Symbol:
Inhba
Name:
inhibin subunit beta A
RGD ID:
62074
Description:
Predicted to enable identical protein binding activity; peptide hormone binding activity; and signaling receptor binding activity. Involved in several processes, including cell surface receptor signaling pathway; cellular response to decreased oxygen levels; and positive regulation of metabolic process. Located in extracellular space. Part of inhibin A complex. Biomarker of congestive heart failure; myocardial infarction; retinal degeneration; and rheumatic heart disease. Orthologous to human INHBA (inhibin subunit beta A); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
activin A; activin beta-A chain; inhibin beta A chain; inhibin beta A subunit; inhibin beta-A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
INHBA (inhibin subunit beta A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Inhba (inhibin beta-A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Inhba (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
INHBA (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
INHBA (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Inhba (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
INHBA (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
INHBA (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Inhba (inhibin subunit beta A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Inhba (inhibin beta-A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
INHBA (inhibin subunit beta A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
inhbaa (inhibin subunit beta Aa)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
inhbab (inhibin subunit beta Ab)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Actbeta
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
inhba
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 53,787,159 - 53,810,942 (-) NCBI GRCr8 mRatBN7.2 17 49,091,635 - 49,111,573 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 49,095,920 - 49,108,982 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 52,294,696 - 52,307,755 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 56,297,581 - 56,310,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 50,395,401 - 50,408,458 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 51,894,869 - 51,919,998 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 51,898,217 - 51,912,496 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 49,961,222 - 49,985,653 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 57,244,466 - 57,257,531 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 57,247,306 - 57,260,372 (-) NCBI Celera 17 45,163,387 - 45,176,397 (-) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Inhba Rat (1->4)-beta-D-glucan multiple interactions ISO Inhba (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of INHBA mRNA CTD PMID:36331819 Inhba Rat (S)-amphetamine multiple interactions ISO Inhba (Mus musculus) 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in increased expression of INHBA mRNA] CTD PMID:12205029 Inhba Rat (S)-amphetamine increases expression ISO Inhba (Mus musculus) 6480464 Dextroamphetamine results in increased expression of INHBA mRNA CTD PMID:12205029 and PMID:12558987 Inhba Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Inhba Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Inhba (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of INHBA mRNA CTD PMID:19647056 Inhba Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of INHBA mRNA CTD PMID:30723492 Inhba Rat 17alpha-ethynylestradiol affects expression ISO Inhba (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of INHBA mRNA CTD PMID:17555576 Inhba Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of INHBA mRNA CTD PMID:15834898 and PMID:28522409 Inhba Rat 17alpha-ethynylestradiol multiple interactions ISO Inhba (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of INHBA mRNA CTD PMID:17942748 Inhba Rat 17alpha-ethynylestradiol increases expression ISO Inhba (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of INHBA mRNA CTD PMID:17942748 Inhba Rat 17beta-estradiol multiple interactions ISO INHBA (Homo sapiens) 6480464 4-(2-aminoethyl)benzenesulfonylfluoride inhibits the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of INHBA mRNA] more ... CTD PMID:17636213 more ... Inhba Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of INHBA mRNA CTD PMID:35192832 Inhba Rat 17beta-estradiol increases expression ISO INHBA (Homo sapiens) 6480464 Estradiol results in increased expression of INHBA mRNA CTD PMID:31614463 Inhba Rat 17beta-estradiol increases expression ISO Inhba (Mus musculus) 6480464 Estradiol results in increased expression of INHBA mRNA CTD PMID:22285243 and PMID:39298647 Inhba Rat 17beta-estradiol decreases expression ISO INHBA (Homo sapiens) 6480464 Estradiol results in decreased expression of INHBA mRNA CTD PMID:21177794 and PMID:23373633 Inhba Rat 17beta-estradiol decreases expression ISO Inhba (Mus musculus) 6480464 Estradiol results in decreased expression of INHBA mRNA and Estradiol results in decreased expression of INHBA protein CTD PMID:17255206 Inhba Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO INHBA (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 and PMID:38568856 Inhba Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO INHBA (Homo sapiens) 6480464 [2 more ... CTD PMID:32653021 Inhba Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine increases secretion ISO Inhba (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased secretion of INHBA protein CTD PMID:26572662 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of INHBA mRNA CTD PMID:34747641 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Inhba (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of INHBA mRNA CTD PMID:21570461 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of INHBA mRNA CTD PMID:21215274 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of INHBA mRNA CTD PMID:22298810 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of INHBA mRNA] CTD PMID:21215274 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Inhba (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of INHBA mRNA CTD PMID:19770486 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Inhba (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of INHBA mRNA CTD PMID:17942748 Inhba Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Inhba (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of INHBA mRNA CTD PMID:17942748 Inhba Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Inhba (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Inhba Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of INHBA mRNA CTD PMID:21346803 Inhba Rat 2-nitrotoluene decreases expression ISO Inhba (Mus musculus) 6480464 2-nitrotoluene results in decreased expression of INHBA mRNA CTD PMID:15618236 Inhba Rat 25-hydroxycholesterol increases expression EXP 6480464 25-hydroxycholesterol results in increased expression of INHBA mRNA CTD PMID:19464342 Inhba Rat 25-hydroxycholesterol decreases expression EXP 6480464 25-hydroxycholesterol results in decreased expression of INHBA protein CTD PMID:19464342 Inhba Rat 3',5'-cyclic AMP increases secretion ISO INHBA (Homo sapiens) 6480464 Cyclic AMP results in increased secretion of INHBA protein CTD PMID:20074812 Inhba Rat 3,4-methylenedioxymethamphetamine increases expression ISO Inhba (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of INHBA mRNA CTD PMID:20188158 Inhba Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO INHBA (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [Busulfan results in increased expression of INHBA mRNA] and bisindolylmaleimide I inhibits the reaction [Busulfan results in increased expression of INHBA protein] CTD PMID:12966370 Inhba Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO INHBA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of INHBA mRNA CTD PMID:28628672 Inhba Rat 3-Nitrobenzanthrone increases expression ISO INHBA (Homo sapiens) 6480464 3-nitrobenzanthrone results in increased expression of INHBA mRNA CTD PMID:34036453 Inhba Rat 4,4'-sulfonyldiphenol decreases expression ISO INHBA (Homo sapiens) 6480464 bisphenol S results in decreased expression of INHBA mRNA CTD PMID:33476716 Inhba Rat 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of INHBA protein CTD