Symbol:
Akap1
Name:
A-kinase anchoring protein 1
RGD ID:
620826
Description:
Enables several functions, including enzyme binding activity; protein kinase A regulatory subunit binding activity; and tubulin binding activity. Involved in several processes, including cellular response to cAMP; negative regulation of cell growth involved in cardiac muscle cell development; and negative regulation of protein import into nucleus. Located in lipid droplet; mitochondrial crista; and postsynaptic membrane. Is active in neuromuscular junction and postsynaptic specialization, intracellular component. Biomarker of brain ischemia. Orthologous to human AKAP1 (A-kinase anchoring protein 1); PARTICIPATES IN protein kinase A (PKA) signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
A kinase (PRKA) anchor protein 1; a kinase anchor protein 1, mitochondrial; A-kinase anchor protein 1, mitochondrial; A-kinase anchor protein 121 kDa; AKAP 121; Akap84; D-AKAP-1; dual specificity A-kinase-anchoring protein 1; PRKA1; protein kinase A-anchoring protein 1; S-AKAP84; spermatid A-kinase anchor protein 84
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bmd4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 74,118,232 - 74,151,366 (-) NCBI GRCr8 mRatBN7.2 10 73,621,021 - 73,654,123 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 73,621,883 - 73,653,896 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 78,236,555 - 78,250,887 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 77,741,478 - 77,755,810 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 73,204,658 - 73,218,993 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 76,151,013 - 76,183,987 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 76,151,038 - 76,166,276 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 73,927,523 - 73,960,524 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 77,262,592 - 77,276,832 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 77,276,968 - 77,291,202 (-) NCBI Celera 10 72,528,421 - 72,542,825 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akap1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AKAP1 mRNA] CTD PMID:31150632 Akap1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:731357 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AKAP1 mRNA CTD PMID:36331819 Akap1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:731357 6480464 1,2-Dimethylhydrazine results in increased expression of AKAP1 mRNA CTD PMID:22206623 Akap1 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO RGD:1343676 6480464 14-deoxy-11,12-didehydroandrographolide results in decreased expression of AKAP1 mRNA CTD PMID:22101062 Akap1 Rat 17beta-estradiol affects expression ISO RGD:1343676 6480464 Estradiol affects the expression of AKAP1 mRNA CTD PMID:14699072|PMID:22574217 Akap1 Rat 17beta-estradiol increases expression ISO RGD:1343676 6480464 Estradiol results in increased expression of AKAP1 mRNA CTD PMID:31614463 Akap1 Rat 17beta-estradiol increases expression ISO RGD:731357 6480464 Estradiol results in increased expression of AKAP1 mRNA CTD PMID:39298647 Akap1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of AKAP1 mRNA CTD PMID:32145629 Akap1 Rat 17beta-estradiol decreases expression ISO RGD:1343676 6480464 Estradiol results in decreased expression of AKAP1 mRNA CTD PMID:31646340 Akap1 Rat 17beta-estradiol multiple interactions ISO RGD:1343676 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of AKAP1 mRNA; Estradiol inhibits more ... CTD PMID:20404318|PMID:31646340 Akap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:731357 6480464 Tetrachlorodibenzodioxin results in increased expression of AKAP1 mRNA CTD PMID:19933214 Akap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AKAP1 mRNA CTD PMID:34747641 Akap1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:731357 6480464 Tetrachlorodibenzodioxin affects the expression of AKAP1 mRNA CTD PMID:21570461 Akap1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKAP1 mRNA CTD PMID:21215274|PMID:33387578 Akap1 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO RGD:1343676 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in