Advanced Search (OLGA)

Gene: NUDT10 (nudix hydrolase 10) Homo sapiens

Subscribe to Updates

Analyze

No known orthologs.

Symbol:

NUDT10

Name:

nudix hydrolase 10

RGD ID:

1352246

HGNC Page

HGNC:17621

Description:

Predicted to enable pyrophosphatase activity. Predicted to be involved in diphosphoinositol polyphosphate metabolic process and nucleotide catabolic process. Located in cytosol.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

APS2; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha; diadenosine hexaphosphate hydrolase (AMP-forming); diphosphoinositol polyphosphate phosphohydrolase 3-alpha; diphosphoinositol polyphosphate phosphohydrolase type 3 alpha; DIPP-3-alpha; DIPP3-alpha; DIPP3a; hAps2; hDIPP3alpha; nucleoside diphosphate-linked moiety X motif 10; nudix (nucleoside diphosphate linked moiety X)-type motif 10; nudix motif 10

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Mus musculus (house mouse):	Nudt11 (nudix hydrolase 11)	HGNC	HGNC, OMA, Panther, Treefam
Sus scrofa (pig):	LOC100515984 (diphosphoinositol polyphosphate phosphohydrolase 3-beta)	HGNC	OMA, Treefam
Canis lupus familiaris (dog):	NUDT11 (nudix hydrolase 11)	HGNC	Inparanoid
Rattus norvegicus (Norway rat):	Nudt4 (nudix hydrolase 4)	HGNC	OrthoDB
Mus musculus (house mouse):	Nudt4 (nudix hydrolase 4)	HGNC	OrthoDB
Canis lupus familiaris (dog):	NUDT4 (nudix hydrolase 4)	HGNC	OrthoDB
Sus scrofa (pig):	NUDT4 (nudix hydrolase 4)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Nudt11 (nudix hydrolase 11)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Nudt11 (nudix hydrolase 11)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nudt10 (nudix hydrolase 10)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nudt4a (nudix (nucleoside diphosphate linked moiety X)-type motif 4a)	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Aps	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DDP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y92H12BL.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	51,332,231 - 51,337,525 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	51,332,231 - 51,337,525 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	51,075,083 - 51,080,377 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	51,091,823 - 51,097,117 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	50,908,118 - 50,913,411	NCBI
Celera	X	55,118,909 - 55,124,202 (+)	NCBI		Celera
Cytogenetic Map	X	p11.22	NCBI
HuRef	X	48,516,471 - 48,521,742 (+)	NCBI		HuRef
CHM1_1	X	51,154,988 - 51,160,299 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	50,603,515 - 50,608,810 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	autistic disorder		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
NUDT10	Human	congenital disorder of glycosylation type IIm		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 22	ClinVar	PMID:28492532
NUDT10	Human	neurodegeneration with brain iron accumulation 5		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Beta-propeller protein-associated neurodegeneration	ClinVar	PMID:28492532
NUDT10	Human	Stocco Dos Santos type X-linked intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: X-linked intellectual disability and Stocco dos Santos type	ClinVar	PMID:25670966
NUDT10	Human	syndromic X-linked intellectual disability Lubs type		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868
NUDT10	Human	Thrombocytopenia 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Thrombocytopenia and X-linked	ClinVar	PMID:28492532
NUDT10	Human	Wiskott-Aldrich syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: WISKOTT-ALDRICH SYNDROME 1	ClinVar	PMID:28492532
NUDT10	Human	X-linked epilepsy with variable learning disabilities and behavior disorders		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Epilepsy more ...	ClinVar	PMID:28492532
NUDT10	Human	X-linked severe congenital neutropenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: X-linked severe congenital neutropenia	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	8-Br-cAMP	decreases expression	EXP		6480464	8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of NUDT10 mRNA	CTD	PMID:22079614
NUDT10	Human	actinomycin D	multiple interactions	EXP		6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of NUDT10 mRNA	CTD	PMID:38460933
NUDT10	Human	adenosine 5'-(hexahydrogen pentaphosphate)	multiple interactions	EXP		6480464	[NUDT10 protein results in increased metabolism of diadenosine 5' more ...	CTD	PMID:12121577
NUDT10	Human	adenosine 5'-monophosphate	multiple interactions	EXP		6480464	[NUDT10 protein results in increased metabolism of diadenosine 5' more ...	CTD	PMID:12121577
NUDT10	Human	adenosine 5'-tetraphosphate(5-)	multiple interactions	EXP		6480464	[NUDT10 protein results in increased metabolism of P(1) and P(5)-di(adenosine-5'-)pentaphosphate] which results in increased chemical synthesis of adenosine 5'-tetraphosphate	CTD	PMID:12121577
NUDT10	Human	adenosine 5'-tetraphosphate(5-)	increases metabolic processing	EXP		6480464	NUDT10 protein results in increased metabolism of adenosine 5'-tetraphosphate	CTD	PMID:12121577
NUDT10	Human	arsenous acid	multiple interactions	EXP		6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NUDT10 protein]	CTD	PMID:26598702
NUDT10	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of NUDT10 3' UTR more ...	CTD	PMID:27901495
NUDT10	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of NUDT10 mRNA	CTD	PMID:32234424
NUDT10	Human	bis(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	Diethylhexyl Phthalate results in decreased expression of NUDT10 mRNA	CTD	PMID:31163220
NUDT10	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to NUDT10 gene]	CTD	PMID:28238834
NUDT10	Human	clozapine	increases expression	EXP		6480464	Clozapine results in increased expression of NUDT10 protein	CTD	PMID:34122009
NUDT10	Human	diarsenic trioxide	multiple interactions	EXP		6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NUDT10 protein]	CTD	PMID:26598702
NUDT10	Human	enzyme inhibitor	multiple interactions	EXP		6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NUDT10 protein	CTD	PMID:23301498
NUDT10	Human	kojic acid	decreases expression	EXP		6480464	kojic acid results in decreased expression of NUDT10 mRNA	CTD	PMID:16595896
NUDT10	Human	manganese(II) chloride	multiple interactions	EXP		6480464	manganese chloride promotes the reaction [NUDT10 protein results in increased metabolism of P(1) and P(5)-di(adenosine-5'-)pentaphosphate]	CTD	PMID:12121577
NUDT10	Human	Nutlin-3	multiple interactions	EXP		6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of NUDT10 mRNA	CTD	PMID:38460933
NUDT10	Human	P(1),P(4)-bis(5'-adenosyl) tetraphosphate	increases metabolic processing	EXP		6480464	NUDT10 protein results in increased metabolism of diadenosine tetraphosphate	CTD	PMID:12121577
NUDT10	Human	P(1),P(4)-bis(5'-guanosyl) tetraphosphate	increases metabolic processing	EXP		6480464	NUDT10 protein results in increased metabolism of diguanosine tetraphosphate	CTD	PMID:12121577
NUDT10	Human	P(1),P(5)-bis(5'-adenosyl) pentaphosphate	multiple interactions	EXP		6480464	[NUDT10 protein results in increased metabolism of P(1) more ...	CTD	PMID:12121577
NUDT10	Human	P(1),P(5)-bis(5'-adenosyl) pentaphosphate	increases metabolic processing	EXP		6480464	NUDT10 protein results in increased metabolism of P(1) and P(5)-di(adenosine-5'-)pentaphosphate	CTD	PMID:12121577
NUDT10	Human	P(1),P(6)-bis(5'-adenosyl)hexaphosphate	multiple interactions	EXP		6480464	[NUDT10 protein results in increased metabolism of diadenosine 5' more ...	CTD	PMID:12121577
NUDT10	Human	P(1),P(6)-bis(5'-adenosyl)hexaphosphate	increases metabolic processing	EXP		6480464	NUDT10 protein results in increased metabolism of diadenosine 5' more ...	CTD	PMID:12121577
NUDT10	Human	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide analog results in increased expression of NUDT10 mRNA	CTD	PMID:23806026
NUDT10	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of NUDT10 mRNA	CTD	PMID:31533062