PMID:37357847 Inhba Rat 4,4'-sulfonyldiphenol affects expression ISO Inhba (Mus musculus) 6480464 bisphenol S affects the expression of INHBA mRNA CTD PMID:39298647 Inhba Rat 4,4'-sulfonyldiphenol multiple interactions ISO Inhba (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of INHBA mRNA CTD PMID:30951980 Inhba Rat 4,4'-sulfonyldiphenol increases expression ISO Inhba (Mus musculus) 6480464 bisphenol S results in increased expression of INHBA mRNA CTD PMID:30951980 Inhba Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Inhba (Mus musculus) 6480464 Oxazolone results in increased expression of INHBA mRNA CTD PMID:19647056 Inhba Rat 4-methylcatechol decreases expression EXP 6480464 4-methylcatechol results in decreased expression of INHBA mRNA CTD PMID:29473434 Inhba Rat 4-nitrotoluene decreases expression ISO Inhba (Mus musculus) 6480464 4-nitrotoluene results in decreased expression of INHBA mRNA CTD PMID:15618236 Inhba Rat 5-aza-2'-deoxycytidine increases expression ISO Inhba (Mus musculus) 6480464 Decitabine results in increased expression of INHBA mRNA CTD PMID:27915011 Inhba Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of INHBA mRNA CTD PMID:24780913 Inhba Rat 8-Br-cAMP increases expression ISO INHBA (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of INHBA mRNA CTD PMID:20147733 and PMID:22079614 Inhba Rat acrolein multiple interactions ISO INHBA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of INHBA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of INHBA mRNA CTD PMID:32699268 Inhba Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of INHBA mRNA CTD PMID:28959563 Inhba Rat aflatoxin B1 decreases expression ISO INHBA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of INHBA mRNA CTD PMID:22100608 Inhba Rat aflatoxin B1 decreases methylation ISO INHBA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of INHBA gene CTD PMID:27153756 Inhba Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of INHBA mRNA CTD PMID:23630614 Inhba Rat all-trans-retinoic acid increases expression ISO INHBA (Homo sapiens) 6480464 Tretinoin results in increased expression of INHBA mRNA CTD PMID:21934132 Inhba Rat all-trans-retinoic acid multiple interactions ISO Inhba (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of INHBA mRNA more ... CTD PMID:30951980 Inhba Rat all-trans-retinol multiple interactions ISO Inhba (Mus musculus) 6480464 [Vitamin A co-treated with INHBA protein] results in decreased expression of SHH mRNA more ... CTD PMID:17244017 Inhba Rat allethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] results in decreased expression of INHBA mRNA more ... CTD PMID:33051911 more ... Inhba Rat alpha-pinene multiple interactions ISO INHBA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of INHBA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of INHBA mRNA CTD PMID:32699268 Inhba Rat amiodarone decreases expression ISO Inhba (Mus musculus) 6480464 Amiodarone results in decreased expression of INHBA mRNA CTD PMID:24535564 Inhba Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of INHBA mRNA CTD PMID:16483693 Inhba Rat amphotericin B increases expression ISO INHBA (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of INHBA mRNA CTD PMID:28534445 Inhba Rat aristolochic acid A decreases expression ISO INHBA (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of INHBA mRNA CTD PMID:33212167 Inhba Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of INHBA protein CTD PMID:35690179 Inhba Rat Aroclor 1254 decreases expression ISO Inhba (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of INHBA mRNA CTD PMID:23650126 Inhba Rat arsane affects expression ISO INHBA (Homo sapiens) 6480464 Arsenic affects the expression of INHBA protein CTD PMID:24675094 Inhba Rat arsenic atom affects expression ISO INHBA (Homo sapiens) 6480464 Arsenic affects the expression of INHBA protein CTD PMID:24675094 Inhba Rat arsenite(3-) decreases expression ISO Inhba (Mus musculus) 6480464 arsenite results in decreased expression of INHBA mRNA CTD PMID:15894712 Inhba Rat arsenite(3-) multiple interactions ISO Inhba (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of INHBA mRNA CTD PMID:15894712 Inhba Rat arsenous acid decreases expression ISO INHBA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of INHBA mRNA CTD PMID:20458559 Inhba Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of INHBA mRNA CTD PMID:36841081 Inhba Rat Azoxymethane multiple interactions ISO Inhba (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INHBA mRNA CTD PMID:29950665 Inhba Rat belinostat increases expression ISO INHBA (Homo sapiens) 6480464 belinostat results in increased expression of INHBA mRNA CTD PMID:26272509 Inhba Rat belinostat multiple interactions ISO INHBA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INHBA mRNA CTD PMID:27188386 Inhba Rat benzalkonium chloride increases expression ISO Inhba (Mus musculus) 6480464 Benzalkonium Compounds results in increased expression of INHBA mRNA CTD PMID:30171875 Inhba Rat benzo[a]pyrene multiple interactions ISO Inhba (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of INHBA mRNA CTD PMID:15894712 Inhba Rat benzo[a]pyrene decreases expression ISO INHBA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of INHBA mRNA CTD PMID:32234424 Inhba Rat benzo[a]pyrene increases methylation ISO INHBA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of INHBA 5' UTR CTD PMID:27901495 Inhba Rat benzo[a]pyrene increases expression ISO Inhba (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of INHBA mRNA CTD PMID:22228805 Inhba Rat benzo[a]pyrene decreases expression ISO Inhba (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of INHBA mRNA CTD PMID:15894712 and PMID:19770486 Inhba Rat Benzo[ghi]perylene decreases expression ISO Inhba (Mus musculus) 6480464 1 and 12-benzoperylene results in decreased expression of INHBA mRNA CTD PMID:26377693 Inhba Rat bis(2-chloroethyl) sulfide increases secretion ISO INHBA (Homo sapiens) 6480464 Mustard Gas results in increased secretion of INHBA protein CTD PMID:33491125 Inhba Rat bis(2-ethylhexyl) phthalate decreases expression ISO Inhba (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of INHBA mRNA CTD PMID:19850644 Inhba Rat bis(2-ethylhexyl) phthalate increases expression ISO INHBA (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of INHBA mRNA CTD PMID:31163220 Inhba Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Inhba (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of INHBA mRNA] CTD PMID:19850644 Inhba Rat bisphenol A decreases expression ISO INHBA (Homo sapiens) 6480464 bisphenol A results in decreased expression of INHBA mRNA CTD PMID:33476716 Inhba Rat bisphenol A decreases expression ISO Inhba (Mus musculus) 6480464 bisphenol A results in decreased expression of INHBA mRNA CTD PMID:37894381 Inhba Rat bisphenol A increases expression ISO Inhba (Mus musculus) 6480464 bisphenol A results in increased expression of INHBA mRNA CTD PMID:30951980 and PMID:32370801 Inhba Rat bisphenol A multiple interactions ISO Inhba (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of INHBA mRNA CTD PMID:30951980 Inhba Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of INHBA mRNA CTD PMID:25181051 more ... Inhba Rat bisphenol F increases expression ISO Inhba (Mus musculus) 6480464 bisphenol F results in increased expression of INHBA mRNA CTD PMID:30951980 Inhba Rat bisphenol F decreases expression ISO Inhba (Mus musculus) 6480464 bisphenol F results in decreased expression of INHBA mRNA CTD PMID:38685157 Inhba Rat bisphenol F multiple interactions ISO Inhba (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of INHBA mRNA CTD PMID:30951980 Inhba Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of INHBA mRNA CTD PMID:32479839 Inhba Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of INHBA mRNA CTD PMID:24136188 Inhba Rat busulfan multiple interactions ISO INHBA (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [Busulfan results in increased expression of INHBA mRNA] and bisindolylmaleimide I inhibits the reaction [Busulfan results in increased expression of INHBA protein] CTD PMID:12966370 Inhba Rat busulfan increases expression ISO INHBA (Homo sapiens) 6480464 Busulfan results in increased expression of INHBA mRNA and Busulfan results in increased expression of INHBA protein CTD PMID:12966370 and PMID:22286157 Inhba Rat butanal increases expression ISO INHBA (Homo sapiens) 6480464 butyraldehyde results in increased expression of INHBA mRNA CTD PMID:26079696 Inhba Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of INHBA mRNA CTD PMID:19167457 Inhba Rat cadmium atom increases expression ISO INHBA (Homo sapiens) 6480464 Cadmium results in increased expression of INHBA mRNA CTD PMID:21120746 more ... Inhba Rat cadmium dichloride increases expression ISO INHBA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of INHBA mRNA CTD PMID:38568856 Inhba Rat calcitriol decreases expression ISO INHBA (Homo sapiens) 6480464 Calcitriol results in decreased expression of INHBA mRNA CTD PMID:16002434 Inhba Rat calcitriol increases expression ISO INHBA (Homo sapiens) 6480464 Calcitriol results in increased expression of INHBA mRNA and Calcitriol results in increased expression of INHBA protein CTD PMID:23589129 Inhba Rat calcitriol multiple interactions ISO INHBA (Homo sapiens) 6480464 INHBA protein inhibits the reaction [Calcitriol results in increased expression of BGLAP mRNA] CTD PMID:23589129 Inhba Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of INHBA protein CTD PMID:22150557 Inhba Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Ibotenic Acid results in increased expression of INHBA protein] more ... CTD PMID:22150557 and PMID:36925032 Inhba Rat carbon nanotube increases expression ISO INHBA (Homo sapiens) 6480464 Nanotubes more ... CTD PMID:20800606 more ... Inhba Rat carbon nanotube increases expression ISO Inhba (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Inhba Rat carbon nanotube decreases expression ISO INHBA (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of INHBA protein CTD PMID:23634900 Inhba Rat carmustine affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Inhba Rat CGP 52608 multiple interactions ISO INHBA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to INHBA gene] CTD PMID:28238834 Inhba Rat CHIR 99021 multiple interactions ISO INHBA (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Inhba Rat chlordecone increases expression ISO Inhba (Mus musculus) 6480464 Chlordecone results in increased expression of INHBA mRNA CTD PMID:31084621 Inhba Rat cholesterol increases expression ISO INHBA (Homo sapiens) 6480464 Cholesterol results in increased expression of INHBA mRNA CTD PMID:26296894 Inhba Rat chromium(6+) affects expression ISO Inhba (Mus musculus) 6480464 chromium hexavalent ion affects the expression of INHBA mRNA CTD PMID:28472532 Inhba Rat ciguatoxin CTX1B affects expression ISO Inhba (Mus musculus) 6480464 Ciguatoxins affects the expression of INHBA mRNA CTD PMID:18353800 Inhba Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of INHBA mRNA CTD PMID:22023808 Inhba Rat cisplatin increases expression ISO Inhba (Mus musculus) 6480464 Cisplatin results in increased expression of INHBA mRNA CTD PMID:21151649 Inhba Rat clothianidin increases expression ISO Inhba (Mus musculus) 6480464 clothianidin results in increased expression of INHBA mRNA CTD PMID:33563863 Inhba Rat cobalt atom multiple interactions ISO INHBA (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of INHBA mRNA CTD PMID:18078969 Inhba Rat colforsin daropate hydrochloride multiple interactions ISO INHBA (Homo sapiens) 6480464 FST protein inhibits the reaction [INHBA protein inhibits the reaction [Colforsin results in increased secretion of Progesterone]] and INHBA protein inhibits the reaction [Colforsin results in increased secretion of Progesterone] CTD PMID:18936084 Inhba Rat copper(II) chloride increases expression ISO INHBA (Homo sapiens) 6480464 cupric chloride results in increased expression of INHBA mRNA CTD PMID:38568856 Inhba Rat crocidolite asbestos decreases expression ISO INHBA (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of INHBA protein CTD PMID:23634900 Inhba Rat crocidolite asbestos increases expression ISO INHBA (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of INHBA mRNA CTD PMID:24160326 and PMID:25351596 Inhba Rat crocidolite asbestos affects expression ISO INHBA (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of INHBA mRNA CTD PMID:25757056 Inhba Rat crocidolite asbestos increases expression ISO Inhba (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of INHBA mRNA CTD PMID:29279043 Inhba Rat crotonaldehyde decreases expression ISO INHBA (Homo sapiens) 6480464 2-butenal results in decreased expression of INHBA mRNA CTD PMID:20471460 Inhba Rat cyclosporin A decreases expression ISO INHBA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of INHBA mRNA CTD PMID:22147139 and PMID:27989131 Inhba Rat cyhalothrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] results in decreased expression of INHBA mRNA more ... CTD PMID:33051911 more ... Inhba Rat cypermethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] results in decreased expression of INHBA mRNA more ... CTD PMID:33051911 more ... Inhba Rat dexamethasone decreases expression ISO Inhba (Mus musculus) 6480464 Dexamethasone results in decreased expression of INHBA mRNA CTD PMID:22733784 Inhba Rat dexamethasone multiple interactions ISO INHBA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of INHBA mRNA CTD PMID:28628672 Inhba Rat dexamethasone decreases expression ISO INHBA (Homo sapiens) 6480464 Dexamethasone results in decreased expression of INHBA mRNA CTD PMID:25047013 Inhba Rat dextran sulfate multiple interactions ISO Inhba (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INHBA mRNA CTD PMID:29950665 Inhba Rat diarsenic trioxide decreases expression ISO INHBA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of INHBA mRNA CTD PMID:20458559 Inhba Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of INHBA mRNA CTD PMID:21266533 Inhba Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of INHBA mRNA CTD PMID:18636392 Inhba Rat diethylstilbestrol decreases expression ISO Inhba (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of INHBA mRNA and Diethylstilbestrol results in decreased expression of INHBA protein CTD PMID:17255206 Inhba Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of INHBA mRNA CTD PMID:36653537 Inhba Rat diethylstilbestrol multiple interactions EXP 6480464 Diethylstilbestrol promotes the reaction [FSHB protein results in increased expression of INHBA mRNA] CTD PMID:15878960 Inhba Rat diisononyl phthalate decreases expression EXP 6480464 diisononyl phthalate results in decreased expression of INHBA mRNA CTD PMID:22112501 Inhba Rat dimethylselenide multiple interactions ISO INHBA (Homo sapiens) 6480464 [[Reactive Oxygen Species results in increased oxidation of dimethylselenide] which results in increased expression of DLGAP1-AS2 mRNA] which results in increased expression of INHBA mRNA CTD PMID:33656867 Inhba Rat dioxygen decreases expression ISO INHBA (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of INHBA mRNA CTD PMID:20660070 Inhba Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of INHBA mRNA CTD PMID:33729688 Inhba Rat dioxygen multiple interactions ISO Inhba (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of INHBA mRNA CTD PMID:30529165 Inhba Rat dioxygen increases expression ISO INHBA (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of INHBA mRNA CTD PMID:20042640 and PMID:26516004 Inhba Rat dizocilpine maleate multiple interactions EXP 6480464 Dizocilpine Maleate inhibits the reaction [Ibotenic Acid results in increased expression of INHBA protein] CTD PMID:36925032 Inhba Rat dorsomorphin multiple interactions ISO INHBA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Inhba Rat doxorubicin affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Inhba Rat doxorubicin affects expression ISO INHBA (Homo sapiens) 6480464 Doxorubicin affects the expression of INHBA mRNA CTD PMID:29803840 Inhba Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of INHBA mRNA CTD PMID:29391264 Inhba Rat entinostat increases expression ISO INHBA (Homo sapiens) 6480464 entinostat results in increased expression of INHBA mRNA CTD PMID:26272509 Inhba Rat entinostat multiple interactions ISO INHBA (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INHBA mRNA CTD PMID:27188386 Inhba Rat epoxiconazole decreases expression ISO Inhba (Mus musculus) 6480464 epoxiconazole results in decreased expression of INHBA mRNA CTD PMID:35436446 Inhba Rat ethanol decreases expression ISO Inhba (Mus musculus) 6480464 Ethanol results in decreased expression of INHBA mRNA CTD PMID:19167417 Inhba Rat ethanol increases expression ISO Inhba (Mus musculus) 6480464 Ethanol results in increased expression of INHBA mRNA CTD PMID:30319688 Inhba Rat eugenol decreases expression ISO Inhba (Mus musculus) 6480464 Eugenol results in decreased expression of INHBA mRNA CTD PMID:15618236 Inhba Rat fenthion increases expression ISO Inhba (Mus musculus) 6480464 Fenthion results in increased expression of INHBA mRNA CTD PMID:34813904 Inhba Rat fenvalerate multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] results in decreased expression of INHBA mRNA more ... CTD PMID:33051911 more ... Inhba Rat formaldehyde increases expression ISO INHBA (Homo sapiens) 6480464 Formaldehyde results in increased expression of INHBA mRNA CTD PMID:27664576 Inhba Rat furan decreases expression EXP 6480464 furan results in decreased expression of INHBA mRNA CTD PMID:25539665 and PMID:26194646 Inhba Rat geldanamycin increases expression ISO INHBA (Homo sapiens) 6480464 geldanamycin results in increased expression of INHBA mRNA CTD PMID:26705709 Inhba Rat genistein affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA protein affects the susceptibility to Genistein CTD PMID:22228119 Inhba Rat genistein decreases expression ISO INHBA (Homo sapiens) 6480464 Genistein results in decreased expression of INHBA mRNA and Genistein results in decreased expression of INHBA protein CTD PMID:22228119 Inhba Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of INHBA mRNA CTD PMID:33387578 Inhba Rat glyphosate decreases expression ISO INHBA (Homo sapiens) 6480464 Glyphosate results in decreased expression of INHBA mRNA CTD PMID:31295307 Inhba Rat graphite affects expression EXP 6480464 Graphite affects the expression of INHBA mRNA CTD PMID:29933104 Inhba Rat hydroquinone increases expression ISO INHBA (Homo sapiens) 6480464 hydroquinone results in increased expression of INHBA mRNA CTD PMID:31256213 Inhba Rat Ibotenic acid multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Ibotenic Acid results in increased expression of INHBA protein] and Dizocilpine Maleate inhibits the reaction [Ibotenic Acid results in increased expression of INHBA protein] CTD PMID:36925032 Inhba Rat Ibotenic acid increases expression EXP 6480464 Ibotenic Acid results in increased expression of INHBA protein CTD PMID:36925032 Inhba Rat indometacin multiple interactions ISO INHBA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of INHBA mRNA CTD PMID:28628672 Inhba Rat isoflavones decreases expression ISO INHBA (Homo sapiens) 6480464 Isoflavones results in decreased expression of INHBA mRNA CTD PMID:16365062 Inhba Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of INHBA mRNA CTD PMID:20080153 Inhba Rat L-ascorbic acid multiple interactions ISO INHBA (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Inhba Rat L-ascorbic acid 2-phosphate multiple interactions ISO INHBA (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Inhba Rat lead diacetate increases expression ISO Inhba (Mus musculus) 6480464 lead acetate results in increased expression of INHBA mRNA CTD PMID:20542052 Inhba Rat linuron decreases expression EXP 6480464 Linuron results in decreased expression of INHBA mRNA CTD PMID:36410587 Inhba Rat lipopolysaccharide increases expression EXP 329849007 LPS increases expression of activin A mRNA and protein in rat cardiac fibroblasts RGD Inhba Rat lipopolysaccharide increases expression ISO INHBA (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of INHBA mRNA CTD PMID:35811015 Inhba Rat lipopolysaccharide multiple interactions ISO INHBA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:20507366 and PMID:35811015 Inhba Rat malathion increases expression ISO INHBA (Homo sapiens) 6480464 Malathion results in increased expression of INHBA mRNA CTD PMID:37047231 Inhba Rat malathion decreases methylation ISO INHBA (Homo sapiens) 6480464 Malathion results in decreased methylation of INHBA promoter CTD PMID:37047231 Inhba Rat maneb multiple interactions ISO Inhba (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of INHBA mRNA and [Paraquat co-treated with Maneb] affects the expression of INHBA mRNA CTD PMID:22563483 and PMID:23017109 Inhba Rat methotrexate affects expression ISO Inhba (Mus musculus) 6480464 Methotrexate affects the expression of INHBA mRNA CTD PMID:18502557 Inhba Rat methylisothiazolinone increases expression ISO INHBA (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of INHBA mRNA CTD PMID:31629900 Inhba Rat methylmercury chloride increases expression ISO INHBA (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of INHBA mRNA CTD PMID:23179753 and PMID:27188386 Inhba Rat mifepristone increases expression ISO INHBA (Homo sapiens) 6480464 Mifepristone results in increased expression of INHBA mRNA CTD PMID:17584828 Inhba Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of INHBA mRNA CTD PMID:28943392 Inhba Rat naproxen multiple interactions EXP 6480464 Naproxen inhibits the reaction [Capsaicin results in increased expression of INHBA protein] CTD PMID:22150557 Inhba Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of INHBA mRNA CTD PMID:24136188 Inhba Rat neomycin increases expression ISO Inhba (Mus musculus) 6480464 Neomycin results in increased expression of INHBA mRNA CTD PMID:30626089 Inhba Rat nickel dichloride increases expression ISO INHBA (Homo sapiens) 6480464 nickel chloride results in increased expression of INHBA mRNA CTD PMID:17312168 Inhba Rat nickel sulfate increases expression ISO INHBA (Homo sapiens) 6480464 nickel sulfate results in increased expression of INHBA mRNA CTD PMID:16780908 Inhba Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of INHBA mRNA CTD PMID:24136188 Inhba Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of INHBA mRNA CTD PMID:26720608 Inhba Rat O-methyleugenol decreases expression ISO Inhba (Mus musculus) 6480464 methyleugenol results in decreased expression of INHBA mRNA CTD PMID:15618236 Inhba Rat O-methyleugenol decreases expression ISO INHBA (Homo sapiens) 6480464 methyleugenol results in decreased expression of INHBA mRNA CTD PMID:32234424 Inhba Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of INHBA mRNA CTD PMID:23358140 Inhba Rat oxazepam decreases expression ISO Inhba (Mus musculus) 6480464 Oxazepam results in decreased expression of INHBA mRNA CTD PMID:15618236 Inhba Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of INHBA mRNA CTD PMID:18636392 Inhba Rat ozone multiple interactions ISO Inhba (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of INHBA mRNA CTD PMID:34911549 Inhba Rat ozone multiple interactions ISO INHBA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of INHBA mRNA more ... CTD PMID:32699268 Inhba Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of INHBA mRNA CTD PMID:27638505 Inhba Rat paracetamol affects expression ISO Inhba (Mus musculus) 6480464 Acetaminophen affects the expression of INHBA mRNA CTD PMID:17562736 Inhba Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of INHBA mRNA CTD PMID:33387578 Inhba Rat paracetamol decreases expression ISO INHBA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of INHBA mRNA CTD PMID:22230336 and PMID:26690555 Inhba Rat paracetamol increases expression ISO INHBA (Homo sapiens) 6480464 Acetaminophen results in increased expression of INHBA protein CTD PMID:12560755 Inhba Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of INHBA mRNA CTD PMID:17077588 Inhba Rat paraquat increases expression ISO INHBA (Homo sapiens) 6480464 Paraquat results in increased expression of INHBA mRNA CTD PMID:34097952 Inhba Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of INHBA mRNA CTD PMID:32680482 Inhba Rat paraquat increases expression ISO Inhba (Mus musculus) 6480464 Paraquat results in increased expression of INHBA mRNA CTD PMID:22563483 Inhba Rat paraquat multiple interactions ISO Inhba (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of INHBA mRNA and [Paraquat co-treated with Maneb] affects the expression of INHBA mRNA CTD PMID:22563483 and PMID:23017109 Inhba Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Inhba Rat PD 0325901 multiple interactions ISO INHBA (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of INHBA mRNA CTD PMID:25119042 Inhba Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of INHBA mRNA CTD PMID:25710175 Inhba Rat pepstatin A multiple interactions ISO INHBA (Homo sapiens) 6480464 pepstatin inhibits the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of INHBA mRNA] CTD PMID:20660070 Inhba Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Inhba (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of INHBA mRNA CTD PMID:36331819 Inhba Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of INHBA mRNA CTD PMID:19162173 Inhba Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of INHBA mRNA CTD PMID:31324951 Inhba Rat phenobarbital decreases expression ISO Inhba (Mus musculus) 6480464 Phenobarbital results in decreased expression of INHBA mRNA CTD PMID:19270015 and PMID:23091169 Inhba Rat phenylmercury acetate multiple interactions ISO INHBA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INHBA mRNA CTD PMID:27188386 Inhba Rat pinostrobin increases expression ISO INHBA (Homo sapiens) 6480464 pinostrobin results in increased expression of INHBA mRNA CTD PMID:37777166 Inhba Rat pirinixic acid multiple interactions ISO Inhba (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of INHBA mRNA CTD PMID:20813756 Inhba Rat pirinixic acid decreases expression ISO Inhba (Mus musculus) 6480464 pirinixic acid results in decreased expression of INHBA mRNA CTD PMID:20813756 and PMID:23811191 Inhba Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of INHBA mRNA CTD PMID:19162173 and PMID:22112501 Inhba Rat potassium dichromate decreases expression ISO Inhba (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of INHBA mRNA CTD PMID:23608068 Inhba Rat progesterone multiple interactions ISO INHBA (Homo sapiens) 6480464 4-(2-aminoethyl)benzenesulfonylfluoride inhibits the reaction [[Estradiol co-treated with Progesterone] results in decreased expression of INHBA mRNA] more ... CTD PMID:17636213 more ... Inhba Rat progesterone increases expression ISO Inhba (Mus musculus) 6480464 Progesterone results in increased expression of INHBA mRNA CTD PMID:22285243 Inhba Rat progesterone decreases secretion ISO INHBA (Homo sapiens) 6480464 INHBA protein results in decreased secretion of Progesterone CTD PMID:20660033 Inhba Rat progesterone decreases expression ISO INHBA (Homo sapiens) 6480464 Progesterone results in decreased expression of INHBA mRNA CTD PMID:18070364 and PMID:20660070 Inhba Rat progesterone multiple interactions EXP 6480464 INHBA protein inhibits the reaction [FSHB protein results in increased secretion of Progesterone] CTD PMID:17954979 Inhba Rat progesterone increases expression ISO INHBA (Homo sapiens) 6480464 Progesterone results in increased expression of INHBA mRNA CTD PMID:17636213 Inhba Rat propanal decreases expression ISO INHBA (Homo sapiens) 6480464 propionaldehyde results in decreased expression of INHBA mRNA CTD PMID:26079696 Inhba Rat pyrethrins increases expression EXP 6480464 Pyrethrins results in increased expression of INHBA protein CTD PMID:34896426 Inhba Rat pyridaben increases expression ISO Inhba (Mus musculus) 6480464 pyridaben results in increased expression of INHBA mRNA CTD PMID:22563483 Inhba Rat raloxifene multiple interactions ISO INHBA (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in increased expression of INHBA mRNA CTD PMID:19059307 Inhba Rat reactive oxygen species multiple interactions ISO INHBA (Homo sapiens) 6480464 [[Reactive Oxygen Species results in increased oxidation of dimethylselenide] which results in increased expression of DLGAP1-AS2 mRNA] which results in increased expression of INHBA mRNA CTD PMID:33656867 Inhba Rat resveratrol increases expression ISO Inhba (Mus musculus) 6480464 resveratrol results in increased expression of INHBA mRNA CTD PMID:11588890 Inhba Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of INHBA mRNA CTD PMID:28374803 Inhba Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO INHBA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Inhba Rat SB 431542 multiple interactions ISO INHBA (Homo sapiens) 6480464 4-(5-benzo(1 more ... CTD PMID:20074812 more ... Inhba Rat serpentine asbestos decreases expression ISO INHBA (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of INHBA mRNA CTD PMID:24160326 Inhba Rat serpentine asbestos increases expression ISO INHBA (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of INHBA mRNA CTD PMID:24160326 Inhba Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of INHBA mRNA CTD PMID:15967596 Inhba Rat silicon dioxide increases expression ISO INHBA (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of INHBA mRNA and Silicon Dioxide results in increased expression of INHBA mRNA CTD PMID:22300531 more ... Inhba Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of INHBA mRNA CTD PMID:34779285 Inhba Rat silicon dioxide increases expression ISO Inhba (Mus musculus) 6480464 Silicon Dioxide results in increased expression of INHBA mRNA CTD PMID:29341224 Inhba Rat silver atom decreases expression ISO Inhba (Mus musculus) 6480464 Silver results in decreased expression of INHBA mRNA CTD PMID:27131904 Inhba Rat silver(0) decreases expression ISO Inhba (Mus musculus) 6480464 Silver results in decreased expression of INHBA mRNA CTD PMID:27131904 Inhba Rat sodium arsenite increases expression ISO INHBA (Homo sapiens) 6480464 sodium arsenite results in increased expression of INHBA mRNA CTD PMID:20020861 more ... Inhba Rat sodium arsenite decreases expression ISO Inhba (Mus musculus) 6480464 sodium arsenite results in decreased expression of INHBA mRNA CTD PMID:37682722 Inhba Rat sodium arsenite decreases expression ISO INHBA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of INHBA mRNA CTD PMID:29301061 Inhba Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of INHBA mRNA CTD PMID:25993096 Inhba Rat sodium dichromate increases expression ISO Inhba (Mus musculus) 6480464 sodium bichromate results in increased expression of INHBA mRNA CTD PMID:31558096 Inhba Rat sumatriptan multiple interactions EXP 6480464 Sumatriptan inhibits the reaction [Capsaicin results in increased expression of INHBA protein] CTD PMID:22150557 Inhba Rat sunitinib decreases expression ISO INHBA (Homo sapiens) 6480464 Sunitinib results in decreased expression of INHBA mRNA CTD PMID:31533062 Inhba Rat tamoxifen affects expression ISO Inhba (Mus musculus) 6480464 Tamoxifen affects the expression of INHBA mRNA CTD PMID:17555576 Inhba Rat tamoxifen multiple interactions ISO INHBA (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in increased expression of INHBA mRNA CTD PMID:19059307 Inhba Rat temozolomide affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Inhba Rat tert-butyl hydroperoxide increases expression ISO INHBA (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of INHBA mRNA CTD PMID:15336504 Inhba Rat testosterone multiple interactions ISO INHBA (Homo sapiens) 6480464 [FSHB protein co-treated with Testosterone] results in increased expression of INHBA mRNA CTD PMID:18535249 Inhba Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of INHBA mRNA and Carbon Tetrachloride results in increased expression of INHBA protein CTD PMID:12706302 Inhba Rat tetrachloromethane increases expression ISO Inhba (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of INHBA mRNA CTD PMID:31919559 Inhba Rat thapsigargin increases expression ISO INHBA (Homo sapiens) 6480464 Thapsigargin results in increased expression of INHBA mRNA CTD PMID:21694771 Inhba Rat Theaflavin 3,3'-digallate affects expression ISO INHBA (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of INHBA mRNA CTD PMID:34925699 Inhba Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of INHBA mRNA CTD PMID:23411599 Inhba Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of INHBA mRNA CTD PMID:28943392 Inhba Rat thiram increases expression ISO INHBA (Homo sapiens) 6480464 Thiram results in increased expression of INHBA mRNA CTD PMID:38568856 Inhba Rat titanium dioxide decreases expression ISO Inhba (Mus musculus) 6480464 titanium dioxide results in decreased expression of INHBA mRNA CTD PMID:23557971 Inhba Rat titanium dioxide multiple interactions ISO Inhba (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of INHBA mRNA CTD PMID:29950665 Inhba Rat toluene 2,4-diisocyanate increases expression ISO Inhba (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of INHBA mRNA CTD PMID:19647056 Inhba Rat topotecan affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA protein affects the susceptibility to Topotecan CTD PMID:16217747 Inhba Rat torcetrapib increases expression ISO INHBA (Homo sapiens) 6480464 torcetrapib results in increased expression of INHBA mRNA CTD PMID:23228038 Inhba Rat tremolite asbestos increases expression ISO Inhba (Mus musculus) 6480464 tremolite results in increased expression of INHBA mRNA CTD PMID:29279043 Inhba Rat trichostatin A increases expression ISO INHBA (Homo sapiens) 6480464 trichostatin A results in increased expression of INHBA mRNA CTD PMID:26705709 Inhba Rat triclosan multiple interactions ISO INHBA (Homo sapiens) 6480464 Triclosan inhibits the reaction [Lipopolysaccharides results in increased expression of INHBA mRNA] CTD PMID:20507366 Inhba Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of INHBA mRNA CTD PMID:30589522 Inhba Rat Tungsten carbide multiple interactions ISO INHBA (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of INHBA mRNA CTD PMID:18078969 Inhba Rat tunicamycin increases expression ISO INHBA (Homo sapiens) 6480464 Tunicamycin results in increased expression of INHBA mRNA CTD PMID:33545341 Inhba Rat valproic acid decreases expression ISO Inhba (Mus musculus) 6480464 Valproic Acid results in decreased expression of INHBA mRNA CTD PMID:24535564 Inhba Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of INHBA mRNA CTD PMID:29427782 Inhba Rat valproic acid multiple interactions ISO INHBA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INHBA mRNA CTD PMID:27188386 Inhba Rat valproic acid increases expression ISO INHBA (Homo sapiens) 6480464 Valproic Acid results in increased expression of INHBA mRNA CTD PMID:19101580 more ... Inhba Rat valproic acid decreases methylation ISO INHBA (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of INHBA gene CTD PMID:29154799 Inhba Rat valsartan multiple interactions ISO INHBA (Homo sapiens) 6480464 Valsartan inhibits the reaction [AGT protein results in increased expression of INHBA mRNA] CTD PMID:19225232 Inhba Rat vincaleukoblastine affects response to substance ISO INHBA (Homo sapiens) 6480464 INHBA protein affects the susceptibility to Vinblastine CTD PMID:16217747 Inhba Rat XAV939 multiple interactions ISO INHBA (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Inhba Rat xylitol increases expression ISO INHBA (Homo sapiens) 6480464 Xylitol results in increased expression of INHBA mRNA CTD PMID:32275922 Inhba Rat zearalenone decreases expression ISO Inhba (Mus musculus) 6480464 Zearalenone results in decreased expression of INHBA mRNA CTD PMID:30138655 Inhba Rat zinc atom multiple interactions ISO INHBA (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of INHBA mRNA CTD PMID:18593933 Inhba Rat zinc(0) multiple interactions ISO INHBA (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of INHBA mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-amphetamine (ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-nitrotoluene (ISO) 25-hydroxycholesterol (EXP) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-Nitrobenzanthrone (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-methylcatechol (EXP) 4-nitrotoluene (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) allethrin (EXP) alpha-pinene (ISO) amiodarone (ISO) ammonium chloride (EXP) amphotericin B (ISO) aristolochic acid A (EXP,ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) Azoxymethane (ISO) belinostat (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) buspirone (EXP) busulfan (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) capsaicin (EXP) carbon nanotube (ISO) carmustine (ISO) CGP 52608 (ISO) CHIR 99021 (ISO) chlordecone (ISO) cholesterol (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP,ISO) clothianidin (ISO) cobalt atom (ISO) colforsin daropate hydrochloride (ISO) copper(II) chloride (ISO) crocidolite asbestos (ISO) crotonaldehyde (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diethylstilbestrol (EXP,ISO) diisononyl phthalate (EXP) dimethylselenide (ISO) dioxygen (EXP,ISO) dizocilpine maleate (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) eugenol (ISO) fenthion (ISO) fenvalerate (EXP) formaldehyde (ISO) furan (EXP) geldanamycin (ISO) genistein (ISO) gentamycin (EXP) glyphosate (ISO) graphite (EXP) hydroquinone (ISO) Ibotenic acid (EXP) indometacin (ISO) isoflavones (ISO) ketamine (EXP) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (ISO) linuron (EXP) lipopolysaccharide (EXP,ISO) malathion (ISO) maneb (ISO) methotrexate (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) mifepristone (ISO) N-nitrosodiethylamine (EXP) naproxen (EXP) nefazodone (EXP) neomycin (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nimesulide (EXP) nitrofen (EXP) O-methyleugenol (ISO) ochratoxin A (EXP) oxazepam (ISO) ozone (EXP,ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (EXP,ISO) PCB138 (EXP) PD 0325901 (ISO) pentane-2,3-dione (EXP) pepstatin A (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenformin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pinostrobin (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) progesterone (EXP,ISO) propanal (ISO) pyrethrins (EXP) pyridaben (ISO) raloxifene (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sevoflurane (EXP) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) sumatriptan (EXP) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) Theaflavin 3,3'-digallate (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) topotecan (ISO) torcetrapib (ISO) tremolite asbestos (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (EXP) Tungsten carbide (ISO) tunicamycin (ISO) valproic acid (EXP,ISO) valsartan (ISO) vincaleukoblastine (ISO) XAV939 (ISO) xylitol (ISO) zearalenone (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
activin receptor signaling pathway (IEA,ISO,ISS) androgen metabolic process (IEA,ISO) androst-4-ene-3,17-dione biosynthetic process (IEA,ISO) autophagy (IDA) cardiac fibroblast cell development (IDA) cellular response to angiotensin (IEP) cellular response to cholesterol (IDA) cellular response to follicle-stimulating hormone stimulus (IDA) cellular response to hypoxia (IEP) cellular response to oxygen-glucose deprivation (IEP) cytokine-mediated signaling pathway (IEP) endodermal cell differentiation (IEA,ISO) extrinsic apoptotic signaling pathway (IEA,ISO) eyelid development in camera-type eye (IEA,ISO,ISS) GABAergic neuron differentiation (IEA,ISO) gene expression (IEA,ISO) hair follicle development (IEA,ISO,ISS) hematopoietic progenitor cell differentiation (IEA,ISO,ISS) hemoglobin biosynthetic process (IEA,ISO,ISS) lipid metabolic process (IEA,ISO) male gonad development (IEA,ISO,ISS) mesoderm formation (IEA,ISO) mesodermal cell differentiation (IEA,ISO) negative regulation of cell growth (IEA,ISO,ISS) negative regulation of cell population proliferation (IEA,ISO,ISS) negative regulation of G1/S transition of mitotic cell cycle (IEA,ISO,ISS) negative regulation of hair follicle development (IEA,ISO) odontogenesis (IEA,ISO,ISS) ovarian follicle development (IEA,ISO,ISS) positive regulation of collagen biosynthetic process (IDA) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of ERK1 and ERK2 cascade (IDA) positive regulation of erythrocyte differentiation (IEA,ISO,ISS) positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO,ISS) positive regulation of gene expression (IEA,ISO) positive regulation of ovulation (IEA,ISO,ISS) positive regulation of protein metabolic process (IEA,ISO) positive regulation of protein phosphorylation (IDA) positive regulation of SMAD protein signal transduction (IEA,ISO) positive regulation of transcription by RNA polymerase II (IDA,IEA,ISO,ISS) positive regulation of transcription by RNA polymerase III (IEP) progesterone secretion (IEA,ISO,ISS) regulation of follicle-stimulating hormone secretion (IEA,ISO,ISS) regulation of transcription by RNA polymerase II (IEA,ISO,ISS) response to aldosterone (IEP) roof of mouth development (IEA,ISO,ISS) Sertoli cell differentiation (IEA,ISO) SMAD protein signal transduction (IDA) steroid biosynthetic process (IEA,ISO) steroid metabolic process (IEA,ISO) striatal medium spiny neuron differentiation (IEA,ISO) testosterone biosynthetic process (IEA,ISO) transcription by RNA polymerase II (IEA,ISO)
1.
Regulation of inhibin/activin expression in rat early antral follicles.
Andreone L, etal., Mol Cell Endocrinol. 2009 Oct 15;309(1-2):48-54. doi: 10.1016/j.mce.2009.05.003. Epub 2009 May 21.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Activin A stimulates the proliferation and differentiation of cardiac fibroblasts via the ERK1/2 and p38-MAPK pathways.
Hu J, etal., Eur J Pharmacol. 2016 Oct 15;789:319-327. doi: 10.1016/j.ejphar.2016.07.053. Epub 2016 Jul 29.
5.
Cytokine modulation of inhibin secretion in cultured rat granulosa cells.
Imai M, etal., J Endocrinol. 1996 Dec;151(3):449-57.
6.
Downstream mRNA Target Analysis in Neonatal Hypoxic-Ischaemic Encephalopathy Identifies Novel Marker of Severe Injury: a Proof of Concept Paper.
Looney AM, etal., Mol Neurobiol. 2017 Dec;54(10):8420-8428. doi: 10.1007/s12035-016-0330-4. Epub 2016 Dec 12.
7.
Involvement of Pax-2 in the action of activin A on tubular cell regeneration.
Maeshima A, etal., J Am Soc Nephrol 2002 Dec;13(12):2850-9.
8.
Systemic Blockade of ACVR2B Ligands Protects Myocardium from Acute Ischemia-Reperfusion Injury.
Magga J, etal., Mol Ther. 2019 Mar 6;27(3):600-610. doi: 10.1016/j.ymthe.2019.01.013. Epub 2019 Jan 24.
9.
Granulosa cell tumor mutant FOXL2C134W suppresses GDF-9 and activin A-induced follistatin transcription in primary granulosa cells.
McTavish KJ, etal., Mol Cell Endocrinol. 2013 Jun 15;372(1-2):57-64. doi: 10.1016/j.mce.2013.03.021. Epub 2013 Apr 6.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Inhibin/activin subunits beta-A (-betaA) and beta-B (-betaB) are differentially localised in normal, hyperplastic and malignant human endometrial tissue.
Mylonas I, etal., Acta Histochem. 2006;108(1):1-11. Epub 2006 Jan 19.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Gene expression changes in the retina after systemic administration of aldosterone.
Ono A, etal., Jpn J Ophthalmol. 2018 Jul;62(4):499-507. doi: 10.1007/s10384-018-0595-4. Epub 2018 Apr 30.
14.
Abnormal concentration of maternal serum activin-A in gestational diseases.
Petraglia F, etal., J Clin Endocrinol Metab. 1995 Feb;80(2):558-61.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
GOA pipeline
RGD automated data pipeline
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Systemic blockade of ACVR2B ligands attenuates muscle wasting in ischemic heart failure without compromising cardiac function.
Szabó Z, etal., FASEB J. 2020 Aug;34(8):9911-9924. doi: 10.1096/fj.201903074RR. Epub 2020 May 19.
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.
Predicting complications of pregnancy with first-trimester maternal serum free-betahCG, PAPP-A and inhibin-A.
Tul N, etal., Prenat Diagn. 2003 Dec 15;23(12):990-6.
21.
Rat inhibin: molecular cloning of alpha- and beta-subunit complementary deoxyribonucleic acids and expression in the ovary.
Woodruff TK, etal., Mol Endocrinol 1987 Aug;1(8):561-8.
22.
Expression of the activin axis and neuronal rescue effects of recombinant activin A following hypoxic-ischemic brain injury in the infant rat.
Wu DD, etal., Brain Res. 1999 Jul 24;835(2):369-78. doi: 10.1016/s0006-8993(99)01638-8.
23.
Activation of activin/Smad2 and 3 signaling pathway and the potential involvement of endothelial‑mesenchymal transition in the valvular damage due to rheumatic heart disease.
Xian S, etal., Mol Med Rep. 2021 Jan;23(1):10. doi: 10.3892/mmr.2020.11648. Epub 2020 Nov 12.
24.
Activin A/Smads signaling pathway negatively regulates Oxygen Glucose Deprivation-induced autophagy via suppression of JNK and p38 MAPK pathways in neuronal PC12 cells.
Xue LX, etal., Biochem Biophys Res Commun. 2016 Nov 18;480(3):355-361. doi: 10.1016/j.bbrc.2016.10.050. Epub 2016 Oct 18.
25.
Increasing blunting of inhibin responses to dynamic ovarian challenge is associated with reproductive aging in the rat.
Yeh J and Kim B, Reprod Sci. 2007 Jan;14(1):10-9.
26.
Elevated levels of activin A in heart failure: potential role in myocardial remodeling.
Yndestad A, etal., Circulation. 2004 Mar 23;109(11):1379-85. Epub 2004 Mar 1.
27.
Lipopolysaccharide induced activin A-follistatin imbalance affects cardiac fibrosis.
Zhang WQ, etal., Chin Med J (Engl). 2012 Jun;125(12):2205-12.
28.
Activin A improves the neurological outcome after ischemic stroke in mice by promoting oligodendroglial ACVR1B-mediated white matter remyelination.
Zheng J, etal., Exp Neurol. 2021 Mar;337:113574. doi: 10.1016/j.expneurol.2020.113574. Epub 2020 Dec 18.
Inhba Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 53,787,159 - 53,810,942 (-) NCBI GRCr8 mRatBN7.2 17 49,091,635 - 49,111,573 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 49,095,920 - 49,108,982 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 52,294,696 - 52,307,755 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 56,297,581 - 56,310,640 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 50,395,401 - 50,408,458 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 51,894,869 - 51,919,998 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 51,898,217 - 51,912,496 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 49,961,222 - 49,985,653 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 57,244,466 - 57,257,531 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 57,247,306 - 57,260,372 (-) NCBI Celera 17 45,163,387 - 45,176,397 (-) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
INHBA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 41,685,114 - 41,705,406 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 41,667,168 - 41,705,834 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 41,724,712 - 41,742,688 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 41,695,126 - 41,709,231 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 41,502,035 - 41,513,299 NCBI Celera 7 41,719,390 - 41,733,490 (-) NCBI Celera Cytogenetic Map 7 p14.1 NCBI HuRef 7 41,613,504 - 41,627,622 (-) NCBI HuRef CHM1_1 7 41,731,917 - 41,746,019 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 41,843,512 - 41,867,440 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 41,768,467 - 41,782,571 (-) NCBI
Inhba Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 16,178,841 - 16,206,194 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 16,186,436 - 16,206,206 (+) Ensembl GRCm39 Ensembl GRCm38 13 16,004,256 - 16,031,609 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 16,011,851 - 16,031,621 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 16,106,308 - 16,119,044 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 15,805,362 - 15,818,098 (+) NCBI MGSCv36 mm8 Celera 13 16,301,736 - 16,314,777 (+) NCBI Celera Cytogenetic Map 13 A1 NCBI cM Map 13 5.85 NCBI
Inhba Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 2,046,588 - 2,066,609 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 2,054,879 - 2,066,628 (+) NCBI ChiLan1.0 ChiLan1.0
INHBA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 46,734,760 - 46,755,426 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 95,059,503 - 95,080,165 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 42,538,591 - 42,556,578 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 42,580,730 - 42,598,712 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 42,580,730 - 42,595,097 (+) Ensembl panpan1.1 panPan2
INHBA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 8,272,978 - 8,288,432 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 8,272,872 - 8,283,794 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 8,122,697 - 8,138,128 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 8,321,520 - 8,336,958 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 8,318,003 - 8,332,480 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 8,301,757 - 8,317,182 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 8,269,907 - 8,285,348 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 8,385,256 - 8,400,687 (+) NCBI UU_Cfam_GSD_1.0
Inhba
INHBA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 52,889,684 - 52,900,967 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 53,115,379 - 53,117,128 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 52,889,684 - 52,909,260 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 57,997,858 - 58,017,387 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 12 55,481,493 - 55,483,255 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 18 q24 NCBI
INHBA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 16,936,054 - 16,951,430 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 16,936,175 - 16,946,880 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666062 5,522,195 - 5,540,211 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Inhba
.
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 57 Interacting mature miRNAs: 61 Transcripts: ENSRNOT00000019272 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1598871 Memor5 Memory QTL 5 5.3 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 17 40540041 80387013 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354635 Bp245 Blood pressure QTL 245 6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 42073160 69599340 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 1300148 Bp192 Blood pressure QTL 192 3.47 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 17 34550843 73951021 Rat 2317060 Aia26 Adjuvant induced arthritis QTL 26 3.22 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 38281509 83281509 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2324621 Coatc5 Coat color QTL 5 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 17 31368391 73951021 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1354663 Bvd5 Brain ventricular dilatation QTL 5 3.51 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 31990784 81292925 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 724528 Uae4 Urinary albumin excretion QTL 4 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 17 35837085 69599340 Rat 631497 Bp98 Blood pressure QTL 98 3.66 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 41354651 60463643 Rat 1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 2301412 Kidm40 Kidney mass QTL 40 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 37479847 82479847 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 724549 Niddm56 Non-insulin dependent diabetes mellitus QTL 56 0.03 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 31990784 76990784 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 10450503 Bp386 Blood pressure QTL 386 0.28 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 31368391 62109574 Rat 2313854 Bp343 Blood pressure QTL 343 3.9 life span trait (VT:0005372) age at time of death (CMO:0001193) 17 31990784 50909196 Rat 2317054 Aia12 Adjuvant induced arthritis QTL 12 4.24 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 38281509 83281509 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat
INHBA-STS
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 49,096,032 - 49,096,354 (+) MAPPER mRatBN7.2 Rnor_6.0 17 51,899,267 - 51,899,588 NCBI Rnor6.0 Rnor_5.0 17 49,965,620 - 49,965,941 UniSTS Rnor5.0 RGSC_v3.4 17 57,244,587 - 57,244,908 UniSTS RGSC3.4 Celera 17 45,163,508 - 45,163,829 UniSTS Cytogenetic Map 17 q12.1 UniSTS
UniSTS:143589
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 49,096,024 - 49,096,369 (+) MAPPER mRatBN7.2 Rnor_6.0 17 51,899,259 - 51,899,603 NCBI Rnor6.0 Rnor_5.0 17 49,965,612 - 49,965,956 UniSTS Rnor5.0 RGSC_v3.4 17 57,244,579 - 57,244,923 UniSTS RGSC3.4 Celera 17 45,163,500 - 45,163,844 UniSTS Cytogenetic Map 17 q12.1 UniSTS
UniSTS:496691
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 53,791,517 - 53,791,731 (+) Marker Load Pipeline mRatBN7.2 17 49,095,992 - 49,096,207 (+) MAPPER mRatBN7.2 Rnor_6.0 17 51,899,227 - 51,899,441 NCBI Rnor6.0 Rnor_5.0 17 49,965,580 - 49,965,794 UniSTS Rnor5.0 RGSC_v3.4 17 57,244,547 - 57,244,761 UniSTS RGSC3.4 Celera 17 45,163,468 - 45,163,682 UniSTS Cytogenetic Map 17 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
111
91
90
59
25
59
6
218
97
91
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019272 ⟹ ENSRNOP00000019272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 49,095,920 - 49,108,982 (-) Ensembl Rnor_6.0 Ensembl 17 51,898,217 - 51,912,496 (-) Ensembl
RefSeq Acc Id:
NM_017128 ⟹ NP_058824
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 53,791,436 - 53,804,508 (-) NCBI mRatBN7.2 17 49,095,912 - 49,108,982 (-) NCBI Rnor_6.0 17 51,899,146 - 51,912,423 (-) NCBI Rnor_5.0 17 49,961,222 - 49,985,653 (-) NCBI RGSC_v3.4 17 57,244,466 - 57,257,531 (-) RGD Celera 17 45,163,387 - 45,176,397 (-) NCBI
Sequence:
GACAGCTCTGACCTCATGAGACAAGAGCCGGCTGGCAAAACAGAAGGGACCCGAAAGAGAATTTGCTGAAGAGGAGAAGGAAAAAAAAAGTCCAAAAAACCTGTACGTGAGGGGTGGGGAGGAAAAGC
hide sequence
RefSeq Acc Id:
XM_006254001 ⟹ XP_006254063
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 53,787,159 - 53,809,889 (-) NCBI mRatBN7.2 17 49,091,635 - 49,111,573 (-) NCBI Rnor_6.0 17 51,894,869 - 51,918,092 (-) NCBI Rnor_5.0 17 49,961,222 - 49,985,653 (-) NCBI
Sequence:
TTGTAGATAGCTTCAACCTTCTTATTGGCTTTTGCTTTTTGGATCTATAATTGGACAACAGGTT
hide sequence
RefSeq Acc Id:
XM_008771712 ⟹ XP_008769934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 53,787,159 - 53,809,890 (-) NCBI mRatBN7.2 17 49,091,635 - 49,111,204 (-) NCBI Rnor_6.0 17 51,894,869 - 51,918,092 (-) NCBI
Sequence:
TTGTAGATAGCTTCAACCTTCTTATTGGCTTTTGCTTTTTGGATCTATAATTGGACAACAGGTTGTAGAGGAATCTTTGTGGATAAACAAAACTGGAGTAGAATCAAAGCCTCTGCTCTGTTATCAGT
hide sequence
RefSeq Acc Id:
XM_063276286 ⟹ XP_063132356
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 53,787,159 - 53,810,942 (-) NCBI
RefSeq Acc Id:
XM_063276287 ⟹ XP_063132357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 53,787,159 - 53,809,890 (-) NCBI
RefSeq Acc Id:
NP_058824 ⟸ NM_017128
- Peptide Label:
preproprotein
- UniProtKB:
P18331 (UniProtKB/Swiss-Prot), A6K9B0 (UniProtKB/TrEMBL)
- Sequence:
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALATLPKDGPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAE
hide sequence
RefSeq Acc Id:
XP_006254063 ⟸ XM_006254001
- Peptide Label:
isoform X1
- UniProtKB:
P18331 (UniProtKB/Swiss-Prot), A6K9B0 (UniProtKB/TrEMBL)
- Sequence:
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALATLPKDGPNSQPEMVEAVKKHILN
hide sequence
RefSeq Acc Id:
XP_008769934 ⟸ XM_008771712
- Peptide Label:
isoform X1
- UniProtKB:
P18331 (UniProtKB/Swiss-Prot), A6K9B0 (UniProtKB/TrEMBL)
- Sequence:
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALATLPKDGPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAE
hide sequence
Ensembl Acc Id:
ENSRNOP00000019272 ⟸ ENSRNOT00000019272
RefSeq Acc Id:
XP_063132356 ⟸ XM_063276286
- Peptide Label:
isoform X1
- UniProtKB:
P18331 (UniProtKB/Swiss-Prot), A6K9B0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063132357 ⟸ XM_063276287
- Peptide Label:
isoform X1
- UniProtKB:
P18331 (UniProtKB/Swiss-Prot), A6K9B0 (UniProtKB/TrEMBL)
RGD ID: 13700511 Promoter ID: EPDNEW_R11033 Type: initiation region Name: Inhba_1 Description: inhibin beta A subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 51,912,433 - 51,912,493 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-05-25
Inhba
inhibin subunit beta A
Inhba
inhibin beta A subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-06-01
Inhba
inhibin beta A subunit
Inhba
inhibin beta-A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Inhba
inhibin beta-A
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_physical_interaction
interacts with beta B subunit to produce heterodimer which inhibits secretion of FSH from pituitary gonadotrophs
61638
gene_regulation
expression is stimulated by FSH
61638