decreased expression of AKAP1 protein CTD PMID:32044396 Akap1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of AKAP1 mRNA CTD PMID:28522335 Akap1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:731357 6480464 bisphenol S results in decreased expression of AKAP1 mRNA CTD PMID:39298647 Akap1 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:731357 6480464 bisphenol S affects the methylation of AKAP1 gene CTD PMID:31683443 Akap1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:731357 6480464 Fenretinide results in increased expression of AKAP1 mRNA CTD PMID:28973697 Akap1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of AKAP1 mRNA CTD PMID:30047161 Akap1 Rat acrolein multiple interactions ISO RGD:1343676 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Akap1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of AKAP1 mRNA CTD PMID:28959563 Akap1 Rat aflatoxin B1 increases expression ISO RGD:731357 6480464 Aflatoxin B1 results in increased expression of AKAP1 mRNA CTD PMID:19770486 Akap1 Rat all-trans-retinoic acid increases expression ISO RGD:1343676 6480464 Tretinoin results in increased expression of AKAP1 mRNA CTD PMID:15894607 Akap1 Rat all-trans-retinoic acid decreases expression ISO RGD:1343676 6480464 Tretinoin results in decreased expression of AKAP1 mRNA CTD PMID:33167477 Akap1 Rat alpha-pinene multiple interactions ISO RGD:1343676 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Akap1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of AKAP1 mRNA CTD PMID:30047161 Akap1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AKAP1 mRNA CTD PMID:16483693 Akap1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of AKAP1 mRNA CTD PMID:30779732 Akap1 Rat arsenite(3-) increases expression ISO RGD:1343676 6480464 arsenite results in increased expression of AKAP1 mRNA CTD PMID:31646340 Akap1 Rat arsenite(3-) increases expression ISO RGD:731357 6480464 arsenite results in increased expression of AKAP1 protein CTD PMID:37955338 Akap1 Rat arsenite(3-) multiple interactions ISO RGD:1343676 6480464 arsenite inhibits the reaction [Fulvestrant results in increased expression of AKAP1 mRNA]; Fulvestrant inhibits the more ... CTD PMID:31646340 Akap1 Rat benzo[a]pyrene affects methylation ISO RGD:1343676 6480464 Benzo(a)pyrene affects the methylation of AKAP1 5' UTR CTD PMID:27901495 Akap1 Rat benzo[a]pyrene decreases expression ISO RGD:1343676 6480464 Benzo(a)pyrene results in decreased expression of AKAP1 mRNA CTD PMID:32234424 Akap1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1343676 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of AKAP1 mRNA CTD PMID:20018196 Akap1 Rat beta-lapachone increases expression ISO RGD:1343676 6480464 beta-lapachone results in increased expression of AKAP1 mRNA CTD PMID:38218311 Akap1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AKAP1 mRNA CTD PMID:25181051 Akap1 Rat bisphenol A decreases expression ISO RGD:1343676 6480464 bisphenol A results in decreased expression of AKAP1 protein CTD PMID:33376534 Akap1 Rat bisphenol A increases expression ISO RGD:731357 6480464 bisphenol A results in increased expression of AKAP1 mRNA CTD PMID:33221593 Akap1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AKAP1 mRNA CTD PMID:32145629 Akap1 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of AKAP1 protein CTD PMID:28903499 Akap1 Rat Butylbenzyl phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat cadmium atom increases expression ISO RGD:1343676 6480464 Cadmium results in increased expression of AKAP1 mRNA CTD PMID:31646340 Akap1 Rat cadmium dichloride decreases expression ISO RGD:1343676 6480464 Cadmium Chloride results in decreased expression of AKAP1 mRNA CTD PMID:38568856 Akap1 Rat caffeine affects phosphorylation ISO RGD:1343676 6480464 Caffeine affects the phosphorylation of AKAP1 protein CTD PMID:35688186 Akap1 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of AKAP1 mRNA CTD PMID:15913539 Akap1 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of AKAP1 mRNA CTD PMID:15913539 Akap1 Rat celecoxib affects expression ISO RGD:731357 6480464 Celecoxib affects the expression