Rplp0 (ribosomal protein lateral stalk subunit P0)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rplp0 (ribosomal protein lateral stalk subunit P0) Rattus norvegicus

Analyze

Symbol:

Rplp0

Name:

ribosomal protein lateral stalk subunit P0

RGD ID:

621247

Description:

Exhibits peptide binding activity. Involved in several processes, including cellular response to organonitrogen compound; cellular response to phorbol 13-acetate 12-myristate; and lactation. Localizes to membrane and synapse. Biomarker of Down syndrome. Orthologous to human RPLP0 (ribosomal protein lateral stalk subunit P0); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

60S acidic ribosomal protein P0; 60S ribosomal protein L10E; acidic ribosomal phosphoprotein P0; acidic ribosomal protein P0; Arbp; L10E; ribosomal protein, large, P0

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

Rnor_6.0 - RGSC Genome Assembly v6.0

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	41,054,363 - 41,057,632 (-)	NCBI
Rnor_6.0 Ensembl	12	46,791,528 - 46,794,797 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	12	46,791,528 - 46,794,797 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	12	48,588,974 - 48,592,243 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,315,766 - 42,318,732 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	12	42,179,153 - 42,182,120 (-)	NCBI
Celera	12	42,677,808 - 42,681,077 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Down syndrome (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2-acetamidofluorene (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3'-diindolylmethane (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

alpha-hexachlorocyclohexane (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP,ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

bufalin (ISO)

C60 fullerene (EXP)

captan (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chromium trinitrate (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

disodium selenite (ISO)

enzyme inhibitor (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

geldanamycin (ISO)

gentamycin (EXP)

glafenine (EXP)

indometacin (ISO)

lovastatin (ISO)

miconazole (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

naphthalene (ISO)

nickel atom (ISO)

nickel subsulfide (EXP)

nimesulide (EXP)

nitric oxide (ISO)

paracetamol (EXP,ISO)

PhIP (EXP)

potassium chromate (ISO)

Propiverine (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP)

silicon dioxide (ISO)

sodium dichromate (ISO)

Soman (EXP)

tanespimycin (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

troglitazone (ISO)

tungsten (ISO)

warfarin (ISO)

zileuton (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to cAMP (IEP)

cellular response to interleukin-4 (ISO)

cellular response to phorbol 13-acetate 12-myristate (IEP)

cellular response to Thyroid stimulating hormone (IEP)

cytoplasmic translation (IBA)

lactation (IEP)

response to selenium ion (IEP)

ribosomal large subunit assembly (IBA)

Cellular Component

cytoplasm (ISO,ISS)

cytoplasmic ribonucleoprotein granule (ISO)

cytosol (ISO)

cytosolic large ribosomal subunit (IBA,ISO)

cytosolic ribosome (ISO)

dendrite (ISO)

endoplasmic reticulum (ISO)

membrane (IDA)

nucleus (ISO,ISS)

postsynapse (ISO)

postsynaptic density (ISO)

ribonucleoprotein complex (ISO,ISS)

synapse (EXP,IDA)

Molecular Function

large ribosomal subunit rRNA binding (IBA)

peptide binding (IDA)

protein binding (ISO)

structural constituent of ribosome (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated


1.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Ikeda M, etal., Endocrinology. 1991 May;128(5):2540-7.
4.	Ishihara K, etal., Neuroscience. 2014 Sep 28;281C:1-15. doi: 10.1016/j.neuroscience.2014.09.039.
5.	Lan X, etal., Exp Biol Med (Maywood). 2015 Feb;240(2):235-41. doi: 10.1177/1535370214554531. Epub 2014 Oct 6.
6.	Lee NK, etal., Peptides. 2010 Dec;31(12):2247-54. doi: 10.1016/j.peptides.2010.09.008. Epub 2010 Sep 21.
7.	Li KW, etal., J Biol Chem. 2004 Jan 9;279(2):987-1002. doi: 10.1074/jbc.M303116200. Epub 2003 Oct 7.
8.	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	RGD automated data pipeline
10.	RGD automated import pipeline for gene-chemical interactions
11.	RGD comprehensive gene curation
12.	Saito T, etal., Biochem Biophys Res Commun. 1994 Sep 15;203(2):780-8.
13.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	Usami M, etal., Birth Defects Res B Dev Reprod Toxicol. 2008 Apr;83(2):80-96. doi: 10.1002/bdrb.20145.
15.	Wool IG, etal., Biochimie 1991 Jul-Aug;73(7-8):861-70.