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	adenosine 5'-(hexahydrogen pentaphosphate) catabolic process	involved_in	IBA	PANTHER:PTN000290327 and PomBase:SPAC13G6.14	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	diadenosine hexaphosphate catabolic process	involved_in	IBA	PANTHER:PTN000290327 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	diadenosine pentaphosphate catabolic process	involved_in	IBA	PANTHER:PTN000290327 and PomBase:SPAC13G6.14	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	diphosphoinositol polyphosphate metabolic process	involved_in	IBA	PANTHER:PTN000290327 and UniProtKB:O95989	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
NUDT10	Human	cytoplasm	is_active_in	IBA	FB:FBgn0036111 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
NUDT10	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-1855165 more ...
NUDT10	Human	cytosol	located_in	IDA		150520179		HPA	GO_REF:0000052
NUDT10	Human	nucleus	is_active_in	IBA	FB:FBgn0036111 more ...	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	bis(5'-adenosyl)-hexaphosphatase activity	enables	IEA	RHEA:32047	150520179		RHEA	GO_REF:0000116
NUDT10	Human	bis(5'-adenosyl)-hexaphosphatase activity	enables	IBA	FB:FBgn0036111 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	bis(5'-adenosyl)-pentaphosphatase activity	enables	IBA	PANTHER:PTN000290327 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	diphosphoinositol-polyphosphate diphosphatase activity	enables	IBA	FB:FBgn0036111 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	diphosphoinositol-polyphosphate diphosphatase activity	enables	IEA	EC:3.6.1.52	150520179		UniProt	GO_REF:0000003
NUDT10	Human	diphosphoinositol-polyphosphate diphosphatase activity	enables	ISS	UniProtKB:Q9NZJ9	150520179		UniProt	GO_REF:0000024
NUDT10	Human	endopolyphosphatase activity	enables	IBA	PANTHER:PTN000290327 more ...	150520179		GO_Central	GO_REF:0000033
NUDT10	Human	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
NUDT10	Human	hydrolase activity	enables	IEA	InterPro:IPR020084	150520179		InterPro	GO_REF:0000002
NUDT10	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
NUDT10	Human	protein binding	enables	IPI	UniProtKB:A0A024RBG1	150520179	PMID:33961781	IntAct	PMID:33961781
NUDT10	Human	protein binding	enables	IPI	UniProtKB:O75031 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
NUDT10	Human	protein binding	enables	IPI	UniProtKB:O75971 more ...	150520179	PMID:25416956	IntAct	PMID:25416956
NUDT10	Human	pyrophosphatase activity	enables	IEA	InterPro:IPR047198	150520179		InterPro	GO_REF:0000002
NUDT10	Human	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	150520179		UniProt	GO_REF:0000043

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NUDT10	Human	Autism		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12105228	PMID:12121577	PMID:12370170	PMID:12477932	PMID:15146197	PMID:15489334	PMID:15772651	PMID:16169070	PMID:17207965	PMID:18264097	PMID:18264098	PMID:20564319
PMID:21071540	PMID:21873635	PMID:25416956	PMID:27432908	PMID:32296183	PMID:32687490	PMID:32807901	PMID:33001583	PMID:33961781	PMID:34696672	PMID:36215168	PMID:37223481

Variants in NUDT10
7 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x3	copy number gain	See cases [RCV000133911]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|likely pathogenic\|conflicting data from submitters
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x3	copy number gain	See cases [RCV000050810]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:3092486-155699618)x2	copy number gain	See cases [RCV000050889]	ChrX:3092486..155699618 [GRCh38] ChrX:3010527..154929279 [GRCh37] ChrX:3020527..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x1	copy number loss	See cases [RCV000050811]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000050699]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	Global developmental delay [RCV000050386]\|See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000050697]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp22.33-11.22(chrX:10679-52809182)x1	copy number loss	See cases [RCV000051026]	ChrX:10679..52809182 [GRCh38] ChrX:60679..52838206 [GRCh37] ChrX:679..52854931 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:50086006-54030240)x1	copy number loss	See cases [RCV000051663]	ChrX:50086006..54030240 [GRCh38] ChrX:49850663..53957191 [GRCh37] ChrX:49737403..54073398 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40704-156022362)x3	copy number gain	See cases [RCV000052325]	ChrX:40704..156022362 [GRCh38] ChrX:90704..155252027 [GRCh37] ChrX:30704..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26101-155999293)x3	copy number gain	See cases [RCV000052322]	ChrX:26101..155999293 [GRCh38] ChrX:76101..155228958 [GRCh37] ChrX:16101..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:237659-156022362)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|See cases [RCV000052327]	ChrX:237659..156022362 [GRCh38] ChrX:154326..155252027 [GRCh37] ChrX:94326..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2790845-155699618)x3	copy number gain	See cases [RCV000052359]	ChrX:2790845..155699618 [GRCh38] ChrX:2708886..154929279 [GRCh37] ChrX:2718886..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:27245-155996431)x3	copy number gain	See cases [RCV000052324]	ChrX:27245..155996431 [GRCh38] ChrX:77245..155226096 [GRCh37] ChrX:17245..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:47859417-52789530)x3	copy number gain	See cases [RCV000052390]	ChrX:47859417..52789530 [GRCh38] ChrX:47835880..52818575 [GRCh37] ChrX:47603760..52835300 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp11.22(chrX:50916108-53902080)x2	copy number gain	See cases [RCV000052391]	ChrX:50916108..53902080 [GRCh38] ChrX:50659108..53928500 [GRCh37] ChrX:50675848..53945225 [NCBI36] ChrX:Xp11.22	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:48344666-52664916)x2	copy number gain	See cases [RCV000051992]	ChrX:48344666..52664916 [GRCh38] ChrX:48204101..52616581 [GRCh37] ChrX:48089045..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	Global developmental delay [RCV000052986]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|Intellectual functioning disability [RCV000052988]\|Global developmental delay [RCV000052989]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q22.1(chrX:675360-100368517)x1	copy number loss	See cases [RCV000053005]	ChrX:675360..100368517 [GRCh38] ChrX:636095..99623515 [GRCh37] ChrX:556095..99510171 [NCBI36] ChrX:Xp22.33-q22.1	pathogenic
GRCh38/hg38 Xp22.33-11.21(chrX:26102-57302794)x1	copy number loss	See cases [RCV000052990]	ChrX:26102..57302794 [GRCh38] ChrX:76102..57329227 [GRCh37] ChrX:16102..57345952 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp22.33-11.21(chrX:2769041-58055036)x1	copy number loss	See cases [RCV000053007]	ChrX:2769041..58055036 [GRCh38] ChrX:2687082..58081470 [GRCh37] ChrX:2697082..58098195 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	Hypoplastic left heart [RCV000052982]\|See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.1(chrX:253129-58271563)x1	copy number loss	See cases [RCV000052994]	ChrX:253129..58271563 [GRCh38] ChrX:169796..58297997 [GRCh37] ChrX:109796..58314722 [NCBI36] ChrX:Xp22.33-11.1	pathogenic
GRCh38/hg38 Xp22.33-11.21(chrX:10679-55550898)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052971]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052971]\|See cases [RCV000052971]	ChrX:10679..55550898 [GRCh38] ChrX:60679..55577331 [GRCh37] ChrX:679..55594056 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	Global developmental delay [RCV000052984]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10479-54179172)x3	copy number gain	See cases [RCV000053817]	ChrX:10479..54179172 [GRCh38] ChrX:60479..53957191 [GRCh37] ChrX:479..54222330 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022826)x4	copy number gain	See cases [RCV000133654]	ChrX:10679..156022826 [GRCh38] ChrX:60679..155252491 [GRCh37] ChrX:679..154905685 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:70297-58066465)x3	copy number gain	See cases [RCV000239834]	ChrX:70297..58066465 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-155978689)x1	copy number loss	See cases [RCV000133792]	ChrX:10701..155978689 [GRCh38] ChrX:60701..155208354 [GRCh37] ChrX:701..154861548 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10701-52857805)x1	copy number loss	See cases [RCV000133817]	ChrX:10701..52857805 [GRCh38] ChrX:60701..52886834 [GRCh37] ChrX:701..52903559 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:4245..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q11.1(chrX:10701-62712219)x1	copy number loss	See cases [RCV000134568]	ChrX:10701..62712219 [GRCh38] ChrX:60701..61931689 [GRCh37] ChrX:701..61848414 [NCBI36] ChrX:Xp22.33-q11.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-155999253)x3	copy number gain	See cases [RCV000134564]	ChrX:20297..155999253 [GRCh38] ChrX:70297..155228918 [GRCh37] ChrX:10297..154882112 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x1	copy number loss	See cases [RCV000133947]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp22.33-11.21(chrX:10701-58055053)x1	copy number loss	See cases [RCV000134026]	ChrX:10701..58055053 [GRCh38] ChrX:60701..58081487 [GRCh37] ChrX:701..58098212 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp21.1-q28(chrX:37076284-156016920)x1	copy number loss	See cases [RCV000135300]	ChrX:37076284..156016920 [GRCh38] ChrX:37094357..155246585 [GRCh37] ChrX:37004278..154899779 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xp22.31-11.22(chrX:8176030-53962833)x1	copy number loss	See cases [RCV000135305]	ChrX:8176030..53962833 [GRCh38] ChrX:8144071..53989266 [GRCh37] ChrX:8104071..54005991 [NCBI36] ChrX:Xp22.31-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156026127)x1	copy number loss	See cases [RCV000135321]	ChrX:20297..156026127 [GRCh38] ChrX:70297..155255792 [GRCh37] ChrX:10297..154908986 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10679-52857805)x3	copy number gain	See cases [RCV000134957]	ChrX:10679..52857805 [GRCh38] ChrX:60679..52886834 [GRCh37] ChrX:679..52903559 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:48022053-52664916)x3	copy number gain	See cases [RCV000135801]	ChrX:48022053..52664916 [GRCh38] ChrX:47881447..52616581 [GRCh37] ChrX:47766391..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic\|uncertain significance
GRCh38/hg38 Xp21.1-q28(chrX:36237706-156022206)x1	copy number loss	See cases [RCV000135552]	ChrX:36237706..156022206 [GRCh38] ChrX:36255823..155251871 [GRCh37] ChrX:36165744..154905065 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x1	copy number loss	See cases [RCV000136097]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40904-155998166)x1	copy number loss	See cases [RCV000136478]	ChrX:40904..155998166 [GRCh38] ChrX:90904..155227831 [GRCh37] ChrX:30904..154881025 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q25(chrX:10701-128393708)	copy number loss	See cases [RCV000136094]	ChrX:10701..128393708 [GRCh38] ChrX:60701..127527686 [GRCh37] ChrX:701..127355367 [NCBI36] ChrX:Xp22.33-q25	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10001-156030895)x1	copy number loss	See cases [RCV000136005]	ChrX:10001..156030895 [GRCh38] ChrX:60001..155260560 [GRCh37] ChrX:1..154913754 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.23-11.21(chrX:48344666-58055036)x3	copy number gain	See cases [RCV000135958]	ChrX:48344666..58055036 [GRCh38] ChrX:48204101..58081470 [GRCh37] ChrX:48089045..58098195 [NCBI36] ChrX:Xp11.23-11.21	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10679-52213731)x1	copy number loss	See cases [RCV000137112]	ChrX:10679..52213731 [GRCh38] ChrX:60679..51948998 [GRCh37] ChrX:679..51973598 [NCBI36] ChrX:Xp22.33-11.22	pathogenic\|uncertain significance
GRCh38/hg38 Xp22.33-q28(chrX:2782275-155611794)x2	copy number gain	See cases [RCV000136841]	ChrX:2782275..155611794 [GRCh38] ChrX:2700316..154785891 [GRCh37] ChrX:2710316..154494649 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:48260861-52664916)x2	copy number gain	See cases [RCV000136829]	ChrX:48260861..52664916 [GRCh38] ChrX:48120296..52616581 [GRCh37] ChrX:48005240..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2765636-155522304)x3	copy number gain	See cases [RCV000136791]	ChrX:2765636..155522304 [GRCh38] ChrX:2683677..154751965 [GRCh37] ChrX:2693677..154405159 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10701-52033734)x1	copy number loss	See cases [RCV000137430]	ChrX:10701..52033734 [GRCh38] ChrX:60701..51776830 [GRCh37] ChrX:701..51793570 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-11.21(chrX:10701-58055036)x1	copy number loss	See cases [RCV000137552]	ChrX:10701..58055036 [GRCh38] ChrX:60701..58081470 [GRCh37] ChrX:701..58098195 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp11.23-q22.1(chrX:49100536-102174742)x1	copy number loss	See cases [RCV000137414]	ChrX:49100536..102174742 [GRCh38] ChrX:48957474..101429714 [GRCh37] ChrX:48844418..101316370 [NCBI36] ChrX:Xp11.23-q22.1	pathogenic\|likely benign
GRCh38/hg38 Xp22.33-q13.3(chrX:10679-76420505)x3	copy number gain	See cases [RCV000137137]	ChrX:10679..76420505 [GRCh38] ChrX:60679..75640898 [GRCh37] ChrX:679..75557302 [NCBI36] ChrX:Xp22.33-q13.3	pathogenic\|likely benign
