Kif3a Rat protein-containing complex binding IPI RGD:2123|RGD:620374 1581595 RGD Kif3a Rat small GTPase binding enables ISO RGD:1352051 1624291 UniProtKB:O14966 PMID:26021297 RGD PMID:26021297 Kif3a Rat spectrin binding enables ISO RGD:1352051 1624291 PMID:23704327 RGD PMID:23704327
Imported Annotations - PID (archival)
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 5-fluorouracil (ISO) acetamide (EXP) acetylsalicylic acid (ISO) aflatoxin M1 (ISO) ammonium chloride (EXP) Aroclor 1254 (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbon nanotube (ISO) cocaine (EXP) crocidolite asbestos (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) doxorubicin (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) hydrogen peroxide (ISO) indole-3-methanol (EXP) mercury dichloride (ISO) N-ethyl-N-nitrosourea (ISO) okadaic acid (ISO) paclitaxel (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) quercetin (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium dichromate (EXP) sunitinib (ISO) tamoxifen (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Microtubule-dependent movement of late endocytic vesicles in vitro: requirements for Dynein and Kinesin.
Bananis E, etal., Mol Biol Cell. 2004 Aug;15(8):3688-97. Epub 2004 Jun 4.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Dynamics of Kv1 channel transport in axons.
Gu Y and Gu C, PLoS One. 2010 Aug 4;5(8):e11931. doi: 10.1371/journal.pone.0011931.
4.
Silica Perturbs Primary Cilia and Causes Myofibroblast Differentiation during Silicosis by Reduction of the KIF3A-Repressor GLI3 Complex.
Li S, etal., Theranostics. 2020 Jan 1;10(4):1719-1732. doi: 10.7150/thno.37049. eCollection 2020.
5.
Kidney-specific inactivation of the KIF3A subunit of kinesin-II inhibits renal ciliogenesis and produces polycystic kidney disease.
Lin F, etal., Proc Natl Acad Sci U S A 2003 Apr 29;100(9):5286-91.
6.
Increased expression of the dyslexia candidate gene DCDC2 affects length and signaling of primary cilia in neurons.
Massinen S, etal., PLoS One. 2011;6(6):e20580. doi: 10.1371/journal.pone.0020580. Epub 2011 Jun 16.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
The kinesin motor KIF3A is a component of the presynaptic ribbon in vertebrate photoreceptors.
Muresan V, etal., J Neurosci. 1999 Feb 1;19(3):1027-37.
9.
KIF3C and KIF3A form a novel neuronal heteromeric kinesin that associates with membrane vesicles.
Muresan V, etal., Mol Biol Cell 1998 Mar;9(3):637-52.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
Role of the PAR-3-KIF3 complex in the establishment of neuronal polarity.
Nishimura T, etal., Nat Cell Biol. 2004 Apr;6(4):328-34. Epub 2004 Mar 28.
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
17.
APC and GSK-3beta are involved in mPar3 targeting to the nascent axon and establishment of neuronal polarity.
Shi SH, etal., Curr Biol. 2004 Nov 23;14(22):2025-32.
18.
Myosin Va and kinesin II motor proteins are concentrated in ribosomal domains (periaxoplasmic ribosomal plaques) of myelinated axons.
Sotelo-Silveira JR, etal., J Neurobiol. 2004 Aug;60(2):187-96.
19.
Active zone proteins are dynamically associated with synaptic ribbons in rat pinealocytes.
Spiwoks-Becker I, etal., Cell Tissue Res. 2008 Aug;333(2):185-95. doi: 10.1007/s00441-008-0627-3. Epub 2008 Jun 4.
Kif3a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 38,226,388 - 38,263,062 (+) NCBI GRCr8 mRatBN7.2 10 37,725,930 - 37,761,183 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 37,725,970 - 37,759,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 42,418,009 - 42,451,222 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 41,908,061 - 41,941,287 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 37,411,789 - 37,445,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 38,918,705 - 38,953,958 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 38,918,748 - 38,952,785 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 38,700,206 - 38,734,498 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 39,029,351 - 39,062,570 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 39,057,446 - 39,068,547 (+) NCBI Celera 10 37,070,450 - 37,103,611 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
KIF3A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 132,688,812 - 132,737,546 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 132,692,628 - 132,737,638 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 132,028,323 - 132,073,238 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 132,056,222 - 132,101,164 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 132,059,220 - 132,101,163 NCBI Celera 5 128,158,460 - 128,203,363 (-) NCBI Celera Cytogenetic Map 5 q31.1 NCBI HuRef 5 127,220,971 - 127,265,873 (-) NCBI HuRef CHM1_1 5 131,461,606 - 131,506,536 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 133,208,481 - 133,257,281 (-) NCBI T2T-CHM13v2.0
Kif3a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 53,456,531 - 53,495,075 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 53,458,206 - 53,492,794 (+) Ensembl GRCm39 Ensembl GRCm38 11 53,565,701 - 53,604,248 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 53,567,379 - 53,601,967 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 53,380,881 - 53,417,746 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 53,410,826 - 53,445,377 (+) NCBI MGSCv36 mm8 Celera 11 58,146,946 - 58,183,772 (+) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 31.97 NCBI
Kif3a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 4,069,639 - 4,115,998 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 4,072,823 - 4,115,975 (-) NCBI ChiLan1.0 ChiLan1.0
KIF3A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 128,004,995 - 128,049,749 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 126,144,560 - 126,189,314 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 128,112,636 - 128,154,443 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 134,268,505 - 134,315,431 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 134,274,352 - 134,315,431 (-) Ensembl panpan1.1 panPan2
KIF3A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 20,988,516 - 21,044,151 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 20,928,655 - 21,044,090 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 19,790,183 - 19,845,775 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 21,774,466 - 21,830,159 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 21,774,475 - 21,830,123 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 20,492,965 - 20,548,637 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 20,340,508 - 20,396,333 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 20,983,018 - 21,038,700 (-) NCBI UU_Cfam_GSD_1.0
Kif3a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 115,458,121 - 115,499,788 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936647 2,461,138 - 2,501,871 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936647 2,461,017 - 2,502,550 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIF3A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 134,932,615 - 135,069,377 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 134,932,339 - 135,069,408 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 140,400,867 - 140,537,919 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIF3A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 35,496,770 - 35,554,536 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 35,514,130 - 35,551,472 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 42,387,830 - 42,436,606 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kif3a
.
Predicted Target Of
Count of predictions: 7 Count of miRNA genes: 5 Interacting mature miRNAs: 7 Transcripts: ENSRNOT00000009999 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
D10Rat168
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 38,230,174 - 38,230,417 (+) Marker Load Pipeline mRatBN7.2 10 37,729,374 - 37,729,617 (+) MAPPER mRatBN7.2 Rnor_6.0 10 38,922,153 - 38,922,395 NCBI Rnor6.0 Rnor_5.0 10 38,703,881 - 38,704,123 UniSTS Rnor5.0 RGSC_v3.4 10 39,032,755 - 39,032,998 RGD RGSC3.4 RGSC_v3.4 10 39,032,756 - 39,032,998 UniSTS RGSC3.4 RGSC_v3.1 10 39,041,271 - 39,041,661 RGD Celera 10 37,073,855 - 37,074,097 UniSTS SHRSP x BN Map 10 36.2799 UniSTS SHRSP x BN Map 10 36.2799 RGD Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009999 ⟹ ENSRNOP00000009999
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,725,970 - 37,759,191 (+) Ensembl Rnor_6.0 Ensembl 10 38,918,748 - 38,951,967 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077569 ⟹ ENSRNOP00000069057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,726,277 - 37,759,191 (+) Ensembl Rnor_6.0 Ensembl 10 38,919,167 - 38,952,785 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096824 ⟹ ENSRNOP00000085263
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,729,166 - 37,757,761 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110159 ⟹ ENSRNOP00000096291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,728,722 - 37,757,761 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111035 ⟹ ENSRNOP00000096108
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,725,970 - 37,759,188 (+) Ensembl
RefSeq Acc Id:
NM_053377 ⟹ NP_445829
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,770 - 38,259,989 (+) NCBI mRatBN7.2 10 37,725,970 - 37,759,191 (+) NCBI Rnor_6.0 10 38,918,748 - 38,951,967 (+) NCBI Rnor_5.0 10 38,700,206 - 38,734,498 (+) NCBI RGSC_v3.4 10 39,029,351 - 39,062,570 (+) RGD Celera 10 37,070,450 - 37,103,611 (+) RGD
Sequence:
GCCGTAGTCTCCAGAGCGCTAAGGTGTTTCGGTCGCTTGCGGCCAGCCTCGCCTCCAAACCCGGTGTTGTTGGACTGCATCCGGAGCGGGGACATTGGCGGACCACCAGACGCGGCCACCATGCCGAT
hide sequence
RefSeq Acc Id:
XM_006246347 ⟹ XP_006246409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI mRatBN7.2 10 37,725,937 - 37,761,180 (+) NCBI Rnor_6.0 10 38,918,705 - 38,953,958 (+) NCBI Rnor_5.0 10 38,700,206 - 38,734,498 (+) NCBI
Sequence:
GGCGGGGCGAGCTCAGAGTGCGCCTGCGCACTGCGGTTTGTGAGCCGTAGTCTCCAGAGCGCTAAGGTGTTTCGGTCGCTTGCGGCCAGCCTCGCCTCCAAACCCGGTGTTGTTGGACTGCATCCGGA
hide sequence
RefSeq Acc Id:
XM_006246351 ⟹ XP_006246413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI mRatBN7.2 10 37,725,937 - 37,759,191 (+) NCBI Rnor_6.0 10 38,918,706 - 38,953,958 (+) NCBI Rnor_5.0 10 38,700,206 - 38,734,498 (+) NCBI
Sequence:
GCGGGGCGAGCTCAGAGTGCGCCTGCGCACTGCGGTTTGTGAGCCGTAGTCTCCAGAGCGCTAA
hide sequence
RefSeq Acc Id:
XM_017597556 ⟹ XP_017453045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI mRatBN7.2 10 37,726,318 - 37,759,141 (+) NCBI Rnor_6.0 10 38,919,098 - 38,953,958 (+) NCBI
Sequence:
GCCAGGCCTGCGCAGCCGGACAGAAAAAGCACCTCGCGGCCAGCAGGGACTTGGTGGCTGCGCG
hide sequence
RefSeq Acc Id:
XM_017597557 ⟹ XP_017453046
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI mRatBN7.2 10 37,725,936 - 37,759,141 (+) NCBI Rnor_6.0 10 38,918,705 - 38,953,958 (+) NCBI
Sequence:
GGCGGGGCGAGCTCAGAGTGCGCCTGCGCACTGCGGTTTGTGAGCCGTAGTCTCCAGAGCGCTAAGGTGTTTCGGTCGCTTGCGGCCAGCCTCGCCTCCAAACCCGGTGTTGTTGGACTGCATCCGGA
hide sequence
RefSeq Acc Id:
XM_039086966 ⟹ XP_038942894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,249,719 (+) NCBI mRatBN7.2 10 37,725,930 - 37,748,899 (+) NCBI
RefSeq Acc Id:
XM_039086967 ⟹ XP_038942895
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,249,719 (+) NCBI mRatBN7.2 10 37,725,932 - 37,748,899 (+) NCBI
RefSeq Acc Id:
XM_063269987 ⟹ XP_063126057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI
RefSeq Acc Id:
XM_063269988 ⟹ XP_063126058
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI
RefSeq Acc Id:
XM_063269989 ⟹ XP_063126059
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,263,062 (+) NCBI
RefSeq Acc Id:
XM_063269990 ⟹ XP_063126060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 38,226,388 - 38,249,719 (+) NCBI
RefSeq Acc Id:
NP_445829 ⟸ NM_053377
- UniProtKB:
A0A0G2JUD6 (UniProtKB/TrEMBL)
- Sequence:
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFA
hide sequence
RefSeq Acc Id:
XP_006246409 ⟸ XM_006246347
- Peptide Label:
isoform X1
- UniProtKB:
F1LQZ3 (UniProtKB/TrEMBL), A0A0G2JUD6 (UniProtKB/TrEMBL)
- Sequence:
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFD
hide sequence
RefSeq Acc Id:
XP_006246413 ⟸ XM_006246351
- Peptide Label:
isoform X5
- UniProtKB:
A6HED3 (UniProtKB/TrEMBL), A0A0G2JUD6 (UniProtKB/TrEMBL)
- Sequence:
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFD
hide sequence
RefSeq Acc Id:
XP_017453046 ⟸ XM_017597557
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JUD6 (UniProtKB/TrEMBL)
- Sequence:
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFA
hide sequence
RefSeq Acc Id:
XP_017453045 ⟸ XM_017597556
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2JUD6 (UniProtKB/TrEMBL)
- Sequence:
MINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAH
hide sequence
Ensembl Acc Id:
ENSRNOP00000069057 ⟸ ENSRNOT00000077569
Ensembl Acc Id:
ENSRNOP00000009999 ⟸ ENSRNOT00000009999
RefSeq Acc Id:
XP_038942894 ⟸ XM_039086966
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038942895 ⟸ XM_039086967
- Peptide Label:
isoform X9
Ensembl Acc Id:
ENSRNOP00000096291 ⟸ ENSRNOT00000110159
Ensembl Acc Id:
ENSRNOP00000096108 ⟸ ENSRNOT00000111035
Ensembl Acc Id:
ENSRNOP00000085263 ⟸ ENSRNOT00000096824
RefSeq Acc Id:
XP_063126058 ⟸ XM_063269988
- Peptide Label:
isoform X6
- UniProtKB:
A0A0G2JUD6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126057 ⟸ XM_063269987
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AP89 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126059 ⟸ XM_063269989
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AP89 (UniProtKB/TrEMBL), A0A8I6AL48 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126060 ⟸ XM_063269990
- Peptide Label:
isoform X10
RGD ID: 13697181 Promoter ID: EPDNEW_R7704 Type: initiation region Name: Kif3a_1 Description: kinesin family member 3a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R7705 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 38,918,751 - 38,918,811 EPDNEW
RGD ID: 13697185 Promoter ID: EPDNEW_R7705 Type: multiple initiation site Name: Kif3a_2 Description: kinesin family member 3a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R7704 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 38,919,203 - 38,919,263 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Kif3a
kinesin family member 3a
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Kif3a
kinesin family member 3a
Symbol and Name status set to provisional
70820 PROVISIONAL