of AKAP1 mRNA CTD PMID:20562220 Akap1 Rat chlorpyrifos decreases expression ISO RGD:731357 6480464 Chlorpyrifos results in decreased expression of AKAP1 mRNA CTD PMID:37019170 Akap1 Rat choline multiple interactions ISO RGD:731357 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Akap1 Rat cisplatin multiple interactions ISO RGD:1343676 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of AKAP1 mRNA CTD PMID:27392435 Akap1 Rat cobalt dichloride decreases expression ISO RGD:1343676 6480464 cobaltous chloride results in decreased expression of AKAP1 mRNA CTD PMID:19320972 Akap1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of AKAP1 mRNA CTD PMID:30556269 Akap1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of AKAP1 mRNA CTD PMID:30556269 Akap1 Rat copper(II) sulfate decreases expression ISO RGD:1343676 6480464 Copper Sulfate results in decreased expression of AKAP1 mRNA CTD PMID:19549813 Akap1 Rat coumarin decreases phosphorylation ISO RGD:1343676 6480464 coumarin results in decreased phosphorylation of AKAP1 protein CTD PMID:35688186 Akap1 Rat cyclosporin A decreases expression ISO RGD:1343676 6480464 Cyclosporine results in decreased expression of AKAP1 mRNA CTD PMID:20106945|PMID:25562108 Akap1 Rat cyproconazole decreases expression ISO RGD:731357 6480464 cyproconazole results in decreased expression of AKAP1 mRNA CTD PMID:22334560 Akap1 Rat DDE increases expression ISO RGD:1343676 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of AKAP1 mRNA CTD PMID:38568856 Akap1 Rat dibutyl phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat diethyl phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat diisobutyl phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat diisononyl phthalate multiple interactions ISO RGD:731357 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Akap1 Rat dorsomorphin multiple interactions ISO RGD:1343676 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Akap1 Rat doxorubicin decreases expression ISO RGD:1343676 6480464 Doxorubicin results in decreased expression of AKAP1 mRNA CTD PMID:29803840 Akap1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of AKAP1 mRNA CTD PMID:29391264 Akap1 Rat entinostat increases expression ISO RGD:1343676 6480464 entinostat results in increased expression of AKAP1 mRNA CTD PMID:26272509 Akap1 Rat entinostat multiple interactions ISO RGD:1343676 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Akap1 Rat enzyme inhibitor multiple interactions ISO RGD:1343676 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Akap1 Rat epoxiconazole decreases expression ISO RGD:731357 6480464 epoxiconazole results in decreased expression of AKAP1 mRNA CTD PMID:22334560 Akap1 Rat ethanol affects expression ISO RGD:731357 6480464 Ethanol affects the expression of AKAP1 mRNA CTD PMID:30319688 Akap1 Rat ethyl methanesulfonate decreases expression ISO RGD:1343676 6480464 Ethyl Methanesulfonate results in decreased expression of AKAP1 mRNA CTD PMID:23649840 Akap1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of AKAP1 mRNA CTD PMID:30307764 Akap1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of AKAP1 mRNA CTD PMID:24136188 Akap1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of AKAP1 mRNA CTD PMID:18035473 Akap1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of AKAP1 mRNA CTD PMID:24793618 Akap1 Rat folic acid multiple interactions ISO RGD:731357 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Akap1 Rat FR900359 affects phosphorylation ISO RGD:1343676 6480464 FR900359 affects the phosphorylation of AKAP1 protein CTD PMID:37730182 Akap1 Rat fulvestrant increases expression ISO RGD:1343676 6480464 Fulvestrant results in increased expression of AKAP1 mRNA CTD PMID:31646340 Akap1 Rat fulvestrant multiple interactions ISO RGD:1343676 6480464 arsenite inhibits the reaction [Fulvestrant results in increased expression of AKAP1 mRNA]; Estradiol inhibits the more ... CTD PMID:31646340 Akap1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AKAP1 mRNA CTD PMID:33387578 Akap1 Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of AKAP1 mRNA CTD PMID:15345336 Akap1 Rat hexadecanoic acid decreases phosphorylation ISO RGD:1343676 6480464 Palmitic Acid results in decreased phosphorylation of AKAP1 protein CTD PMID:28073184 Akap1 Rat isoprenaline decreases expression ISO RGD:731357 6480464 Isoproterenol results in decreased expression of AKAP1 mRNA CTD PMID:20003209 Akap1 Rat L-methionine multiple interactions ISO RGD:731357 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Akap1 Rat lead diacetate multiple interactions ISO RGD:731357 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of AKAP1 more ... CTD PMID:33445541 Akap1 Rat lead(0) multiple interactions ISO RGD:731357 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of AKAP1 more ... CTD PMID:33445541 Akap1 Rat methidathion increases expression ISO RGD:731357 6480464 methidathion results in increased expression of AKAP1 mRNA CTD PMID:34813904 Akap1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of AKAP1 gene CTD PMID:35440735 Akap1 Rat methyl methanesulfonate decreases expression ISO RGD:1343676 6480464 Methyl Methanesulfonate results in decreased expression of AKAP1 mRNA CTD PMID:23649840 Akap1 Rat nickel atom decreases expression ISO RGD:1343676 6480464 Nickel results in decreased expression of AKAP1 mRNA CTD PMID:25583101 Akap1 Rat ozone multiple interactions ISO RGD:1343676 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Akap1 Rat paracetamol decreases expression ISO RGD:1343676 6480464 Acetaminophen results in decreased expression of AKAP1 mRNA CTD PMID:25704631|PMID:29067470 Akap1 Rat paracetamol increases expression ISO RGD:1343676 6480464 Acetaminophen results in increased expression of AKAP1 mRNA CTD PMID:26690555 Akap1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:731357 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AKAP1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Akap1 Rat perfluorooctanoic acid increases expression ISO RGD:1343676 6480464 perfluorooctanoic acid results in increased expression of AKAP1 protein CTD PMID:26879310 Akap1 Rat phenobarbital affects expression ISO RGD:731357 6480464 Phenobarbital affects the expression of AKAP1 mRNA CTD PMID:23091169 Akap1 Rat pirinixic acid increases expression ISO RGD:731357 6480464 pirinixic acid results in increased expression of AKAP1 mRNA CTD PMID:18301758 Akap1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of AKAP1 mRNA CTD PMID:20726854 Akap1 Rat propiconazole decreases expression ISO RGD:731357 6480464 propiconazole results in decreased expression of AKAP1 mRNA CTD PMID:21278054|PMID:22334560 Akap1 Rat raloxifene multiple interactions ISO RGD:1343676 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of AKAP1 mRNA CTD PMID:19059307 Akap1 Rat raloxifene affects expression ISO RGD:1343676 6480464 Raloxifene Hydrochloride affects the expression of AKAP1 mRNA CTD PMID:14699072 Akap1 Rat rotenone affects expression ISO RGD:731357 6480464 Rotenone affects the expression of AKAP1 mRNA CTD PMID:23186747 Akap1 Rat SB 431542 multiple interactions ISO RGD:1343676 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Akap1 Rat silver atom decreases expression ISO RGD:1343676 6480464 Silver results in decreased expression of AKAP1 mRNA CTD PMID:26014281 Akap1 Rat silver(0) decreases expression ISO RGD:1343676 6480464 Silver results in decreased expression of AKAP1 mRNA CTD PMID:26014281 Akap1 Rat sodium arsenite decreases expression ISO RGD:1343676 6480464 sodium arsenite results in decreased expression of AKAP1 mRNA CTD PMID:38568856 Akap1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of AKAP1 mRNA CTD PMID:24136188 Akap1 Rat tamoxifen multiple interactions ISO RGD:1343676 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of AKAP1 mRNA CTD PMID:19059307 Akap1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AKAP1 mRNA] CTD PMID:31150632 Akap1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of AKAP1 mRNA CTD PMID:31150632 Akap1 Rat thiram decreases expression ISO RGD:1343676 6480464 Thiram results in decreased expression of AKAP1 mRNA CTD PMID:38568856 Akap1 Rat titanium dioxide increases methylation ISO RGD:731357 6480464 titanium dioxide results in increased methylation of AKAP1 promoter CTD PMID:35295148 Akap1 Rat titanium dioxide decreases methylation ISO RGD:731357 6480464 titanium dioxide results in decreased methylation of AKAP1 gene CTD PMID:35295148 Akap1 Rat trichostatin A decreases expression ISO RGD:1343676 6480464 trichostatin A results in decreased expression of AKAP1 mRNA CTD PMID:24935251 Akap1 Rat triphenyl phosphate affects expression ISO RGD:1343676 6480464 triphenyl phosphate affects the expression of AKAP1 mRNA CTD PMID:37042841 Akap1 Rat triptonide decreases expression ISO RGD:731357 6480464 triptonide results in decreased expression of AKAP1 mRNA CTD PMID:33045310 Akap1 Rat uranium atom affects expression ISO RGD:1343676 6480464 Uranium affects the expression of AKAP1 mRNA CTD PMID:15672453 Akap1 Rat urethane decreases expression ISO RGD:1343676 6480464 Urethane results in decreased expression of AKAP1 mRNA CTD PMID:28818685 Akap1 Rat valproic acid affects expression ISO RGD:1343676 6480464 Valproic Acid affects the expression of AKAP1 mRNA CTD PMID:25979313 Akap1 Rat valproic acid increases expression ISO RGD:1343676 6480464 Valproic Acid results in increased expression of AKAP1 mRNA CTD PMID:23179753|PMID:25192806|PMID:28001369 Akap1 Rat valproic acid decreases expression ISO RGD:1343676 6480464 Valproic Acid results in decreased expression of AKAP1 mRNA CTD PMID:24935251 Akap1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of AKAP1 mRNA CTD PMID:18042343
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium atom (EXP) calcium(0) (EXP) celecoxib (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) cyproconazole (ISO) DDE (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) finasteride (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) glutathione (EXP) hexadecanoic acid (ISO) isoprenaline (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) methidathion (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) nickel atom (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) progesterone (EXP) propiconazole (ISO) raloxifene (ISO) rotenone (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulindac (EXP) tamoxifen (ISO) tetrachloromethane (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) uranium atom (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
The A-kinase anchor protein AKAP121 is a negative regulator of cardiomyocyte hypertrophy.
Abrenica B, etal., J Mol Cell Cardiol. 2009 May;46(5):674-81.
2.
Identification and characterization of D-AKAP1 as a major adipocyte PKA and PP1 binding protein.
Bridges D, etal., Biochem Biophys Res Commun. 2006 Jul 21;346(1):351-7. Epub 2006 Jun 2.
3.
A-kinase anchor protein 84/121 are targeted to mitochondria and mitotic spindles by overlapping amino-terminal motifs.
Cardone L, etal., J Mol Biol. 2002 Jul 12;320(3):663-75.
4.
Proteolysis of AKAP121 regulates mitochondrial activity during cellular hypoxia and brain ischaemia.
Carlucci A, etal., EMBO J. 2008 Apr 9;27(7):1073-84. Epub 2008 Mar 6.
5.
A-kinase anchoring proteins: from protein complexes to physiology and disease.
Carnegie GK, etal., IUBMB Life. 2009 Apr;61(4):394-406.
6.
Organelle-specific targeting of protein kinase AII (PKAII). Molecular and in situ characterization of murine A kinase anchor proteins that recruit regulatory subunits of PKAII to the cytoplasmic surface of mitochondria.
Chen Q, etal., J Biol Chem 1997 Jun 13;272(24):15247-57.
7.
Expression of a kinase anchor protein 121 is regulated by hormones in thyroid and testicular germ cells.
Feliciello A, etal., J Biol Chem. 1998 Sep 4;273(36):23361-6.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
PKA, PKC, and AKAP localization in and around the neuromuscular junction.
Perkins GA, etal., BMC Neurosci. 2001;2:17. Epub 2001 Oct 23.
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Occurrence of A-kinase anchor protein and associated cAMP-dependent protein kinase in the inner compartment of mammalian mitochondria.
Sardanelli AM, etal., FEBS Lett. 2006 Oct 16;580(24):5690-6. Epub 2006 Sep 18.
16.
Localized effects of cAMP mediated by distinct routes of protein kinase A.
Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.
17.
AAT-1, a novel testis-specific AMY-1-binding protein, forms a quaternary complex with AMY-1, A-kinase anchor protein 84, and a regulatory subunit of cAMP-dependent protein kinase and is phosphorylated by its kinase.
Yukitake H, etal., J Biol Chem. 2002 Nov 22;277(47):45480-92. Epub 2002 Sep 9.
Akap1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 74,118,232 - 74,151,366 (-) NCBI GRCr8 mRatBN7.2 10 73,621,021 - 73,654,123 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 73,621,883 - 73,653,896 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 78,236,555 - 78,250,887 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 77,741,478 - 77,755,810 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 73,204,658 - 73,218,993 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 76,151,013 - 76,183,987 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 76,151,038 - 76,166,276 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 73,927,523 - 73,960,524 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 77,262,592 - 77,276,832 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 77,276,968 - 77,291,202 (-) NCBI Celera 10 72,528,421 - 72,542,825 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
AKAP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 57,085,246 - 57,121,344 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 57,085,092 - 57,121,346 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 55,162,607 - 55,198,705 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 52,517,552 - 52,553,709 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 52,529,085 - 52,553,608 NCBI Celera 17 51,624,091 - 51,660,266 (+) NCBI Celera Cytogenetic Map 17 q22 ENTREZGENE HuRef 17 50,523,434 - 50,559,589 (+) NCBI HuRef CHM1_1 17 55,227,656 - 55,263,814 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 57,959,590 - 57,995,715 (+) NCBI T2T-CHM13v2.0
Akap1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 88,721,618 - 88,755,426 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 88,721,618 - 88,755,412 (-) Ensembl GRCm39 Ensembl GRCm38 11 88,830,792 - 88,864,596 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 88,830,792 - 88,864,586 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 88,692,106 - 88,725,900 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 88,647,760 - 88,667,593 (-) NCBI MGSCv36 mm8 Celera 11 98,443,444 - 98,477,088 (-) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 54.34 NCBI
Akap1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 5,756,835 - 5,770,238 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 5,756,648 - 5,787,617 (-) NCBI ChiLan1.0 ChiLan1.0
AKAP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 73,258,822 - 73,295,090 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 78,069,847 - 78,106,113 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 51,162,993 - 51,199,202 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 56,023,381 - 56,058,744 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 56,023,381 - 56,058,744 (+) Ensembl panpan1.1 panPan2
AKAP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 31,884,028 - 31,908,142 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 31,885,478 - 31,904,386 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 31,111,289 - 31,147,661 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 32,679,514 - 32,715,929 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 32,679,552 - 32,713,004 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 31,465,187 - 31,501,542 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 31,748,681 - 31,785,035 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 31,832,099 - 31,868,463 (+) NCBI UU_Cfam_GSD_1.0
Akap1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 31,227,485 - 31,245,312 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 5,830,973 - 5,845,441 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 5,829,728 - 5,842,217 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AKAP1
AKAP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 36,275,287 - 36,313,612 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 36,275,209 - 36,306,012 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 7,095,917 - 7,132,219 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Akap1
.
Predicted Target Of
Count of predictions: 166 Count of miRNA genes: 125 Interacting mature miRNAs: 139 Transcripts: ENSRNOT00000003251, ENSRNOT00000055683 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 2289982 Bp303 Blood pressure QTL 303 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 73452992 75632053 Rat 2289983 Bp304 Blood pressure QTL 304 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 73579541 74119158 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 724555 Bp150 Blood pressure QTL 150 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 73452992 78210622 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH141905
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 73,621,080 - 73,621,293 (+) MAPPER mRatBN7.2 mRatBN7.2 16 17,844,021 - 17,844,237 (+) MAPPER mRatBN7.2 Rnor_6.0 16 19,568,001 - 19,568,216 NCBI Rnor6.0 Rnor_6.0 10 76,151,073 - 76,151,285 NCBI Rnor6.0 Rnor_5.0 16 19,425,028 - 19,425,243 UniSTS Rnor5.0 Rnor_5.0 10 73,960,252 - 73,960,464 UniSTS Rnor5.0 RGSC_v3.4 10 77,261,760 - 77,261,972 UniSTS RGSC3.4 RGSC_v3.4 16 18,331,190 - 18,331,405 UniSTS RGSC3.4 Celera 16 18,052,386 - 18,052,601 UniSTS Celera 10 72,527,589 - 72,527,801 UniSTS RH 3.4 Map 10 681.4 UniSTS Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003251 ⟹ ENSRNOP00000003251
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 73,621,913 - 73,653,896 (-) Ensembl Rnor_6.0 Ensembl 10 76,164,046 - 76,166,251 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000055683 ⟹ ENSRNOP00000052543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 73,621,883 - 73,640,980 (-) Ensembl Rnor_6.0 Ensembl 10 76,151,038 - 76,166,276 (-) Ensembl
RefSeq Acc Id:
NM_053665 ⟹ NP_446117
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,119,124 - 74,133,457 (-) NCBI mRatBN7.2 10 73,621,913 - 73,636,246 (-) NCBI Rnor_6.0 10 76,151,905 - 76,166,251 (-) NCBI Rnor_5.0 10 73,927,523 - 73,960,524 (+) NCBI RGSC_v3.4 10 77,262,592 - 77,276,832 (-) RGD Celera 10 72,528,421 - 72,542,825 (-) RGD
Sequence:
ATGGCAATCCAGTTCCGCTCACTCTTCCCCTTGGCCTTGCCTGGAATGCTAGCACTCCTTGGCTGGTGGTGGTTTTTCTCTCGTAAAAAAGATCGGCTCAGCAGCAATGGCAAGCAGGTGGGGACATT
hide sequence
RefSeq Acc Id:
XM_006247067 ⟹ XP_006247129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,138,230 (-) NCBI mRatBN7.2 10 73,621,021 - 73,641,070 (-) NCBI Rnor_6.0 10 76,151,013 - 76,170,990 (-) NCBI Rnor_5.0 10 73,927,523 - 73,960,524 (+) NCBI
Sequence:
ACGGGGCTAGGCTAAGATCAGCAGGCCTGAGGCATGGCTCCATCTCTGTGACCCTGGGTCTCAG
hide sequence
RefSeq Acc Id:
XM_006247068 ⟹ XP_006247130
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,151,366 (-) NCBI mRatBN7.2 10 73,621,021 - 73,654,123 (-) NCBI Rnor_6.0 10 76,151,013 - 76,183,987 (-) NCBI Rnor_5.0 10 73,927,523 - 73,960,524 (+) NCBI
Sequence:
CTGTGTTCGCCCGGCCTGGGCTAGCACGTGGGGGAGCGGCCGAAGCGCCTTGCAGCGCTGCGGG
hide sequence
RefSeq Acc Id:
XM_008767930 ⟹ XP_008766152
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,137,415 (-) NCBI mRatBN7.2 10 73,621,021 - 73,638,851 (-) NCBI Rnor_6.0 10 76,151,013 - 76,168,889 (-) NCBI
Sequence:
GTGCATTTAAATTAGGGAAATGGCCTCTTAACTAATTCCCTAGAAGGCTGTTTGGCCGACATGA
hide sequence
RefSeq Acc Id:
XM_039085023 ⟹ XP_038940951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,126,936 - 74,138,223 (-) NCBI mRatBN7.2 10 73,629,726 - 73,641,213 (-) NCBI
RefSeq Acc Id:
XM_039085025 ⟹ XP_038940953
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,129,082 - 74,138,223 (-) NCBI mRatBN7.2 10 73,631,871 - 73,641,213 (-) NCBI
RefSeq Acc Id:
XM_063268268 ⟹ XP_063124338
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,138,214 (-) NCBI
RefSeq Acc Id:
XM_063268270 ⟹ XP_063124340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,151,329 (-) NCBI
RefSeq Acc Id:
XM_063268271 ⟹ XP_063124341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,131,344 (-) NCBI
RefSeq Acc Id:
XM_063268272 ⟹ XP_063124342
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,118,232 - 74,131,317 (-) NCBI
RefSeq Acc Id:
XR_005489674
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,129,159 - 74,138,223 (-) NCBI mRatBN7.2 10 73,631,966 - 73,641,213 (-) NCBI
RefSeq Acc Id:
XR_005489675
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,129,082 - 74,138,223 (-) NCBI mRatBN7.2 10 73,631,871 - 73,641,213 (-) NCBI
RefSeq Acc Id:
XR_005489676
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,130,919 - 74,138,223 (-) NCBI mRatBN7.2 10 73,633,755 - 73,641,213 (-) NCBI
RefSeq Acc Id:
XR_005489677
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 74,127,680 - 74,138,223 (-) NCBI mRatBN7.2 10 73,630,469 - 73,641,213 (-) NCBI
RefSeq Acc Id:
NP_446117 ⟸ NM_053665
- UniProtKB:
O88980 (UniProtKB/Swiss-Prot), O88884 (UniProtKB/Swiss-Prot)
- Sequence:
MAIQFRSLFPLALPGMLALLGWWWFFSRKKDRLSSNGKQVGTLKVGPAIEDRLPTEEACPGVLSVTPSVTQPPGKEEQRSMDRPLSDPPALPRTRQVRRRSESSGNLPSIVDTRLQAGQCSDENSKVV
hide sequence
RefSeq Acc Id:
XP_006247130 ⟸ XM_006247068
- Peptide Label:
isoform X1
- UniProtKB:
F1LMK0 (UniProtKB/TrEMBL), A6HHY7 (UniProtKB/TrEMBL)
- Sequence:
MAIQFRSLFPLALPGMLALLGWWWFFSRKKDRLSSNGKQVGTLKVGPAIEDRLPTEEACPGVLSVTPSVTQPPGKEEQRSMDRPLTDPPALPRTRQVRRRSESSGNLPSIVDTRLQAGQCRDENSKVV
hide sequence
RefSeq Acc Id:
XP_006247129 ⟸ XM_006247067
- Peptide Label:
isoform X1
- UniProtKB:
F1LMK0 (UniProtKB/TrEMBL), A6HHY7 (UniProtKB/TrEMBL)
- Sequence:
MAIQFRSLFPLALPGMLALLGWWWFFSRKKDRLSSNGKQVGTLKVGPAIEDRLPTEEACPGVLSVTPSVTQPPGKEEQRSMDRPLTDPPALPRTRQVRRRSESSGNLPSIVDTRLQAGQCRDENSKVV
hide sequence
RefSeq Acc Id:
XP_008766152 ⟸ XM_008767930
- Peptide Label:
isoform X1
- UniProtKB:
F1LMK0 (UniProtKB/TrEMBL), A6HHY7 (UniProtKB/TrEMBL)
- Sequence:
MAIQFRSLFPLALPGMLALLGWWWFFSRKKDRLSSNGKQVGTLKVGPAIEDRLPTEEACPGVLSVTPSVTQPPGKEEQRSMDRPLTDPPALPRTRQVRRRSESSGNLPSIVDTRLQAGQCRDENSKVV
hide sequence
Ensembl Acc Id:
ENSRNOP00000052543 ⟸ ENSRNOT00000055683
Ensembl Acc Id:
ENSRNOP00000003251 ⟸ ENSRNOT00000003251
RefSeq Acc Id:
XP_038940951 ⟸ XM_039085023
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038940953 ⟸ XM_039085025
- Peptide Label:
isoform X3
- UniProtKB:
D4A9M6 (UniProtKB/TrEMBL), A6HHY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124340 ⟸ XM_063268270
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063124338 ⟸ XM_063268268
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063124341 ⟸ XM_063268271
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063124342 ⟸ XM_063268272
- Peptide Label:
isoform X5
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Akap1
A-kinase anchoring protein 1
Akap1
A kinase (PRKA) anchor protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Akap1
A kinase (PRKA) anchor protein 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Akap1
A kinase (PRKA) anchor protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_physical_interaction
binds to type I and II regulatory subunits of protein kinase A and anchors them to the cytoplasmic face of the mitochondrial outer membrane
724707