GRCh38/hg38 Xp11.23-11.22(chrX:48429509-52664916)x3	copy number gain	See cases [RCV000138106]	ChrX:48429509..52664916 [GRCh38] ChrX:48287896..52616581 [GRCh37] ChrX:48172840..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic\|likely pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:48429509-52664916)x1	copy number loss	See cases [RCV000138107]	ChrX:48429509..52664916 [GRCh38] ChrX:48287896..52693966 [GRCh37] ChrX:48172840..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp22.33-q22.3(chrX:10701-106113403)x1	copy number loss	See cases [RCV000137886]	ChrX:10701..106113403 [GRCh38] ChrX:60701..105357395 [GRCh37] ChrX:701..105244051 [NCBI36] ChrX:Xp22.33-q22.3	pathogenic
GRCh38/hg38 Xp22.2-q27.3(chrX:13020141-143473520)x1	copy number loss	See cases [RCV000138678]	ChrX:13020141..143473520 [GRCh38] ChrX:13038260..142561303 [GRCh37] ChrX:12948181..142388969 [NCBI36] ChrX:Xp22.2-q27.3	pathogenic
GRCh38/hg38 Xp22.33-11.1(chrX:10701-58517661)x1	copy number loss	See cases [RCV000139343]	ChrX:10701..58517661 [GRCh38] ChrX:60701..58544094 [GRCh37] ChrX:701..58560819 [NCBI36] ChrX:Xp22.33-11.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:1085618-155699644)x1	copy number loss	See cases [RCV000139278]	ChrX:1085618..155699644 [GRCh38] ChrX:1118268..154929305 [GRCh37] ChrX:1038268..154582499 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q21.31(chrX:10701-88318651)x1	copy number loss	See cases [RCV000139352]	ChrX:10701..88318651 [GRCh38] ChrX:60701..87573652 [GRCh37] ChrX:701..87460308 [NCBI36] ChrX:Xp22.33-q21.31	pathogenic
GRCh38/hg38 Xp11.23-11.22(chrX:48386298-52664916)x2	copy number gain	See cases [RCV000139185]	ChrX:48386298..52664916 [GRCh38] ChrX:48245740..52616581 [GRCh37] ChrX:48130684..52710691 [NCBI36] ChrX:Xp11.23-11.22	pathogenic\|uncertain significance
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004181)x3	copy number gain	See cases [RCV000139888]	ChrX:251880..156004181 [GRCh38] ChrX:168547..155233846 [GRCh37] ChrX:108547..154887040 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2299223-155992188)x3	copy number gain	See cases [RCV000141400]	ChrX:2299223..155992188 [GRCh38] ChrX:2217264..155221853 [GRCh37] ChrX:2227264..154875047 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156016920)x3	copy number gain	See cases [RCV000141401]	ChrX:20297..156016920 [GRCh38] ChrX:70297..155246585 [GRCh37] ChrX:10297..154899779 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x4	copy number gain	See cases [RCV000140786]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10701-53750424)x1	copy number loss	See cases [RCV000140711]	ChrX:10701..53750424 [GRCh38] ChrX:60701..53776922 [GRCh37] ChrX:701..53793647 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x1	copy number loss	See cases [RCV000140787]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic\|conflicting data from submitters
GRCh38/hg38 Xp11.23-11.22(chrX:48953927-53273903)x2	copy number gain	See cases [RCV000141869]	ChrX:48953927..53273903 [GRCh38] ChrX:48811187..53303085 [GRCh37] ChrX:48696131..53319810 [NCBI36] ChrX:Xp11.23-11.22	pathogenic
GRCh38/hg38 Xp11.22-q24(chrX:50289384-119297604)	copy number loss	See cases [RCV000141742]	ChrX:50289384..119297604 [GRCh38] ChrX:50032384..118431567 [GRCh37] ChrX:50049124..118315595 [NCBI36] ChrX:Xp11.22-q24	pathogenic
GRCh38/hg38 Xp11.3-11.22(chrX:46971389-54130971)x3	copy number gain	See cases [RCV000141567]	ChrX:46971389..54130971 [GRCh38] ChrX:46818746..53957191 [GRCh37] ChrX:46703690..54174129 [NCBI36] ChrX:Xp11.3-11.22	pathogenic
GRCh38/hg38 Xp22.33-q12(chrX:251880-66445845)x1	copy number loss	See cases [RCV000142334]	ChrX:251880..66445845 [GRCh38] ChrX:168547..65665687 [GRCh37] ChrX:108547..65582412 [NCBI36] ChrX:Xp22.33-q12	pathogenic
GRCh38/hg38 Xp22.33-q24(chrX:251879-118847157)x3	copy number gain	See cases [RCV000142134]	ChrX:251879..118847157 [GRCh38] ChrX:168546..117981120 [GRCh37] ChrX:108546..117865148 [NCBI36] ChrX:Xp22.33-q24	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:251880-51643625)x1	copy number loss	See cases [RCV000142035]	ChrX:251880..51643625 [GRCh38] ChrX:168547..51386559 [GRCh37] ChrX:108547..51403299 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x3	copy number gain	See cases [RCV000142625]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.22(chrX:10701-53131191)x1	copy number loss	See cases [RCV000143348]	ChrX:10701..53131191 [GRCh38] ChrX:60701..53047381 [GRCh37] ChrX:701..53177098 [NCBI36] ChrX:Xp22.33-11.22	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x1	copy number loss	See cases [RCV000143441]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:108546..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x3	copy number gain	See cases [RCV000143433]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-11.21(chrX:251879-56428859)x1	copy number loss	See cases [RCV000143130]	ChrX:251879..56428859 [GRCh38] ChrX:168546..56455292 [GRCh37] ChrX:108546..56472017 [NCBI36] ChrX:Xp22.33-11.21	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x3	copy number gain	See cases [RCV000143219]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:108547..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000148135]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000148141]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155246643)x3	copy number gain	See cases [RCV000240122]	ChrX:71267..155246643 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155250222)x3	copy number gain	See cases [RCV000239843]	ChrX:176426..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:70297-58066465)x1	copy number loss	See cases [RCV000239814]	ChrX:70297..58066465 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255839)x1	copy number loss	See cases [RCV000239832]	ChrX:71267..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q28(chrX:13147668-155250222)x3	copy number gain	See cases [RCV000239798]	ChrX:13147668..155250222 [GRCh37] ChrX:Xp22.2-q28	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48310313-52614698)x1	copy number loss	See cases [RCV000203435]	ChrX:48310313..52614698 [GRCh37] ChrX:Xp11.23-11.22	pathogenic\|uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255839)x3	copy number gain	See cases [RCV000239934]	ChrX:70297..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x2	copy number gain	See cases [RCV000240106]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:553069-155233731)x1	copy number loss	See cases [RCV000446026]	ChrX:553069..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155224766)x1	copy number loss	See cases [RCV000239902]	ChrX:71267..155224766 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246271)x3	copy number gain	See cases [RCV000239989]	ChrX:60701..155246271 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155234036)x2	copy number gain	See cases [RCV000239874]	ChrX:71267..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.3-q21.1(chrX:44734936-79676121)x3	copy number gain	See cases [RCV000240019]	ChrX:44734936..79676121 [GRCh37] ChrX:Xp11.3-q21.1	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155236656)x3	copy number gain	See cases [RCV000240552]	ChrX:176426..155236656 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x3	copy number gain	See cases [RCV000240314]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:225816-155234036)x2	copy number gain	See cases [RCV000240464]	ChrX:225816..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2707626-155250222)x2	copy number gain	See cases [RCV000240541]	ChrX:2707626..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q25(chrX:11692290-121187337)x2	copy number gain	not provided [RCV000488046]	ChrX:11692290..121187337 [GRCh37] ChrX:Xp22.2-q25	uncertain significance
Single allele	duplication	Syndromic X-linked intellectual disability Lubs type [RCV000768455]	ChrX:15323210..153542100 [GRCh37] ChrX:Xp22.2-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-154930047)x3	copy number gain	See cases [RCV000449437]	ChrX:168546..154930047 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x3	copy number gain	See cases [RCV000449330]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)	copy number loss	See cases [RCV000449461]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48317353-51497588)x3	copy number gain	See cases [RCV000449147]	ChrX:48317353..51497588 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-55529093)x1	copy number loss	See cases [RCV000446584]	ChrX:168546..55529093 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-56684082)x1	copy number loss	See cases [RCV000447092]	ChrX:168546..56684082 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246225)x3	copy number gain	See cases [RCV000446270]	ChrX:60701..155246225 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2703632-155233731)x1	copy number loss	See cases [RCV000446712]	ChrX:2703632..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.22(chrX:168546-52573789)x1	copy number loss	See cases [RCV000447470]	ChrX:168546..52573789 [GRCh37] ChrX:Xp22.33-11.22	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255792)x1	copy number loss	See cases [RCV000446197]	ChrX:71267..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:318707-155224707)x1	copy number loss	See cases [RCV000446667]	ChrX:318707..155224707 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48317353-51497588)x2	copy number gain	See cases [RCV000447617]	ChrX:48317353..51497588 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	See cases [RCV000446932]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155196888)x3	copy number gain	See cases [RCV000446310]	ChrX:168546..155196888 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155081533)x3	copy number gain	See cases [RCV000447253]	ChrX:168546..155081533 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168566-155233731)x1	copy number loss	See cases [RCV000445720]	ChrX:168566..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	See cases [RCV000448393]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)x4	copy number gain	See cases [RCV000448034]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.1(chrX:168546-58140271)x1	copy number loss	See cases [RCV000447773]	ChrX:168546..58140271 [GRCh37] ChrX:Xp22.33-11.1	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155246585)x1	copy number loss	See cases [RCV000448652]	ChrX:70297..155246585 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-55240087)x1	copy number loss	See cases [RCV000512136]	ChrX:168546..55240087 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168547-151304063)x1	copy number loss	See cases [RCV000510382]	ChrX:168547..151304063 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q23(chrX:168547-112474026)x1	copy number loss	See cases [RCV000510419]	ChrX:168547..112474026 [GRCh37] ChrX:Xp22.33-q23	pathogenic
GRCh37/hg19 Xp22.33-11.1(chrX:168546-58527164)x1	copy number loss	See cases [RCV000510437]	ChrX:168546..58527164 [GRCh37] ChrX:Xp22.33-11.1	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-57504183)x1	copy number loss	See cases [RCV000511615]	ChrX:168546..57504183 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-57683964)x1	copy number loss	See cases [RCV000512022]	ChrX:168546..57683964 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp21.1-q22.1(chrX:37521774-98488534)x1	copy number loss	See cases [RCV000512026]	ChrX:37521774..98488534 [GRCh37] ChrX:Xp21.1-q22.1	pathogenic
GRCh37/hg19 Xp21.2-q28(chrX:31088082-155233731)x1	copy number loss	See cases [RCV000511413]	ChrX:31088082..155233731 [GRCh37] ChrX:Xp21.2-q28	pathogenic\|uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168547-155233731)	copy number gain	See cases [RCV000512020]	ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-54996659)x1	copy number loss	See cases [RCV000510822]	ChrX:168546..54996659 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-q13.3(chrX:168546-74549686)	copy number loss	See cases [RCV000512142]	ChrX:168546..74549686 [GRCh37] ChrX:Xp22.33-q13.3	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48224454-52813336)x3	copy number gain	See cases [RCV000512224]	ChrX:48224454..52813336 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48290189-52154997)x4	copy number gain	See cases [RCV000512561]	ChrX:48290189..52154997 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168564-57413442)x1	copy number loss	See cases [RCV000512339]	ChrX:168564..57413442 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.31-q21.31(chrX:7841947-90815333)x1,2	copy number gain	not provided [RCV000684261]	ChrX:7841947..90815333 [GRCh37] ChrX:Xp22.31-q21.31	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48156672-52672728)x1	copy number loss	not provided [RCV000684331]	ChrX:48156672..52672728 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:60814-55476165)x1	copy number loss	not provided [RCV000753275]	ChrX:60814..55476165 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.22(chrX:60814-51821765)x1	copy number loss	not provided [RCV000753274]	ChrX:60814..51821765 [GRCh37] ChrX:Xp22.33-11.22	pathogenic
GRCh37/hg19 Xp11.23-q13.2(chrX:48115450-73424191)x1	copy number loss	not provided [RCV000753535]	ChrX:48115450..73424191 [GRCh37] ChrX:Xp11.23-q13.2	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155254881)x2	copy number gain	not provided [RCV000753277]	ChrX:60814..155254881 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x1	copy number loss	not provided [RCV000753271]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x3	copy number gain	not provided [RCV000753272]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:181779-155171702)x1	copy number loss	not provided [RCV000753278]	ChrX:181779..155171702 [GRCh37] ChrX:Xp22.33-q28	pathogenic
Single allele	duplication	Autism [RCV000754365]	ChrX:1..156040895 [GRCh38] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155236712)x2	copy number gain	not provided [RCV000753276]	ChrX:60814..155236712 [GRCh37] ChrX:Xp22.33-q28	pathogenic
NC_000023.10:g.36649710_136649711del100000002insG	indel	Heterotaxy, visceral, 1, X-linked [RCV000754886]	ChrX:36649710..136649711 [GRCh37] ChrX:Xp21.1-q26.3	pathogenic
46,Y,inv(X)(p21.1q13.3)	inversion	Elevated circulating creatine kinase concentration [RCV000856573]	ChrX:32196272..75245806 [GRCh37] ChrX:Xp21.1-q13.3	likely pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48224266-52744574)x2	copy number gain	not provided [RCV000847795]	ChrX:48224266..52744574 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp11.4-q21.32(chrX:40572613-92796528)x1	copy number loss	not provided [RCV000845670]	ChrX:40572613..92796528 [GRCh37] ChrX:Xp11.4-q21.32	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	not provided [RCV000848828]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q11.1(chrX:168546-61877279)x1	copy number loss	not provided [RCV000846273]	ChrX:168546..61877279 [GRCh37] ChrX:Xp22.33-q11.1	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	not provided [RCV000846039]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:200855-155240074)	copy number gain	Klinefelter syndrome [RCV003236730]	ChrX:200855..155240074 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:47179068-54424785)x2	copy number gain	not provided [RCV001537899]	ChrX:47179068..54424785 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:539722-55509385)x1	copy number loss	not provided [RCV001007224]	ChrX:539722..55509385 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48102202-52685635)x2	copy number gain	not provided [RCV001258953]	ChrX:48102202..52685635 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48178413-52686510)x2	copy number gain	not provided [RCV001258954]	ChrX:48178413..52686510 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp11.22(chrX:50849232-51106034)x1	copy number loss	not provided [RCV001258948]	ChrX:50849232..51106034 [GRCh37] ChrX:Xp11.22	uncertain significance
GRCh37/hg19 Xp22.33-11.21(chrX:219609-55466476)x1	copy number loss	See cases [RCV001263061]	ChrX:219609..55466476 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.22(chrX:168546-52573789)	copy number loss	Turner syndrome [RCV002280669]	ChrX:168546..52573789 [GRCh37] ChrX:Xp22.33-11.22	pathogenic
Single allele	complex	Turner syndrome [RCV002280670]	ChrX:590376..56315041 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-57841304)	copy number loss	Turner syndrome [RCV002280671]	ChrX:168546..57841304 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-56457794)x1	copy number loss	not provided [RCV001281358]	ChrX:168546..56457794 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60000-155234966)x1	copy number loss	not provided [RCV001537933]	ChrX:60000..155234966 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	not provided [RCV001834509]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x3	copy number gain	not provided [RCV001829212]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
NC_000023.10:g.(?_48368209)_(51241672_?)dup	duplication	Neurodegeneration with brain iron accumulation 5 [RCV004579591]\|SLC35A2-congenital disorder of glycosylation [RCV004579592]\|X-linked severe congenital neutropenia [RCV003111119]	ChrX:48368209..51241672 [GRCh37] ChrX:Xp11.23-11.22	uncertain significance
NC_000023.10:g.(?_48368209)_(51241672_?)del	deletion	not provided [RCV003116321]	ChrX:48368209..51241672 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:1-155270560)	copy number loss	Turner syndrome [RCV002280668]	ChrX:1..155270560 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:1-155270560)	copy number gain	46,XX sex reversal 1 [RCV002280665]\|Hypotonia [RCV002280667]\|Trisomy X syndrome [RCV002280666]	ChrX:1..155270560 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q28(chrX:11522765-155233731)x1	copy number loss	See cases [RCV002286357]	ChrX:11522765..155233731 [GRCh37] ChrX:Xp22.2-q28	pathogenic
Single allele	deletion	X-linked intellectual disability, Stocco dos Santos type [RCV002287906]	ChrX:49375617..52838206 [GRCh37] ChrX:Xp11.23-11.22	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:61545-155226048)x2	copy number gain	Klinefelter syndrome [RCV002282732]	ChrX:61545..155226048 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.4-11.22(chrX:39525562-52832596)x3	copy number gain	not provided [RCV002474503]	ChrX:39525562..52832596 [GRCh37] ChrX:Xp11.4-11.22	pathogenic
NM_001304963.2(NUDT10):c.154A>G (p.Met52Val)	single nucleotide variant	not specified [RCV004109871]	ChrX:51333119 [GRCh38] ChrX:51075971 [GRCh37] ChrX:Xp11.22	uncertain significance
NM_001304963.2(NUDT10):c.86G>A (p.Arg29His)	single nucleotide variant	not specified [RCV004228927]	ChrX:51333051 [GRCh38] ChrX:51075903 [GRCh37] ChrX:Xp11.22	uncertain significance
NM_001304963.2(NUDT10):c.274A>G (p.Arg92Gly)	single nucleotide variant	not specified [RCV004150188]	ChrX:51333239 [GRCh38] ChrX:51076091 [GRCh37] ChrX:Xp11.22	uncertain significance
NC_000023.10:g.(?_46466387)_(51241672_?)del	deletion	not provided [RCV003154905]	ChrX:46466387..51241672 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
GRCh37/hg19 Xp22.33-11.22(chrX:2696762-53113314)x1	copy number loss	not provided [RCV003483407]	ChrX:2696762..53113314 [GRCh37] ChrX:Xp22.33-11.22	pathogenic
GRCh37/hg19 Xp21.1-11.22(chrX:36355238-54106257)x1	copy number loss	not provided [RCV003483920]	ChrX:36355238..54106257 [GRCh37] ChrX:Xp21.1-11.22	pathogenic
GRCh37/hg19 Xp11.23-11.22(chrX:48224455-52832596)x3	copy number gain	not provided [RCV003485288]	ChrX:48224455..52832596 [GRCh37] ChrX:Xp11.23-11.22	pathogenic
NM_001304963.2(NUDT10):c.262G>C (p.Asp88His)	single nucleotide variant	not provided [RCV003438338]	ChrX:51333227 [GRCh38] ChrX:51076079 [GRCh37] ChrX:Xp11.22	likely benign
GRCh37/hg19 Xp22.33-11.1(chrX:168546-58364114)	copy number loss	not specified [RCV003986240]	ChrX:168546..58364114 [GRCh37] ChrX:Xp22.33-11.1	pathogenic
GRCh37/hg19 Xp22.33-11.21(chrX:168546-55653170)	copy number loss	not specified [RCV003986200]	ChrX:168546..55653170 [GRCh37] ChrX:Xp22.33-11.21	pathogenic
NM_001304963.2(NUDT10):c.25C>G (p.Arg9Gly)	single nucleotide variant	not specified [RCV004496150]	ChrX:51332990 [GRCh38] ChrX:51075842 [GRCh37] ChrX:Xp11.22	uncertain significance
NC_000023.10:g.(?_46466387)_(51241672_?)dup	duplication	Epilepsy, X-linked 1, with variable learning disabilities and behavior disorders [RCV004580271]	ChrX:46466387..51241672 [GRCh37] ChrX:Xp11.23-11.22	uncertain significance
GRCh38/hg38 Xp22.33-q28(chrX:2757837-156030895)x2	copy number gain	Klinefelter syndrome [RCV004579655]	ChrX:2757837..156030895 [GRCh38] ChrX:Xp22.33-q28	pathogenic
NM_001304963.2(NUDT10):c.154A>C (p.Met52Leu)	single nucleotide variant	not specified [RCV004652628]	ChrX:51333119 [GRCh38] ChrX:51075971 [GRCh37] ChrX:Xp11.22	uncertain significance
NM_001304963.2(NUDT10):c.244G>A (p.Val82Ile)	single nucleotide variant	not specified [RCV004840692]	ChrX:51333209 [GRCh38] ChrX:51076061 [GRCh37] ChrX:Xp11.22	likely benign

Predicted Target Of

	Summary Value
Count of predictions:	794
Count of miRNA genes:	338
Interacting mature miRNAs:	359
Transcripts:	ENST00000356450, ENST00000376006
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

WI-13729

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	51,080,223 - 51,080,356	UniSTS	GRCh37
Build 36	X	51,096,963 - 51,097,096	RGD	NCBI36
Celera	X	55,124,048 - 55,124,181	RGD
Cytogenetic Map	X	p11.23	UniSTS
HuRef	X	48,521,588 - 48,521,721	UniSTS
Whitehead-RH Map	X	66.5	UniSTS

SHGC-24010

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	51,080,254 - 51,080,356	UniSTS	GRCh37
Build 36	X	51,096,994 - 51,097,096	RGD	NCBI36
Celera	X	55,124,079 - 55,124,181	RGD
Cytogenetic Map	X	p11.23	UniSTS
HuRef	X	48,521,619 - 48,521,721	UniSTS
Stanford-G3 RH Map	X	2083.0	UniSTS
NCBI RH Map	X	259.8	UniSTS
GeneMap99-G3 RH Map	X	1296.0	UniSTS

DXS7057

Human Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	X	p11.23	UniSTS
HuRef	X	48,520,308 - 48,520,485	UniSTS

NUDT11

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	51,238,957 - 51,239,197	UniSTS	GRCh37
GRCh37	X	51,075,917 - 51,076,157	UniSTS	GRCh37
Celera	X	55,282,791 - 55,283,031	UniSTS
Celera	X	55,119,743 - 55,119,983	UniSTS
HuRef	X	48,680,492 - 48,680,732	UniSTS
HuRef	X	48,517,305 - 48,517,545	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1201	2319	2662	2231	4931	1652	2161	4	556	1257	398	2241	6272	5753	48	3719	792	1688	1494	171	1


RefSeq Transcripts	NM_001304963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_153183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC233976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF469196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK291952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL158055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC049383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC050700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX449265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CN399689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000356450 ⟹ ENSP00000348831

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	51,332,822 - 51,337,525 (+)	Ensembl

Ensembl Acc Id:

ENST00000376006 ⟹ ENSP00000365174

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	X	51,332,231 - 51,337,525 (+)	Ensembl

RefSeq Acc Id:

NM_001304963 ⟹ NP_001291892

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	51,332,822 - 51,337,525 (+)	NCBI
CHM1_1	X	51,155,566 - 51,160,299 (+)	NCBI
T2T-CHM13v2.0	X	50,604,106 - 50,608,810 (+)	NCBI

Sequence:

show sequence

AGACGGCAGACGGAGGCGCCTCTCTCTCCCCGCCCCTCTCCTCGGCCCTTTCTCTTCCCAGCACCTCGGCTGCTGCCCGGCAGCGGCAGCAGCTGCGTCGGCGGCCCACACAGCAGCGAGAGGCGAGA
GGAGGCTGCCTCGAGGATGAAGTGCAAACCCAACCAGACACGGACCTACGACCCCGAGGGGTTCAAGAAGCGGGCGGCGTGCCTGTGCTTCCGGAGCGAGCGCGAGGACGAGGTCCTGTTAGTGAGTA
GCAGCCGGTACCCGGACCGCTGGATCGTGCCGGGCGGGGGCATGGAGCCCGAGGAGGAGCCGGGCGGTGCGGCGGTCCGAGAGGTGTACGAAGAGGCGGGAGTCAAGGGGAAGTTAGGCCGGCTCCTG
GGCGTCTTCGAACAGAACCAGGACCCCAAGCACAGAACGTACGTGTATGTACTGACTGTCACGGAGCTGCTGGAGGATTGGGAAGATTCGGTTAGCATTGGGAGGAAGCGAGAGTGGTTCAAAGTCGA
AGATGCCATCAAGGTTCTCCAGTGCCACAAGCCCGTGCACGCCGAATATCTGGAGAAACTAAAGCTGGGCGGTTCCCCAACCAATGGAAACTCCATGGCCCCATCCTCGCCAGATAGCGATCCCTAGT
GAATGGCATAGATGTTGTTCAGATTTACTTTGAAAGAATCAAGTATGTGAATGGATGGATGAATGGAATTGTGAAGCACAGATGAGCTCTTTCACACTCCAAGGACACAGCTCATCCTATGCTTTTGG
ACACTTCTTCCCTGTTTATTACAATGACTATTCTCCAGGTTGTTGCACTACCGCTGTATCTGTACATAATTCTAACTTGGCACCTGTGGCCTTTTTTGTGCTCTTATGTGTCTGTATTTCCCGGCAGA
GTATACGCCCTTGAATGCCAGGAACTTGTTTCCTTAGTCTTTTTTATATATCTAGCATATAAGATATTGCTTAGAATATGGTAGACATCACTGAAGATTTGTTTCAGTAGTTCATATTTTGTAATGAT
ACTGAATGGTTAAACAATCCCTTTCTAATCTGTCTAGCATATATGTGACTTTTGTTTATCAAGTGTCACACAACTGCTTCAAGGCAGCTGTGAGATACTAGAAAGCAAAAATTCTTACTCCTATGTCT
GTGTCATCCCAGATGTGTGCCTCCAGATGGCAGTATACTACACTATCTGTAAAATATATTTGCAAAGCCAGGCACAGTGTTACGCGTCTGCCTCAGGAGGCTGAGGCAGAAGAATAGCTTGAGCCCAG
GAGCTTTAGTCTAGCCTGAGCAATATAATGAGACTCCGTCTCTTAAAATATTTGCCCAAACATTGAACCTAAATTTGACCATGCCCCTAGAAATAATTCCTAATCTTTAGAAAATAGGGCAGAGAAAC
ATTATTTTACACCATGGAGATGAGATCAGCAGAATCCAGACTATAAGAAACTACAGGACACATGACCTAGTTTCTTCTGTAAATAACTTGCAAGGATGAAAGATGGAGGATGAACCTATAGATTTAAA
GAGACTTAAGAGACATATTAACCAATTGTTAATTGGATCTTATTTGAATTGTGATTTGACCGAACTGTAAAACGAATACATTTATGAGACAATCGGGGTAATTTGAACATTGGTGGGGTATTTGGTAT
TAGAATAATGGTTTTATCATTATGTTAGAAAGAAGGGTCCTCATCTACATTCTCAAACATCTGTGGCTGATATGATATGATTCTTGGAATTTGCTTCAAAATAATAAGTCTGGATGTTAAGTGCATTG
GAAATATTGATGAAACGAAATTGGCCTTGATAATTGTTGAAGCTGGGTGATGGCTAAAATGATGGTTCATTATATATGTTCATCTCTATTTTTGTATGTTTGGCATTTTCCGTAATAAAGTTTATAAA
AATAA

hide sequence

RefSeq Acc Id:

NM_153183 ⟹ NP_694853

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	51,332,231 - 51,337,525 (+)	NCBI
GRCh37	X	51,075,083 - 51,080,377 (+)	RGD
Build 36	X	51,091,823 - 51,097,117 (+)	NCBI Archive
Celera	X	55,118,909 - 55,124,202 (+)	RGD
HuRef	X	48,516,471 - 48,521,742 (+)	ENTREZGENE
CHM1_1	X	51,154,988 - 51,160,299 (+)	NCBI
T2T-CHM13v2.0	X	50,603,515 - 50,608,810 (+)	NCBI

Sequence:

show sequence

TGAGTAAGCCAGAATGGTTGATAGTGGGGGAGGATGATGACGACGCTGCCTTTGCCCCTGTCTT
GTGTGAAACAACTGCCTGTGGGTTTCCTGCAGCGCAGTGGGGAGTGAGAGGAGAAACGTCCTGCCGTGCCACACACCTCGGCTGCTGCCCGGCAGCGGCAGCAGCTGCGTCGGCGGCCCACACAGCAG
CGAGAGGCGAGAGGAGGCTGCCTCGAGGATGAAGTGCAAACCCAACCAGACACGGACCTACGACCCCGAGGGGTTCAAGAAGCGGGCGGCGTGCCTGTGCTTCCGGAGCGAGCGCGAGGACGAGGTCC
TGTTAGTGAGTAGCAGCCGGTACCCGGACCGCTGGATCGTGCCGGGCGGGGGCATGGAGCCCGAGGAGGAGCCGGGCGGTGCGGCGGTCCGAGAGGTGTACGAAGAGGCGGGAGTCAAGGGGAAGTTA
GGCCGGCTCCTGGGCGTCTTCGAACAGAACCAGGACCCCAAGCACAGAACGTACGTGTATGTACTGACTGTCACGGAGCTGCTGGAGGATTGGGAAGATTCGGTTAGCATTGGGAGGAAGCGAGAGTG
GTTCAAAGTCGAAGATGCCATCAAGGTTCTCCAGTGCCACAAGCCCGTGCACGCCGAATATCTGGAGAAACTAAAGCTGGGCGGTTCCCCAACCAATGGAAACTCCATGGCCCCATCCTCGCCAGATA
GCGATCCCTAGTGAATGGCATAGATGTTGTTCAGATTTACTTTGAAAGAATCAAGTATGTGAATGGATGGATGAATGGAATTGTGAAGCACAGATGAGCTCTTTCACACTCCAAGGACACAGCTCATC
CTATGCTTTTGGACACTTCTTCCCTGTTTATTACAATGACTATTCTCCAGGTTGTTGCACTACCGCTGTATCTGTACATAATTCTAACTTGGCACCTGTGGCCTTTTTTGTGCTCTTATGTGTCTGTA
TTTCCCGGCAGAGTATACGCCCTTGAATGCCAGGAACTTGTTTCCTTAGTCTTTTTTATATATCTAGCATATAAGATATTGCTTAGAATATGGTAGACATCACTGAAGATTTGTTTCAGTAGTTCATA
TTTTGTAATGATACTGAATGGTTAAACAATCCCTTTCTAATCTGTCTAGCATATATGTGACTTTTGTTTATCAAGTGTCACACAACTGCTTCAAGGCAGCTGTGAGATACTAGAAAGCAAAAATTCTT
ACTCCTATGTCTGTGTCATCCCAGATGTGTGCCTCCAGATGGCAGTATACTACACTATCTGTAAAATATATTTGCAAAGCCAGGCACAGTGTTACGCGTCTGCCTCAGGAGGCTGAGGCAGAAGAATA
GCTTGAGCCCAGGAGCTTTAGTCTAGCCTGAGCAATATAATGAGACTCCGTCTCTTAAAATATTTGCCCAAACATTGAACCTAAATTTGACCATGCCCCTAGAAATAATTCCTAATCTTTAGAAAATA
GGGCAGAGAAACATTATTTTACACCATGGAGATGAGATCAGCAGAATCCAGACTATAAGAAACTACAGGACACATGACCTAGTTTCTTCTGTAAATAACTTGCAAGGATGAAAGATGGAGGATGAACC
TATAGATTTAAAGAGACTTAAGAGACATATTAACCAATTGTTAATTGGATCTTATTTGAATTGTGATTTGACCGAACTGTAAAACGAATACATTTATGAGACAATCGGGGTAATTTGAACATTGGTGG
GGTATTTGGTATTAGAATAATGGTTTTATCATTATGTTAGAAAGAAGGGTCCTCATCTACATTCTCAAACATCTGTGGCTGATATGATATGATTCTTGGAATTTGCTTCAAAATAATAAGTCTGGATG
TTAAGTGCATTGGAAATATTGATGAAACGAAATTGGCCTTGATAATTGTTGAAGCTGGGTGATGGCTAAAATGATGGTTCATTATATATGTTCATCTCTATTTTTGTATGTTTGGCATTTTCCGTAAT
AAAGTTTATAAAAATAA

hide sequence


Protein RefSeqs	NP_001291892	(Get FASTA)	NCBI Sequence Viewer
	NP_694853	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH49383	(Get FASTA)	NCBI Sequence Viewer
	AAH50700	(Get FASTA)	NCBI Sequence Viewer
	AAM64113	(Get FASTA)	NCBI Sequence Viewer
	BAF84641	(Get FASTA)	NCBI Sequence Viewer
	EAW89910	(Get FASTA)	NCBI Sequence Viewer
	EAW89911	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000348831
	ENSP00000348831.2
	ENSP00000365174
	ENSP00000365174.3
GenBank Protein	Q8NFP7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_694853 ⟸ NM_153183
- UniProtKB:	Q86VK1 (UniProtKB/Swiss-Prot), D3DX69 (UniProtKB/Swiss-Prot), A8K7D7 (UniProtKB/Swiss-Prot), Q86VR0 (UniProtKB/Swiss-Prot), Q8NFP7 (UniProtKB/Swiss-Prot), B2RE29 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKV LQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP hide sequence

RefSeq Acc Id:	NP_001291892 ⟸ NM_001304963
- UniProtKB:	Q86VK1 (UniProtKB/Swiss-Prot), D3DX69 (UniProtKB/Swiss-Prot), A8K7D7 (UniProtKB/Swiss-Prot), Q86VR0 (UniProtKB/Swiss-Prot), Q8NFP7 (UniProtKB/Swiss-Prot), B2RE29 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVR EVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP hide sequence

Ensembl Acc Id:

ENSP00000365174 ⟸ ENST00000376006

Ensembl Acc Id:

ENSP00000348831 ⟸ ENST00000356450

Protein Domains

Nudix hydrolase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8NFP7-F1-model_v2	AlphaFold	Q8NFP7	1-164	view protein structure

RGD ID:

13605328

Promoter ID:

EPDNEW_H28848

Type:

initiation region

Name:

NUDT10_1

Description:

nudix hydrolase 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	51,332,822 - 51,332,882	EPDNEW

Database	Acc Id	Source(s)
COSMIC	NUDT10	COSMIC
Ensembl Genes	ENSG00000122824	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000356450	ENTREZGENE
	ENST00000356450.3	UniProtKB/Swiss-Prot
	ENST00000376006	ENTREZGENE
	ENST00000376006.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Nucleoside Triphosphate Pyrophosphohydrolase	UniProtKB/Swiss-Prot
GTEx	ENSG00000122824	GTEx
HGNC ID	HGNC:17621	ENTREZGENE
Human Proteome Map	NUDT10	Human Proteome Map
InterPro	DDP-like_NUDIX	UniProtKB/Swiss-Prot
	NUDIX_hydrolase-like_dom_sf	UniProtKB/Swiss-Prot
	NUDIX_hydrolase_CS	UniProtKB/Swiss-Prot
	NUDIX_hydrolase_dom	UniProtKB/Swiss-Prot
KEGG Report	hsa:170685	UniProtKB/Swiss-Prot
NCBI Gene	170685	ENTREZGENE
OMIM	300527	OMIM
PANTHER	DIPHOSPHOINOSITOL POLYPHOSPHATE PHOSPHOHYDROLASE	UniProtKB/Swiss-Prot
	DIPHOSPHOINOSITOL POLYPHOSPHATE PHOSPHOHYDROLASE 3-ALPHA	UniProtKB/Swiss-Prot
Pfam	NUDIX	UniProtKB/Swiss-Prot
PharmGKB	PA31831	PharmGKB
PROSITE	NUDIX	UniProtKB/Swiss-Prot
	NUDIX_BOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55811	UniProtKB/Swiss-Prot
UniProt	A8K7D7	ENTREZGENE
	B2RE29	ENTREZGENE, UniProtKB/TrEMBL
	D3DX69	ENTREZGENE
	NUD10_HUMAN	UniProtKB/Swiss-Prot
	Q86VK1	ENTREZGENE
	Q86VR0	ENTREZGENE
	Q8NFP7	ENTREZGENE
UniProt Secondary	A8K7D7	UniProtKB/Swiss-Prot
	D3DX69	UniProtKB/Swiss-Prot
	Q86VK1	UniProtKB/Swiss-Prot
	Q86VR0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-24	NUDT10	nudix hydrolase 10	NUDT10	nudix (nucleoside diphosphate linked moiety X)-type motif 10	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar