Symbol:
Nudt4
Name:
nudix hydrolase 4
RGD ID:
621355
Description:
Predicted to enable pyrophosphatase activity and snoRNA binding activity. Predicted to be involved in diphosphoinositol polyphosphate metabolic process and nucleotide catabolic process. Predicted to be located in cytosol. Predicted to be active in cytoplasm and nucleus. Orthologous to human NUDT4 (nudix hydrolase 4); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; diphosphoinositol polyphosphate phosphohydolase type II; diphosphoinositol polyphosphate phosphohydrolase 2; DIPP-2; DRCF-5; LOC360416; nucleoside diphosphate-linked moiety X motif 4; nudix (nucleoside diphosphate linked moiety X)-type motif 4; nudix motif 4; nudix-type motif 4; rDIPP2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NUDT4 (nudix hydrolase 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nudt4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nudt4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NUDT4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NUDT4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nudt4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NUDT4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NUDT4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nudt4 (nudix hydrolase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NUDT4B (nudix hydrolase 4B) HGNC
Ensembl, OrthoDB, Panther
Homo sapiens (human):
NUDT11 (nudix hydrolase 11) HGNC
OrthoDB
Homo sapiens (human):
NUDT10 (nudix hydrolase 10) HGNC
OrthoDB
Homo sapiens (human):
CHRM1 (cholinergic receptor muscarinic 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
NUDT4 (nudix hydrolase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nudt4 (nudix hydrolase 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NUDT4B (nudix hydrolase 4B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nudt4a (nudix (nucleoside diphosphate linked moiety X)-type motif 4a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
nudt4b (nudix (nucleoside diphosphate linked moiety X)-type motif 4b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Aps
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
DDP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
Y92H12BL.5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nudt4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 32,074,978 - 32,091,491 (-) NCBI GRCr8 mRatBN7.2 7 30,188,100 - 30,204,615 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 30,188,100 - 30,204,615 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 32,174,576 - 32,191,073 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 34,348,209 - 34,364,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 34,123,196 - 34,139,687 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 36,643,916 - 36,660,334 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 36,643,916 - 36,660,141 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 36,695,609 - 36,712,030 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 32,753,728 - 32,769,953 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 32,773,998 - 32,790,224 NCBI Celera 7 27,261,241 - 27,277,464 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nudt4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NUDT4 mRNA CTD PMID:22079256 Nudt4 Rat (1->4)-beta-D-glucan multiple interactions ISO Nudt4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NUDT4 mRNA CTD PMID:36331819 Nudt4 Rat (S)-nicotine increases expression ISO Nudt4 (Mus musculus) 6480464 Nicotine results in increased expression of NUDT4 mRNA CTD PMID:17997037 Nudt4 Rat 1,2-dimethylhydrazine decreases expression ISO Nudt4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NUDT4 mRNA CTD PMID:22206623 Nudt4 Rat 17alpha-ethynylestradiol increases expression ISO Nudt4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NUDT4 mRNA CTD PMID:17942748 Nudt4 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of NUDT4 mRNA CTD PMID:12075121 Nudt4 Rat 17alpha-ethynylestradiol multiple interactions ISO Nudt4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NUDT4 mRNA CTD PMID:17942748 Nudt4 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NUDT4 mRNA CTD PMID:32145629 Nudt4 Rat 17beta-estradiol increases expression ISO Nudt4 (Mus musculus) 6480464 Estradiol results in increased expression of NUDT4 mRNA CTD PMID:39298647 Nudt4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Nudt4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Nudt4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nudt4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NUDT4 mRNA CTD PMID:17942748 Nudt4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NUDT4 mRNA CTD PMID:34747641 Nudt4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NUDT4 mRNA CTD PMID:16960034 more ... Nudt4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nudt4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NUDT4 mRNA CTD PMID:21570461 Nudt4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NUDT4 mRNA CTD PMID:22298810 Nudt4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Nudt4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Nudt4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NUDT4 mRNA CTD PMID:21346803 Nudt4 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NUDT4 mRNA more ... CTD PMID:28628672 Nudt4 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of NUDT4 mRNA CTD PMID:19162173 Nudt4 Rat 4,4'-sulfonyldiphenol multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of NUDT4 mRNA CTD PMID:28628672 Nudt4 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NUDT4 mRNA CTD PMID:36041667 Nudt4 Rat 4,4'-sulfonyldiphenol increases expression ISO Nudt4 (Mus musculus) 6480464 bisphenol S results in increased expression of NUDT4 mRNA CTD PMID:39298647 Nudt4 Rat 4-hydroxyphenyl retinamide increases expression ISO Nudt4 (Mus musculus) 6480464 Fenretinide results in increased expression of NUDT4 mRNA CTD PMID:28973697 Nudt4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NUDT4 mRNA CTD PMID:24780913 Nudt4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of NUDT4 mRNA CTD PMID:31881176 Nudt4 Rat all-trans-retinoic acid decreases expression ISO NUDT4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NUDT4 mRNA CTD PMID:23724009 Nudt4 Rat all-trans-retinoic acid increases expression ISO NUDT4 (Homo sapiens) 6480464 Tretinoin results in increased expression of NUDT4 mRNA CTD PMID:33167477 Nudt4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NUDT4 mRNA CTD PMID:16483693 Nudt4 Rat antirheumatic drug increases expression ISO NUDT4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NUDT4 mRNA CTD PMID:24449571 Nudt4 Rat Aroclor 1254 decreases expression ISO Nudt4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NUDT4 mRNA CTD PMID:23650126 Nudt4 Rat arsane increases expression EXP 6480464 Arsenic results in increased expression of NUDT4 mRNA CTD PMID:18315880 Nudt4 Rat arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of NUDT4 mRNA CTD PMID:18315880 Nudt4 Rat arsenous acid multiple interactions ISO NUDT4 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NUDT4 protein] CTD PMID:26598702 Nudt4 Rat benzo[a]pyrene decreases expression ISO Nudt4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NUDT4 mRNA CTD PMID:17942131 Nudt4 Rat benzo[a]pyrene affects methylation ISO NUDT4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NUDT4 promoter CTD PMID:27901495 Nudt4 Rat benzo[a]pyrene decreases expression ISO NUDT4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NUDT4 mRNA CTD PMID:20106945 more ... Nudt4 Rat benzo[a]pyrene increases expression ISO Nudt4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NUDT4 mRNA CTD PMID:22228805 Nudt4 Rat benzo[a]pyrene diol epoxide I increases expression ISO NUDT4 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Nudt4 Rat beta-lapachone decreases expression ISO NUDT4 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NUDT4 mRNA CTD PMID:38218311 Nudt4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NUDT4 mRNA CTD PMID:12075121 more ... Nudt4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NUDT4 mRNA CTD PMID:36041667 Nudt4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NUDT4 mRNA CTD PMID:32145629 and PMID:34947998 Nudt4 Rat bisphenol A multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NUDT4 mRNA CTD PMID:28628672 Nudt4 Rat Bisphenol B increases expression ISO NUDT4 (Homo sapiens) 6480464 bisphenol B results in increased expression of NUDT4 protein CTD PMID:34186270 Nudt4 Rat bisphenol F multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NUDT4 mRNA CTD PMID:28628672 Nudt4 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NUDT4 mRNA CTD PMID:36041667 Nudt4 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of NUDT4 mRNA CTD PMID:32479839 Nudt4 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of NUDT4 mRNA CTD PMID:24136188 Nudt4 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of NUDT4 mRNA CTD PMID:19167457 Nudt4 Rat cadmium atom multiple interactions ISO Nudt4 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NUDT4 mRNA CTD PMID:37325564 Nudt4 Rat cadmium dichloride decreases expression ISO NUDT4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NUDT4 mRNA CTD PMID:38568856 Nudt4 Rat cadmium dichloride multiple interactions ISO Nudt4 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NUDT4 mRNA CTD PMID:37325564 Nudt4 Rat carbamazepine affects expression ISO NUDT4 (Homo sapiens) 6480464 Carbamazepine affects the expression of NUDT4 mRNA CTD PMID:25979313 Nudt4 Rat carbon nanotube increases expression ISO Nudt4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Nudt4 Rat chlorpyrifos decreases expression ISO Nudt4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NUDT4 mRNA CTD PMID:37019170 Nudt4 Rat chromium(6+) affects expression ISO Nudt4 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NUDT4 mRNA CTD PMID:28472532 Nudt4 Rat ciguatoxin CTX1B affects expression ISO Nudt4 (Mus musculus) 6480464 Ciguatoxins affects the expression of NUDT4 mRNA CTD PMID:18353800 Nudt4 Rat copper(II) sulfate increases expression ISO NUDT4 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NUDT4 mRNA CTD PMID:19549813 Nudt4 Rat cyclosporin A decreases expression ISO Nudt4 (Mus musculus) 6480464 Cyclosporine results in decreased expression of NUDT4 mRNA CTD PMID:17942131 Nudt4 Rat cyclosporin A increases expression ISO NUDT4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NUDT4 mRNA CTD PMID:27989131 Nudt4 Rat dexamethasone multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NUDT4 mRNA more ... CTD PMID:28628672 Nudt4 Rat diarsenic trioxide multiple interactions ISO NUDT4 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NUDT4 protein] CTD PMID:26598702 Nudt4 Rat dibutyl phthalate increases expression ISO Nudt4 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NUDT4 mRNA CTD PMID:21266533 Nudt4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NUDT4 mRNA CTD PMID:21266533 Nudt4 Rat diethylstilbestrol increases expression ISO NUDT4 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of NUDT4 mRNA CTD PMID:36621641 Nudt4 Rat dioxygen increases expression ISO Nudt4 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of NUDT4 mRNA CTD PMID:22629407 Nudt4 Rat dioxygen multiple interactions ISO Nudt4 (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of NUDT4 mRNA] CTD PMID:22629407 Nudt4 Rat dorsomorphin multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nudt4 Rat doxorubicin affects response to substance ISO NUDT4 (Homo sapiens) 6480464 NUDT4 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Nudt4 Rat doxorubicin decreases expression ISO NUDT4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NUDT4 mRNA CTD PMID:29803840 Nudt4 Rat ethanol affects splicing ISO Nudt4 (Mus musculus) 6480464 Ethanol affects the splicing of NUDT4 mRNA CTD PMID:30319688 Nudt4 Rat formaldehyde increases expression ISO NUDT4 (Homo sapiens) 6480464 Formaldehyde results in increased expression of NUDT4 mRNA CTD PMID:23649840 Nudt4 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of NUDT4 mRNA CTD PMID:12075121 Nudt4 Rat genistein increases expression ISO Nudt4 (Mus musculus) 6480464 Genistein results in increased expression of NUDT4 mRNA CTD PMID:32186404 Nudt4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NUDT4 mRNA CTD PMID:22061828 Nudt4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NUDT4 mRNA CTD PMID:22061828 Nudt4 Rat indometacin multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NUDT4 mRNA more ... CTD PMID:28628672 Nudt4 Rat isotretinoin decreases expression ISO NUDT4 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of NUDT4 mRNA CTD PMID:20436886 Nudt4 Rat ivermectin decreases expression ISO NUDT4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NUDT4 protein CTD PMID:32959892 Nudt4 Rat kainic acid increases expression ISO Nudt4 (Mus musculus) 6480464 Kainic Acid results in increased expression of NUDT4 mRNA CTD PMID:17997037 Nudt4 Rat ketoconazole increases expression ISO NUDT4 (Homo sapiens) 6480464 Ketoconazole results in increased expression of NUDT4 mRNA CTD PMID:36621641 Nudt4 Rat leflunomide increases expression ISO NUDT4 (Homo sapiens) 6480464 leflunomide results in increased expression of NUDT4 mRNA CTD PMID:28988120 Nudt4 Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of NUDT4 mRNA CTD PMID:24136188 Nudt4 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of NUDT4 mRNA CTD PMID:11331144 Nudt4 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of NUDT4 mRNA CTD PMID:11331144 Nudt4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of NUDT4 mRNA CTD PMID:30467583 Nudt4 Rat methylisothiazolinone increases expression ISO NUDT4 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of NUDT4 mRNA CTD PMID:31629900 Nudt4 Rat methylmercury chloride increases expression ISO NUDT4 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NUDT4 mRNA CTD PMID:26272509 Nudt4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of NUDT4 mRNA CTD PMID:24136188 Nudt4 Rat nickel atom decreases expression ISO NUDT4 (Homo sapiens) 6480464 Nickel results in decreased expression of NUDT4 mRNA CTD PMID:25583101 Nudt4 Rat nicotine increases expression ISO Nudt4 (Mus musculus) 6480464 Nicotine results in increased expression of NUDT4 mRNA CTD PMID:17997037 Nudt4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of NUDT4 mRNA CTD PMID:24136188 Nudt4 Rat paclitaxel affects response to substance ISO NUDT4 (Homo sapiens) 6480464 NUDT4 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Nudt4 Rat panobinostat multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NUDT4 mRNA CTD PMID:27188386 Nudt4 Rat panobinostat increases expression ISO NUDT4 (Homo sapiens) 6480464 panobinostat results in increased expression of NUDT4 mRNA CTD PMID:26272509 Nudt4 Rat paracetamol decreases expression ISO Nudt4 (Mus musculus) 6480464 Acetaminophen results in decreased expression of NUDT4 mRNA CTD PMID:17942131 Nudt4 Rat paracetamol increases expression ISO NUDT4 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NUDT4 mRNA CTD PMID:29067470 Nudt4 Rat paracetamol decreases expression ISO NUDT4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NUDT4 mRNA CTD PMID:26690555 Nudt4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nudt4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NUDT4 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of NUDT4 mRNA CTD PMID:36331819 Nudt4 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of NUDT4 mRNA CTD PMID:19162173 Nudt4 Rat phenobarbital affects expression ISO NUDT4 (Homo sapiens) 6480464 Phenobarbital affects the expression of NUDT4 mRNA CTD PMID:19159669 Nudt4 Rat pirinixic acid multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NUDT4 mRNA CTD PMID:19710929 Nudt4 Rat pirinixic acid increases expression ISO Nudt4 (Mus musculus) 6480464 pirinixic acid results in increased expression of NUDT4 mRNA CTD PMID:18445702 Nudt4 Rat potassium chromate increases expression ISO NUDT4 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of NUDT4 mRNA CTD PMID:22079256 Nudt4 Rat potassium chromate multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NUDT4 mRNA CTD PMID:22079256 Nudt4 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of NUDT4 mRNA CTD PMID:28374803 Nudt4 Rat SB 431542 multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nudt4 Rat sodium arsenite increases expression ISO Nudt4 (Mus musculus) 6480464 sodium arsenite results in increased expression of NUDT4 mRNA CTD PMID:37682722 Nudt4 Rat Soman increases expression EXP 6480464 Soman results in increased expression of NUDT4 mRNA CTD PMID:19281266 Nudt4 Rat testosterone decreases expression ISO Nudt4 (Mus musculus) 6480464 Testosterone results in decreased expression of NUDT4 mRNA CTD PMID:20403060 Nudt4 Rat tetrachloromethane affects expression ISO Nudt4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of NUDT4 mRNA CTD PMID:17484886 Nudt4 Rat tetrachloromethane increases expression ISO Nudt4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NUDT4 mRNA CTD PMID:31919559 Nudt4 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of NUDT4 protein CTD PMID:35544339 Nudt4 Rat titanium dioxide decreases expression ISO Nudt4 (Mus musculus) 6480464 titanium dioxide results in decreased expression of NUDT4 mRNA CTD PMID:23557971 Nudt4 Rat topotecan affects response to substance ISO NUDT4 (Homo sapiens) 6480464 NUDT4 protein affects the susceptibility to Topotecan CTD PMID:16217747 Nudt4 Rat Tributyltin oxide decreases expression ISO Nudt4 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of NUDT4 mRNA CTD PMID:17942131 Nudt4 Rat trichostatin A increases expression ISO NUDT4 (Homo sapiens) 6480464 trichostatin A results in increased expression of NUDT4 mRNA CTD PMID:24935251 and PMID:26272509 Nudt4 Rat trichostatin A multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NUDT4 mRNA CTD PMID:27188386 Nudt4 Rat triclosan decreases expression ISO NUDT4 (Homo sapiens) 6480464 Triclosan results in decreased expression of NUDT4 mRNA CTD PMID:30510588 Nudt4 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of NUDT4 mRNA CTD PMID:30589522 Nudt4 Rat triphenyl phosphate affects expression ISO NUDT4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NUDT4 mRNA CTD PMID:37042841 Nudt4 Rat urethane decreases expression ISO NUDT4 (Homo sapiens) 6480464 Urethane results in decreased expression of NUDT4 mRNA CTD PMID:28818685 Nudt4 Rat valproic acid increases expression ISO NUDT4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NUDT4 mRNA CTD PMID:23527032 and PMID:29154799 Nudt4 Rat valproic acid decreases methylation ISO NUDT4 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NUDT4 gene CTD PMID:29154799 Nudt4 Rat valproic acid affects expression ISO NUDT4 (Homo sapiens) 6480464 Valproic Acid affects the expression of NUDT4 mRNA CTD PMID:25979313 Nudt4 Rat valproic acid decreases expression ISO NUDT4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NUDT4 mRNA CTD PMID:23179753 Nudt4 Rat vincaleukoblastine affects response to substance ISO NUDT4 (Homo sapiens) 6480464 NUDT4 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Nudt4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NUDT4 mRNA CTD PMID:23034163 Nudt4 Rat vorinostat increases expression ISO NUDT4 (Homo sapiens) 6480464 vorinostat results in increased expression of NUDT4 mRNA CTD PMID:26272509 Nudt4 Rat vorinostat multiple interactions ISO NUDT4 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NUDT4 mRNA CTD PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Nudt4 Rat 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity NOT|enables ISS UniProtKB:Q8R2U6 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Nudt4 Rat 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity NOT|enables ISO Nudt4 (Mus musculus) 1624291 PMID:21070968 RGD PMID:21070968 Nudt4 Rat bis(5'-adenosyl)-hexaphosphatase activity enables IBA FB:FBgn0036111 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nudt4 Rat bis(5'-adenosyl)-pentaphosphatase activity enables IBA PANTHER:PTN000290327 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nudt4 Rat diphosphoinositol-polyphosphate diphosphatase activity enables ISS UniProtKB:Q9NZJ9 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Nudt4 Rat diphosphoinositol-polyphosphate diphosphatase activity enables IEA EC:3.6.1.52 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Nudt4 Rat diphosphoinositol-polyphosphate diphosphatase activity enables IBA FB:FBgn0036111 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nudt4 Rat diphosphoinositol-polyphosphate diphosphatase activity enables ISO NUDT4 (Homo sapiens) 1624291 PMID:10777568 RGD PMID:10777568 Nudt4 Rat endopolyphosphatase activity enables IBA PANTHER:PTN000290327 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nudt4 Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nudt4 Rat hydrolase activity enables IEA InterPro:IPR020084 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nudt4 Rat inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity enables IEA RHEA:56312 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Nudt4 Rat inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity enables IEA RHEA:22384 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Nudt4 Rat inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity enables IEA RHEA:59500 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Nudt4 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nudt4 Rat protein binding enables ISO NUDT4 (Homo sapiens) 1624291 UniProtKB:O76024 more ... RGD PMID:25416956 more ... Nudt4 Rat pyrophosphatase activity enables IEA InterPro:IPR047198 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nudt4 Rat RNA binding enables IEA UniProtKB-KW:KW-0694 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nudt4 Rat snoRNA binding enables ISS UniProtKB:Q8R2U6 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Nudt4 Rat snoRNA binding enables ISO Nudt4 (Mus musculus) 1624291 PMID:21070968 RGD PMID:21070968 Nudt4 Rat snoRNA binding enables IEA UniProtKB:Q8R2U6 and ensembl:ENSMUSP00000020217 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bromobenzene (EXP) buspirone (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) formaldehyde (ISO) genistein (EXP,ISO) gentamycin (EXP) indometacin (ISO) isotretinoin (ISO) ivermectin (ISO) kainic acid (ISO) ketoconazole (ISO) leflunomide (ISO) levofloxacin (EXP) lithium atom (EXP) lithium hydride (EXP) methapyrilene (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) nefazodone (EXP) nickel atom (ISO) nicotine (ISO) nimesulide (EXP) paclitaxel (ISO) panobinostat (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP,ISO) pirinixic acid (ISO) potassium chromate (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (EXP) titanium dioxide (ISO) topotecan (ISO) Tributyltin oxide (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (EXP,ISO) urethane (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vinclozolin (EXP) vorinostat (ISO)
Molecular Function
5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity (ISO,ISS) bis(5'-adenosyl)-hexaphosphatase activity (IBA) bis(5'-adenosyl)-pentaphosphatase activity (IBA) diphosphoinositol-polyphosphate diphosphatase activity (IBA,IEA,ISO,ISS) endopolyphosphatase activity (IBA) hydrolase activity (IEA) inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity (IEA) inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity (IEA) inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity (IEA) metal ion binding (IEA) protein binding (ISO) pyrophosphatase activity (IEA) RNA binding (IEA) snoRNA binding (IEA,ISO,ISS)
Nudt4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 32,074,978 - 32,091,491 (-) NCBI GRCr8 mRatBN7.2 7 30,188,100 - 30,204,615 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 30,188,100 - 30,204,615 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 32,174,576 - 32,191,073 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 34,348,209 - 34,364,896 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 34,123,196 - 34,139,687 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 36,643,916 - 36,660,334 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 36,643,916 - 36,660,141 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 36,695,609 - 36,712,030 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 32,753,728 - 32,769,953 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 32,773,998 - 32,790,224 NCBI Celera 7 27,261,241 - 27,277,464 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
NUDT4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 93,377,925 - 93,408,146 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 93,377,883 - 93,408,146 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 93,771,701 - 93,801,922 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 92,295,832 - 92,321,155 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 92,274,169 - 92,302,519 NCBI Celera 12 93,442,852 - 93,467,713 (+) NCBI Celera Cytogenetic Map 12 q22 NCBI HuRef 12 90,838,980 - 90,863,685 (+) NCBI HuRef CHM1_1 12 93,736,652 - 93,761,972 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 93,358,899 - 93,389,124 (+) NCBI T2T-CHM13v2.0
Nudt4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 95,382,869 - 95,400,008 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 95,382,869 - 95,400,008 (-) Ensembl GRCm39 Ensembl GRCm38 10 95,547,007 - 95,564,146 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 95,547,007 - 95,564,146 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 95,009,641 - 95,026,801 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 94,976,977 - 94,993,834 (-) NCBI MGSCv36 mm8 Celera 10 97,522,698 - 97,539,519 (-) NCBI Celera Cytogenetic Map 10 C2 NCBI cM Map 10 49.42 NCBI
Nudt4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955405 30,228,072 - 30,234,683 (+) NCBI ChiLan1.0 ChiLan1.0
NUDT4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 101,420,265 - 101,444,233 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 101,416,726 - 101,440,627 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 90,920,449 - 90,944,338 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 94,323,929 - 94,347,414 (+) NCBI panpan1.1 PanPan1.1 panPan2
NUDT4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 33,627,441 - 33,644,350 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 33,627,846 - 33,641,795 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 34,078,975 - 34,095,579 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 34,299,028 - 34,315,643 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 34,298,875 - 34,315,304 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 33,577,609 - 33,594,223 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 33,666,908 - 33,683,537 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 33,931,202 - 33,947,815 (+) NCBI UU_Cfam_GSD_1.0
Nudt4
NUDT4
NUDT4
Nudt4
.
Predicted Target Of
Count of predictions: 743 Count of miRNA genes: 296 Interacting mature miRNAs: 386 Transcripts: ENSRNOT00000012363 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH129315
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 30,188,142 - 30,188,339 (+) MAPPER mRatBN7.2 Rnor_6.0 7 36,643,959 - 36,644,155 NCBI Rnor6.0 Rnor_5.0 7 36,695,652 - 36,695,848 UniSTS Rnor5.0 RGSC_v3.4 7 32,753,771 - 32,753,967 UniSTS RGSC3.4 Celera 7 27,261,284 - 27,261,480 UniSTS Cytogenetic Map 7 q13 UniSTS
RH137140
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 30,188,294 - 30,188,487 (+) MAPPER mRatBN7.2 Rnor_6.0 7 36,644,111 - 36,644,303 NCBI Rnor6.0 Rnor_5.0 7 36,695,804 - 36,695,996 UniSTS Rnor5.0 RGSC_v3.4 7 32,753,923 - 32,754,115 UniSTS RGSC3.4 Celera 7 27,261,436 - 27,261,628 UniSTS RH 3.4 Map 7 233.3 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012363 ⟹ ENSRNOP00000012363
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 30,188,124 - 30,204,615 (-) Ensembl Rnor_6.0 Ensembl 7 36,643,916 - 36,660,141 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104209 ⟹ ENSRNOP00000078797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 30,188,124 - 30,204,615 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105881 ⟹ ENSRNOP00000077626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 30,188,100 - 30,193,778 (-) Ensembl
RefSeq Acc Id:
NM_001399417 ⟹ NP_001386346
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 32,074,978 - 32,091,491 (-) NCBI mRatBN7.2 7 30,188,100 - 30,204,615 (-) NCBI
RefSeq Acc Id:
NM_053598 ⟹ NP_446050
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 32,074,978 - 32,091,491 (-) NCBI mRatBN7.2 7 30,188,100 - 30,204,615 (-) NCBI Rnor_6.0 7 36,643,916 - 36,660,141 (-) NCBI Rnor_5.0 7 36,695,609 - 36,712,030 (-) NCBI RGSC_v3.4 7 32,753,728 - 32,769,953 (-) RGD Celera 7 27,261,241 - 27,277,464 (-) RGD
Sequence:
CCGGCTCCGGAGCACCGCGACTTCGTTCGGTCCGACTCCCCGGCGGGGTGGCGGCGGCCGGGTCCCCACGGTGGCGGCCGGAGCAGCGGCTGCAGGAGCCCGGCTCTAGGATGAAGTTCAAGCCCAAC
hide sequence
RefSeq Acc Id:
NP_446050 ⟸ NM_053598
- Peptide Label:
isoform 2
- UniProtKB:
Q99MY2 (UniProtKB/Swiss-Prot), A6IG47 (UniProtKB/TrEMBL), A0A8I5ZLI5 (UniProtKB/TrEMBL)
- Sequence:
MKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGVEPEEEPGGAAAREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000012363 ⟸ ENSRNOT00000012363
Ensembl Acc Id:
ENSRNOP00000077626 ⟸ ENSRNOT00000105881
Ensembl Acc Id:
ENSRNOP00000078797 ⟸ ENSRNOT00000104209
RefSeq Acc Id:
NP_001386346 ⟸ NM_001399417
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I5ZLI5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-10
Nudt4
nudix hydrolase 4
Nudt4
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-02-23
Nudt4
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Nudt4_predicted
nudix (nucleoside diphosphate linked moiety X)-type motif 4 (predicted)
Data merged from RGD:1309814
737654 APPROVED
2005-01-20
Nudt4
nudix (nucleoside diphosphate linked moiety X)-type motif 4
diphosphoinositol polyphosphate phosphohydolase type II
Name updated
1299863 APPROVED
2005-01-12
Nudt4_predicted
nudix (nucleoside diphosphate linked moiety X)-type motif 4 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-08-07
Nudt4
diphosphoinositol polyphosphate phosphohydolase type II
Symbol and Name status set to provisional
70820 PROVISIONAL