Additional References at PubMed

PMID:3323886	PMID:9798653	PMID:12962325	PMID:15121898	PMID:15303970	PMID:15489334	PMID:16396499	PMID:17289661	PMID:19188445	PMID:19946888	PMID:20458337	PMID:21170055
PMID:21257285	PMID:21423176	PMID:21700703	PMID:22022532	PMID:22658674	PMID:22681889	PMID:22720776	PMID:23071613	PMID:23106098	PMID:23376485	PMID:24625528	PMID:29476059
PMID:30053369

Genomics

Comparative Map Data

Rplp0
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	41,054,363 - 41,057,632 (-)	NCBI
Rnor_6.0 Ensembl	12	46,791,528 - 46,794,797 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	12	46,791,528 - 46,794,797 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	12	48,588,974 - 48,592,243 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,315,766 - 42,318,732 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	12	42,179,153 - 42,182,120 (-)	NCBI
Celera	12	42,677,808 - 42,681,077 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

RPLP0
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	12	120,196,699 - 120,201,235 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	12	120,196,699 - 120,201,111 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	12	120,634,502 - 120,638,914 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,118,886 - 119,123,397 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	12	119,097,222 - 119,101,734	NCBI
Celera	12	120,267,618 - 120,272,129 (-)	NCBI
Cytogenetic Map	12	q24.23	NCBI
HuRef	12	117,643,050 - 117,647,561 (-)	NCBI		HuRef
CHM1_1	12	120,602,510 - 120,607,021 (-)	NCBI		CHM1_1

Rplp0
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,697,526 - 115,701,788 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	5	115,697,526 - 115,701,786 (+)	Ensembl
GRCm38	5	115,559,467 - 115,563,729 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,559,467 - 115,563,727 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	116,009,476 - 116,013,738 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	5	115,820,514 - 115,824,726 (+)	NCBI			mm8
Celera	5	112,664,588 - 112,668,879 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI

Rplp0
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955455	11,404,898 - 11,409,262 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPLP0
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	121,146,882 - 121,151,388 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,146,882 - 121,151,388 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	117,771,887 - 117,776,391 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

RPLP0
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,148,463 - 16,154,048 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	16,148,460 - 16,153,614 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,153,039 - 16,158,180 (-)	NCBI
ROS_Cfam_1.0	26	16,416,181 - 16,421,685 (-)	NCBI
UMICH_Zoey_3.1	26	16,377,241 - 16,382,371 (-)	NCBI
UNSW_CanFamBas_1.0	26	16,454,118 - 16,459,286 (-)	NCBI
UU_Cfam_GSD_1.0	26	16,495,325 - 16,500,476 (-)	NCBI

Rplp0
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	146,213,496 - 146,217,945 (+)	NCBI
SpeTri2.0	NW_004936668	712,402 - 716,839 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPLP0
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,219,124 - 40,223,967 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	40,219,196 - 40,223,943 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	120,957,731 - 120,959,417 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	14	q22-24	NCBI

RPLP0
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	115,547,430 - 115,552,242 (-)	NCBI
ChlSab1.1 Ensembl	11	115,547,427 - 115,550,209 (-)	Ensembl

Rplp0
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624747	13,439,791 - 13,444,574 (+)	NCBI

QTLs in Region (Rnor_6.0)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2475687	47475687	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	2513442	47513442	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	2513442	47513442	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	4210051	49210051	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	9223626	52716770	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	9223626	52716770	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	9223626	52716770	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	9223626	52716770	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	9223626	52716770	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	9223626	52716770	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	9223630	52716770	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	9789834	52716770	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	13127211	50320041	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	14419775	52716770	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15021986	52716770	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	15908900	52716770	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	15908900	52716770	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18342477	52716770	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18342477	52716770	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	18729043	52716770	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	18752593	52716770	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	18752593	52716770	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	22650702	48598906	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	22650702	52716770	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24906590	52716770	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	26098845	52716770	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	29113609	49560679	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	29113609	50757185	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	31723565	47433663	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	31723565	51955754	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	31723565	52716770	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37521884	51955754	Rat

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	49
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000001518
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	9	28	41	22	18	22	1	2	51	20	34	8	1
Medium		15	27	19	1	19	7	9	23	15	7	3	7
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP465362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN931898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210412	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220213	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234863	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z29530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000001518 ⟹ ENSRNOP00000001518

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	46,791,528 - 46,794,797 (-)	Ensembl

RefSeq Acc Id:

NM_022402 ⟹ NP_071797

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	41,054,363 - 41,057,632 (-)	NCBI
Rnor_6.0	12	46,791,528 - 46,794,797 (-)	NCBI
Rnor_5.0	12	48,588,974 - 48,592,243 (-)	NCBI
RGSC_v3.4	12	42,315,766 - 42,318,732 (-)	RGD
Celera	12	42,677,808 - 42,681,077 (-)	NCBI

Sequence:

show sequence

CTCTCGCCAGGCGTCCTCATTAGAGTGACATCGTCTTTAAACCCCGCGTGGCAATCCCTGACGC
ACCGCCGTGATGCCCAGGGAAGACAGGGCGACCTGGAAGTCCAACTACTTCCTTAAGATCATCC
AACTTTTGGATGACTACCCAAAATGCTTCATTGTGGGAGCAGACAATGTGGGCTCCAAGCAGAT
GCAGCAGATCCGCATGTCCCTCCGCGGGAAGGCTGTGGTGCTGATGGGCAAGAACACCATGATG
CGCAAGGCCATCCGGGGCCACCTGGAGAACAACCCCGCTCTGGAGAAGCTGCTGCCTCACATCC
GGGGGAACGTGGGCTTTGTGTTCACCAAGGAGGACCTCACCGAGATTAGGGACATGCTGCTGGC
CAATAAGGTGCCAGCTGCTGCCCGAGCCGGTGCCATCGCCCCGTGTGAGGTCACAGTACCTGCT
CAGAACACCGGTCTGGGGCCCGAGAAGACCTCTTTCTTCCAAGCTTTGGGCATCACCACTAAAA
TCTCCAGAGGTACCATTGAAATCCTGAGCGATGTGCAGCTGATAAAGACTGGAGACAAGGTGGG
AGCCAGCGAAGCCACACTGCTGAACATGTTGAACATCTCCCCCTTCTCCTTCGGGCTGATCATC
CAGCAGGTGTTTGACAATGGCAGCATCTACAGCCCAGAGGTGCTGGACATCACAGAGCAGGCCC
TGCACACTCGCTTCCTAGAGGGTGTCCGCAATGTGGCCAGCGTCTGTCTGCAGATTGGCTACCC
GACTGTTGCCTCAGTGCCTCACTCCATCATCAATGGATACAAAAGGGTCCTGGCTTTGTCTGTG
GAGACTGACTACACCTTCCCACTGGCTGAAAAGGTCAAGGCCTTCCTGGCCGATCCATCTGCAT
TTGCGGCTGCGGCCCCTGTGGCTGCTGCCACCACTGCTGCTCCTGCAGCTGCTGCTGCCCCAGC
CAAGGTCGAAGCAAAGGAAGAGTCGGAGGAATCCGATGAGGACATGGGATTCGGTCTCTTCGAC
TAAGCCCCTCACACCAAGTCAGCCTGCTTAATTTGAGAAAGATGGAAATAAAGGCTTACTTCTC
TTAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071797	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH62028	(Get FASTA)	NCBI Sequence Viewer
	CAA82647	(Get FASTA)	NCBI Sequence Viewer
	EDM13873	(Get FASTA)	NCBI Sequence Viewer
	P19945	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_071797 ⟸ NM_022402

- UniProtKB:

P19945 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKA
IRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNT
GLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQV
FDNGSIYSPEVLDITEQALHTRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETD
YTFPLAEKVKAFLADPSAFAAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD

hide sequence

RefSeq Acc Id:

ENSRNOP00000001518 ⟸ ENSRNOT00000001518

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698686

Promoter ID:

EPDNEW_R9211

Type:

single initiation site

Name:

Rplp0_1

Description:

ribosomal protein lateral stalk subunit P0

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	46,794,797 - 46,794,857	EPDNEW

Strain Variation

Strain Sequence Variants (Rnor 6.0)

ACI/EurMcwi (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

ACI/EurMcwi (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

ACI/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

BBDP/Wor (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

BN/SsN (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

Buf/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

COP/CrCrl (MCW & UW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob) University of Wisconsin (Dr. James Shull)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Charles River Laboratories
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob) and UW Madison (Dr. James Shull)

F344/NCrl (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

F344/NRrrc (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

FHH/EurMcwi (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

FHH/EurMcwi (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

FHL/EurMcwi (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

FHL/EurMcwi (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

GH/OmrMcwi (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

GK/Ox (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LE/Stm (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LEW/Crl (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LEW/NCrlBR (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LH/MavRrrc (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LL/MavRrrc (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

LN/MavRrrc (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

M520/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

MHS/Gib (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

MNS/Gib (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

MR/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

SBH/Ygl (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	SBH/Ygl sequenced by MCW

SBH/Ygl (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SBN/Ygl (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	SBN/Ygl sequenced by MCW

SBN/Ygl (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SHR/NHsd (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SHRSP/Gcrc (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SR/JrHsd (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Harlan Laboratories
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

SR/JrHsd (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SS/Jr (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

SS/JrHsdMcwi (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Medical College of Wisconsin (Dr. Howard Jacob)
Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA v0.7.7 and GATK v3.2-2
Breeder:	Medical College of Wisconsin
Description:	Provided by the Medical College of Wisconsin (Dr. Howard Jacob)

SS/JrHsdMcwi (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

WAG/Rij (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

WKY/Gcrc (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

WKY/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

WKY/NCrl (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

WKY/NHsd (RGD)

Visual

CSV

TAB

Printer

Platform:	Illumina HiSeq 2000
Secondary Analysis:	BWA mem 0.7.15, GATK v.3.6-0
Description:	Sequences from Atanur et al and Hermsen et al realigned to the Rnor 6.0 assembly and reanalyzed by RGD

WN/N (MCW)

Visual

CSV

TAB

Printer

Sequenced By:	Royal Netherland Academy of Arts and Sciences (Dr. Edwin Cuppen) Max Delbruck Center for Molecular Medicine (Dr. Norbert Huebner)
Platform:	SOLiD 4 and 5500
Secondary Analysis:	liftOver (Batch Coordinate Conversion)--genome.ucsc.edu
Breeder:	National Institutes of Health
Description:	Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin

Damaging Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain
12	46793535	46793536	C	T	snv	Buf/N (MCW)
12	46793573	46793574	A	G	snv	Buf/N (MCW)

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain
12	42317770	42317771	C	T	snv	BUF/N (KNAW)
12	42317808	42317809	A	G	snv	BUF/N (KNAW)

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621247	AgrOrtholog
Ensembl Genes	ENSRNOG00000001148	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000001518	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001518	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.70.1730	UniProtKB/Swiss-Prot
	3.90.105.20	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5623881	IMAGE-MGC_LOAD
InterPro	L10E_eukaryotes	UniProtKB/Swiss-Prot
	Ribosomal_L10-like_sf	UniProtKB/Swiss-Prot
	Ribosomal_L10P	UniProtKB/Swiss-Prot
	RL10_insert_sf	UniProtKB/Swiss-Prot
	RL10P_insert	UniProtKB/Swiss-Prot
KEGG Report	rno:64205	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72448	IMAGE-MGC_LOAD
NCBI Gene	64205	ENTREZGENE
Pfam	Ribosomal_L10	UniProtKB/Swiss-Prot
	RL10P_insert	UniProtKB/Swiss-Prot
PhenoGen	Rplp0	PhenoGen
PIRSF	L10E	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF160369	UniProtKB/Swiss-Prot
UniProt	P19945	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Rplp0	ribosomal protein lateral stalk subunit P0	Rplp0	ribosomal protein, large, P0	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-20	Rplp0	ribosomal protein, large, P0	Arbp	acidic ribosomal phosphoprotein P0	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Arbp	acidic ribosomal phosphoprotein P0		acidic ribosomal protein P0	Name updated	1299863	APPROVED
2002-08-07	Arbp	acidic ribosomal protein P0			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	predicted protein is 34.18 kDa	631930

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations