Symbol:
Dck
Name:
deoxycytidine kinase
RGD ID:
620667
Description:
Enables deoxycytidine kinase activity; heterocyclic compound binding activity; and magnesium ion binding activity. Involved in deoxycytidine metabolic process. Predicted to be located in nucleoplasm. Predicted to be active in mitochondrion. Orthologous to human DCK (deoxycytidine kinase); PARTICIPATES IN gemcitabine pharmacodynamics pathway; gemcitabine pharmacokinetics pathway; lamivudine pharmacokinetics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deoxyadenosine kinase; deoxyguanosine kinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DCK (deoxycytidine kinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Dck (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dck (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DCK (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DCK (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dck (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DCK (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DCK (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dck (deoxycytidine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DCK (deoxycytidine kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dck (deoxycytidine kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dck (deoxycytidine kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dck.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 19,589,298 - 19,610,326 (-) NCBI GRCr8 mRatBN7.2 14 19,305,218 - 19,326,247 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 19,305,218 - 19,326,247 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 19,294,940 - 19,315,959 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 20,613,805 - 20,634,822 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 19,316,197 - 19,337,208 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 20,935,442 - 20,952,939 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 20,935,369 - 20,953,095 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 20,845,716 - 20,863,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 20,886,700 - 20,904,305 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 20,886,695 - 20,904,305 (-) NCBI Celera 14 18,648,191 - 18,665,287 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dck Rat 1,1-dichloroethene increases expression ISO RGD:1552352 6480464 vinylidene chloride results in increased expression of DCK mRNA CTD PMID:26682919 Dck Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1552352 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Dck Rat 1,2-dichloroethane decreases expression ISO RGD:1552352 6480464 ethylene dichloride results in decreased expression of DCK mRNA CTD PMID:28960355 Dck Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552352 6480464 1,2-Dimethylhydrazine results in decreased expression of DCK mRNA CTD PMID:22206623 Dck Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DCK mRNA CTD PMID:29097150 Dck Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DCK mRNA CTD PMID:32145629 Dck Rat 17beta-estradiol decreases expression ISO RGD:1552352 6480464 Estradiol results in decreased expression of DCK mRNA CTD PMID:39298647 Dck Rat 2'-deoxycytidine affects binding ISO RGD:1344747 6480464 Deoxycytidine binds to DCK protein CTD PMID:17530837 Dck Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1552352 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Dck Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1552352 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Dck Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1552352 6480464 Tetrachlorodibenzodioxin results in increased expression of DCK mRNA CTD PMID:19465110 Dck Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552352 6480464 Tetrachlorodibenzodioxin affects the expression of DCK mRNA CTD PMID:21570461 Dck Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1552352 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Dck Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1552352 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of DCK mRNA CTD PMID:20188158 Dck Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of DCK protein; alpha-Chlorohydrin results in decreased expression of more ... CTD PMID:26597043 Dck Rat 3-methylcholanthrene increases expression ISO RGD:1552352 6480464 Methylcholanthrene results in increased expression of DCK mRNA CTD PMID:20713471 Dck Rat 4,4'-diaminodiphenylmethane affects expression ISO RGD:1552352 6480464 4,4'-diaminodiphenylmethane affects the expression of DCK mRNA CTD PMID:18648102 Dck Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1552352 6480464 bisphenol S results in decreased expression of DCK mRNA CTD PMID:33297965 Dck Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:1552352 6480464 Oxazolone results in increased expression of DCK mRNA CTD PMID:21404309 Dck Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1552352 6480464 Fenretinide results in decreased expression of DCK mRNA CTD PMID:28973697 Dck Rat 5-aza-2'-deoxycytidine affects binding EXP 2300399 5-aza-2'-deoxycytidine binds to Dck protein RGD Dck Rat 5-fluorouracil multiple interactions ISO RGD:1344747 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of DCK mRNA] CTD PMID:15016801 Dck Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DCK mRNA CTD PMID:24780913 Dck Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DCK mRNA CTD PMID:31881176 Dck Rat acrolein multiple interactions ISO RGD:1344747 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Dck Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of DCK mRNA CTD PMID:28959563 Dck Rat aflatoxin B1 affects expression ISO RGD:1344747 6480464 Aflatoxin B1 affects the expression of DCK protein CTD PMID:20106945 Dck Rat aflatoxin M1 decreases expression ISO RGD:1344747 6480464 Aflatoxin M1 results in decreased expression of DCK mRNA CTD PMID:30928695 Dck Rat all-trans-retinoic acid decreases expression ISO RGD:1344747 6480464 Tretinoin results in decreased expression of DCK mRNA CTD PMID:17218384|PMID:33167477 Dck Rat alpha-pinene multiple interactions ISO RGD:1344747 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Dck Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DCK mRNA CTD PMID:16483693 Dck Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of DCK mRNA CTD PMID:30779732 Dck Rat arsenite(3-) multiple interactions ISO RGD:1344747 6480464 arsenite inhibits the reaction [G3BP1 protein binds to DCK mRNA] CTD PMID:32406909 Dck Rat azathioprine decreases expression ISO RGD:1344747 6480464 Azathioprine results in decreased expression of DCK mRNA CTD PMID:22623647 Dck Rat benzo[a]pyrene decreases expression ISO RGD:1344747 6480464 Benzo(a)pyrene results in decreased expression of DCK mRNA CTD PMID:20064835 Dck Rat benzo[a]pyrene increases expression ISO RGD:1344747 6480464 Benzo(a)pyrene results in increased expression of DCK mRNA CTD PMID:32234424 Dck Rat benzo[a]pyrene increases expression ISO RGD:1552352 6480464 Benzo(a)pyrene results in increased expression of DCK mRNA CTD PMID:21715664 Dck Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DCK mRNA CTD PMID:25181051 Dck Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DCK mRNA CTD PMID:32145629 Dck Rat bisphenol A decreases expression ISO RGD:1344747 6480464 bisphenol A results in decreased expression of DCK mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:33376534 Dck Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of DCK promoter CTD PMID:22457795 Dck Rat cadmium dichloride decreases expression ISO RGD:1344747 6480464 Cadmium Chloride results in decreased expression of DCK mRNA CTD PMID:38568856 Dck Rat cadmium dichloride decreases expression ISO RGD:1552352 6480464 Cadmium Chloride results in decreased expression of DCK mRNA CTD PMID:24982889 Dck Rat cadmium sulfate multiple interactions ISO RGD:1552352 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of DCK mRNA] CTD PMID:16221973 Dck Rat caffeine affects phosphorylation ISO RGD:1344747 6480464 Caffeine affects the phosphorylation of DCK protein CTD PMID:35688186 Dck Rat carbon nanotube increases expression ISO RGD:1552352 6480464 Nanotubes, Carbon analog results in increased expression of DCK mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Dck Rat cisplatin increases phosphorylation ISO RGD:1552352 6480464 Cisplatin results in increased phosphorylation of DCK protein CTD PMID:22006019 Dck Rat cisplatin multiple interactions ISO RGD:1344747 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of DCK mRNA CTD PMID:30871063 Dck Rat cisplatin increases expression ISO RGD:1344747 6480464 Cisplatin results in increased expression of DCK mRNA CTD PMID:27594783 Dck Rat clobetasol increases expression ISO RGD:1552352 6480464 Clobetasol results in increased expression of DCK mRNA CTD PMID:27462272 Dck Rat copper(II) sulfate decreases expression ISO RGD:1344747 6480464 Copper Sulfate results in decreased expression of DCK mRNA CTD PMID:19549813 Dck Rat coumestrol increases expression ISO RGD:1344747 6480464 Coumestrol results in increased expression of DCK mRNA CTD PMID:19167446 Dck Rat coumestrol multiple interactions ISO RGD:1344747 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DCK mRNA CTD PMID:19167446 Dck Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of DCK mRNA CTD PMID:26577399|PMID:27523638 Dck Rat cyclosporin A decreases expression ISO RGD:1344747 6480464 Cyclosporine results in decreased expression of DCK mRNA CTD PMID:20106945|PMID:21632981 Dck Rat cyclosporin A affects expression ISO RGD:1344747 6480464 Cyclosporine affects the expression of DCK mRNA CTD PMID:25562108 Dck Rat cytarabine affects binding EXP 2300399 Cytarabine binds to Dck protein RGD Dck Rat cytarabine decreases response to substance ISO RGD:1344747 6480464 DCK gene polymorphism results in decreased susceptibility to Cytarabine CTD PMID:18381442 Dck Rat cytarabine affects binding ISO RGD:1344747 6480464 Cytarabine binds to DCK protein CTD PMID:1318170 Dck Rat dCTP increases metabolic processing ISO RGD:1344747 6480464 DCK protein results in increased metabolism of 2'-deoxycytidine 5'-triphosphate CTD PMID:9586059 Dck Rat dCTP affects activity ISO RGD:1552352 6480464 2'-deoxycytidine 5'-triphosphate affects the activity of DCK protein CTD PMID:9586059 Dck Rat DDE increases expression ISO RGD:1344747 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of DCK mRNA CTD PMID:38568856 Dck Rat Dibutyl phosphate affects expression ISO RGD:1344747 6480464 di-n-butylphosphoric acid affects the expression of DCK mRNA CTD PMID:37042841 Dck Rat dicrotophos decreases expression ISO RGD:1344747 6480464 dicrotophos results in decreased expression of DCK mRNA CTD PMID:28302478 Dck Rat dorsomorphin multiple interactions ISO RGD:1344747 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dck Rat doxorubicin decreases expression ISO RGD:1344747 6480464 Doxorubicin results in decreased expression of DCK mRNA CTD PMID:29803840 Dck Rat emtricitabine multiple interactions ISO RGD:1344747 6480464 DCK protein results in increased phosphorylation of and results in increased activity of Emtricitabine CTD PMID:17530837 Dck Rat emtricitabine affects binding ISO RGD:1344747 6480464 Emtricitabine binds to DCK protein CTD PMID:17530837 Dck Rat ethanol increases expression ISO RGD:1552352 6480464 Ethanol results in increased expression of DCK mRNA CTD PMID:30319688 Dck Rat fenpyroximate decreases expression ISO RGD:1344747 6480464 fenpyroximate results in decreased expression of DCK mRNA CTD PMID:33512557 Dck Rat folic acid decreases expression ISO RGD:1552352 6480464 Folic Acid results in decreased expression of DCK mRNA CTD PMID:25629700 Dck Rat FR900359 decreases phosphorylation ISO RGD:1344747 6480464 FR900359 results in decreased phosphorylation of DCK protein CTD PMID:37730182 Dck Rat furan increases expression EXP 6480464 furan results in increased expression of DCK mRNA CTD PMID:25539665 Dck Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DCK mRNA CTD PMID:33387578 Dck Rat GSK-J4 increases expression ISO RGD:1344747 6480464 GSK-J4 results in increased expression of DCK mRNA CTD PMID:29301935 Dck Rat hydrogen peroxide increases phosphorylation ISO RGD:1552352 6480464 Hydrogen Peroxide results in increased phosphorylation of DCK protein CTD PMID:31494107 Dck Rat hydrogen peroxide multiple interactions ISO RGD:1552352 6480464 N-(oxo-5,6-dihydrophenanthridin-2-yl)-N,N-dimethylacetamide hydrochloride promotes the reaction [Hydrogen Peroxide results in increased phosphorylation of DCK protein] CTD PMID:31494107 Dck Rat ivermectin decreases expression ISO RGD:1344747 6480464 Ivermectin results in decreased expression of DCK protein CTD PMID:32959892 Dck Rat lamivudine multiple interactions ISO RGD:1344747 6480464 DCK protein results in increased phosphorylation of and results in increased activity of Lamivudine CTD PMID:17530837 Dck Rat methyl methanesulfonate increases expression ISO RGD:1344747 6480464 Methyl Methanesulfonate results in increased expression of DCK mRNA CTD PMID:23649840 Dck Rat miconazole increases expression ISO RGD:1552352 6480464 Miconazole results in increased expression of DCK mRNA CTD PMID:27462272 Dck Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DCK gene CTD PMID:33148267 Dck Rat N-nitrosodiethylamine increases expression ISO RGD:1552352 6480464 Diethylnitrosamine results in increased expression of DCK mRNA CTD PMID:17854601 Dck Rat N-nitrosodiethylamine multiple interactions ISO RGD:1552352 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of DCK mRNA] CTD PMID:17854601 Dck Rat okadaic acid increases expression ISO RGD:1344747 6480464 Okadaic Acid results in increased expression of DCK mRNA CTD PMID:38832940 Dck Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of DCK mRNA CTD PMID:25729387 Dck Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DCK mRNA CTD PMID:25729387 Dck Rat ozone decreases expression ISO RGD:1552352 6480464 Ozone results in decreased expression of DCK mRNA CTD PMID:24336422 Dck Rat ozone multiple interactions ISO RGD:1552352 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Dck Rat ozone multiple interactions ISO RGD:1344747 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Dck Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DCK mRNA CTD PMID:33387578 Dck Rat PCB138 multiple interactions ISO RGD:1552352 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Dck Rat pentachlorophenol increases expression ISO RGD:1552352 6480464 Pentachlorophenol results in increased expression of DCK mRNA CTD PMID:23892564 Dck Rat perfluorohexanesulfonic acid increases expression ISO RGD:1552352 6480464 perfluorohexanesulfonic acid results in increased expression of DCK mRNA CTD PMID:37995155 Dck Rat perfluorononanoic acid decreases expression ISO RGD:1344747 6480464 perfluoro-n-nonanoic acid results in decreased expression of DCK mRNA CTD PMID:32588087 Dck Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DCK gene CTD PMID:33148267 Dck Rat pirinixic acid decreases expression ISO RGD:1552352 6480464 pirinixic acid results in decreased expression of DCK mRNA CTD PMID:18445702 Dck Rat pirinixic acid increases expression ISO RGD:1552352 6480464 pirinixic acid results in increased expression of DCK mRNA CTD PMID:23811191 Dck Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of DCK mRNA CTD PMID:26923065 Dck Rat quercetin decreases expression ISO RGD:1344747 6480464 Quercetin results in decreased expression of DCK mRNA CTD PMID:21632981 Dck Rat resveratrol multiple interactions ISO RGD:1344747 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DCK mRNA CTD PMID:19167446 Dck Rat rotenone decreases expression ISO RGD:1344747 6480464 Rotenone results in decreased expression of DCK mRNA CTD PMID:33512557 Dck Rat SB 431542 multiple interactions ISO RGD:1344747 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dck Rat silicon dioxide increases expression ISO RGD:1344747 6480464 Silicon Dioxide analog results in increased expression of DCK mRNA CTD PMID:25895662 Dck Rat sodium arsenite increases expression ISO RGD:1344747 6480464 sodium arsenite results in increased expression of DCK mRNA CTD PMID:28595984 Dck Rat sodium arsenite decreases expression ISO RGD:1344747 6480464 sodium arsenite results in decreased expression of DCK mRNA CTD PMID:38568856 Dck Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of DCK mRNA CTD PMID:22110744 Dck Rat tamoxifen affects expression ISO RGD:1552352 6480464 Tamoxifen affects the expression of DCK mRNA CTD PMID:20937368 Dck Rat Tanshinone I increases expression ISO RGD:1344747 6480464 tanshinone results in increased expression of DCK mRNA CTD PMID:15849732 Dck Rat tetrachloromethane increases expression ISO RGD:1552352 6480464 Carbon Tetrachloride results in increased expression of DCK mRNA CTD PMID:17484886 Dck Rat tetrachloromethane affects expression ISO RGD:1552352 6480464 Carbon Tetrachloride affects the expression of DCK mRNA CTD PMID:31919559 Dck Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of DCK protein CTD PMID:35544339 Dck Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DCK mRNA CTD PMID:23411599|PMID:34492290 Dck Rat titanium dioxide increases expression ISO RGD:1552352 6480464 titanium dioxide results in increased expression of DCK mRNA CTD PMID:23557971 Dck Rat titanium dioxide decreases methylation ISO RGD:1552352 6480464 titanium dioxide results in decreased methylation of DCK promoter CTD PMID:35295148 Dck Rat titanium dioxide decreases expression ISO RGD:1552352 6480464 titanium dioxide results in decreased expression of DCK mRNA CTD PMID:29264374 Dck Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DCK mRNA CTD PMID:25729387 Dck Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of DCK mRNA CTD PMID:25729387 Dck Rat trichostatin A decreases expression ISO RGD:1344747 6480464 trichostatin A results in decreased expression of DCK mRNA CTD PMID:26272509 Dck Rat trichostatin A multiple interactions ISO RGD:1344747 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dck Rat trimellitic anhydride increases expression ISO RGD:1552352 6480464 trimellitic anhydride results in increased expression of DCK mRNA CTD PMID:19042947 Dck Rat triphenyl phosphate affects expression ISO RGD:1344747 6480464 triphenyl phosphate affects the expression of DCK mRNA CTD PMID:37042841 Dck Rat tris(2-butoxyethyl) phosphate increases expression ISO RGD:1344747 6480464 tris(2-butoxyethyl) phosphate results in increased expression of DCK mRNA CTD PMID:29024780 Dck Rat valproic acid decreases expression ISO RGD:1344747 6480464 Valproic Acid results in decreased expression of DCK mRNA CTD PMID:23179753 Dck Rat zalcitabine affects response to substance ISO RGD:1344747 6480464 DCK protein affects the susceptibility to Zalcitabine CTD PMID:11952160 Dck Rat zinc atom decreases expression ISO RGD:1344747 6480464 Zinc deficiency results in decreased expression of DCK mRNA CTD PMID:22171008 Dck Rat zinc(0) decreases expression ISO RGD:1344747 6480464 Zinc deficiency results in decreased expression of DCK mRNA CTD PMID:22171008
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2'-deoxycytidine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) arsenite(3-) (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) caffeine (ISO) carbon nanotube (ISO) cisplatin (ISO) clobetasol (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (EXP,ISO) dCTP (ISO) DDE (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) emtricitabine (ISO) ethanol (ISO) fenpyroximate (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) GSK-J4 (ISO) hydrogen peroxide (ISO) ivermectin (ISO) lamivudine (ISO) methyl methanesulfonate (ISO) miconazole (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP) PCB138 (ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) permethrin (EXP) pirinixic acid (ISO) poly(I:C) (EXP) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) tamoxifen (ISO) Tanshinone I (ISO) tetrachloromethane (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) zalcitabine (ISO) zinc atom (ISO) zinc(0) (ISO)
Molecular Function
ATP binding (IDA,IEA) cytidine kinase activity (IEA,ISO) deoxyadenosine kinase activity (IEA,ISO) deoxycytidine kinase activity (IBA,IDA,IEA,IMP,ISO) deoxyguanosine kinase activity (IEA,ISO) deoxynucleoside kinase activity (IEA) deoxyribonucleoside binding (IPI) kinase activity (IEA) magnesium ion binding (IDA) nucleotide binding (IEA) protein binding (ISO) protein homodimerization activity (IEA,ISO) pyrimidine deoxyribonucleoside binding (IDA,IMP) transferase activity (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
3.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
5.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Deoxycytidine kinase and thymidine kinase activities in rat brain.
Singhal RL and Weber G, Oncol Res. 1993;5(4-5):191-5.
9.
Transfection of wild-type deoxycytidine kinase (dck) cDNA into an AraC- and DAC-resistant rat leukemic cell line of clonal origin fully restores drug sensitivity.
Stegmann AP, etal., Blood. 1995 Mar 1;85(5):1188-94.
10.
Cloning of the Dck gene encoding rat deoxycytidine kinase.
Stegmann AP, etal., Gene 1994 Dec 15;150(2):351-4.
11.
Role of deoxycytidine kinase in an in vitro model for AraC- and DAC-resistance: substrate-enzyme interactions with deoxycytidine, 1-beta-D-arabinofuranosylcytosine and 5-aza-2'-deoxycytidine.
Stegmann AP, etal., Leukemia. 1993 Jul;7(7):1005-11.
Dck Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 19,589,298 - 19,610,326 (-) NCBI GRCr8 mRatBN7.2 14 19,305,218 - 19,326,247 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 19,305,218 - 19,326,247 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 19,294,940 - 19,315,959 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 20,613,805 - 20,634,822 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 19,316,197 - 19,337,208 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 20,935,442 - 20,952,939 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 20,935,369 - 20,953,095 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 20,845,716 - 20,863,008 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 20,886,700 - 20,904,305 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 20,886,695 - 20,904,305 (-) NCBI Celera 14 18,648,191 - 18,665,287 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
DCK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 70,993,649 - 71,030,914 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 70,992,538 - 71,030,914 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 71,859,366 - 71,896,631 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 72,078,256 - 72,115,477 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 72,224,426 - 72,261,648 NCBI Celera 4 69,216,290 - 69,253,648 (+) NCBI Celera Cytogenetic Map 4 q13.3 NCBI HuRef 4 67,664,417 - 67,701,817 (+) NCBI HuRef CHM1_1 4 71,895,140 - 71,932,501 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 74,336,086 - 74,373,339 (+) NCBI T2T-CHM13v2.0
Dck Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 88,912,872 - 88,931,136 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 88,912,855 - 88,931,140 (+) Ensembl GRCm39 Ensembl GRCm38 5 88,765,013 - 88,783,277 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 88,764,996 - 88,783,281 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 89,194,038 - 89,212,302 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 89,839,588 - 89,857,838 (+) NCBI MGSCv36 mm8 Celera 5 86,914,328 - 86,932,500 (+) NCBI Celera Cytogenetic Map 5 E1 NCBI cM Map 5 43.96 NCBI
Dck Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 2,031,258 - 2,067,210 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 2,031,851 - 2,067,005 (-) NCBI ChiLan1.0 ChiLan1.0
DCK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 59,054,071 - 59,094,834 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 59,249,120 - 59,286,370 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 53,193,475 - 53,230,708 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 59,537,350 - 59,574,537 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 59,536,997 - 59,574,537 (-) Ensembl panpan1.1 panPan2
DCK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 60,206,742 - 60,236,338 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 60,205,937 - 60,235,678 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 59,940,643 - 59,971,419 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 61,012,272 - 61,043,696 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 61,011,720 - 61,076,885 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 60,627,511 - 60,658,525 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 60,119,020 - 60,150,439 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 61,266,521 - 61,297,680 (+) NCBI UU_Cfam_GSD_1.0
Dck Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 15,366,311 - 15,391,122 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936598 3,817,994 - 3,843,241 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936598 3,819,239 - 3,846,692 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DCK
DCK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 19,503,855 - 19,535,355 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 19,504,038 - 19,535,674 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666084 3,326,990 - 3,358,445 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dck
.
Predicted Target Of
Count of predictions: 221 Count of miRNA genes: 158 Interacting mature miRNAs: 187 Transcripts: ENSRNOT00000004440 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 631528 Scl11 Serum cholesterol level QTL 11 4.9 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 14 17573412 19726296 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 1300140 Srn3 Serum renin concentration QTL 3 3.19 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 14875168 30883947 Rat
RH141381
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 19,306,660 - 19,306,840 (+) MAPPER mRatBN7.2 Rnor_6.0 14 20,933,590 - 20,933,769 NCBI Rnor6.0 Rnor_5.0 14 20,843,864 - 20,844,043 UniSTS Rnor5.0 RGSC_v3.4 14 20,884,848 - 20,885,027 UniSTS RGSC3.4 Celera 14 18,646,339 - 18,646,518 UniSTS RH 3.4 Map 14 305.39 UniSTS Cytogenetic Map 14 p22 UniSTS
AI176044
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 19,591,237 - 19,591,432 (+) Marker Load Pipeline mRatBN7.2 14 19,307,157 - 19,307,352 (+) MAPPER mRatBN7.2 Rnor_6.0 14 20,934,087 - 20,934,281 NCBI Rnor6.0 Rnor_5.0 14 20,844,361 - 20,844,555 UniSTS Rnor5.0 RGSC_v3.4 14 20,885,345 - 20,885,539 UniSTS RGSC3.4 Celera 14 18,646,836 - 18,647,030 UniSTS RH 3.4 Map 14 284.8 UniSTS Cytogenetic Map 14 p22 UniSTS
AI231703
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 19,324,261 - 19,324,422 (+) MAPPER mRatBN7.2 Rnor_6.0 14 20,951,257 - 20,951,417 NCBI Rnor6.0 Rnor_5.0 14 20,861,326 - 20,861,486 UniSTS Rnor5.0 RGSC_v3.4 14 20,902,623 - 20,902,783 UniSTS RGSC3.4 Celera 14 18,663,605 - 18,663,765 UniSTS RH 3.4 Map 14 284.3 UniSTS Cytogenetic Map 14 p22 UniSTS
GDB:437189
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 97,517,490 - 97,517,920 (+) MAPPER mRatBN7.2 Rnor_6.0 14 108,306,182 - 108,306,611 NCBI Rnor6.0 Rnor_5.0 14 105,142,039 - 105,142,468 UniSTS Rnor5.0 RGSC_v3.4 14 104,467,365 - 104,467,794 UniSTS RGSC3.4 Celera 14 96,494,461 - 96,494,890 UniSTS Cytogenetic Map 14 p22 UniSTS Cytogenetic Map 14 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004440 ⟹ ENSRNOP00000004440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 19,305,218 - 19,326,247 (-) Ensembl Rnor_6.0 Ensembl 14 20,935,369 - 20,953,095 (-) Ensembl
RefSeq Acc Id:
NM_024158 ⟹ NP_077072
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 19,589,298 - 19,610,326 (-) NCBI mRatBN7.2 14 19,305,218 - 19,326,247 (-) NCBI Rnor_6.0 14 20,935,442 - 20,952,939 (-) NCBI Rnor_5.0 14 20,845,716 - 20,863,008 (-) NCBI RGSC_v3.4 14 20,886,700 - 20,904,305 (-) RGD Celera 14 18,648,191 - 18,665,287 (-) RGD
Sequence:
CCGCCTTCCTGAGGTCCCGCGTCCTTAGCATGGCCACCCCACCTAAGAGGTTCTGCTCTTCTCCCTCAACCAGCTCTGAGGGGACCCGCATCAAGAAGATCTCCATCGAAGGGAACATCGCTGCCGGG
hide sequence
RefSeq Acc Id:
NP_077072 ⟸ NM_024158
- UniProtKB:
P48769 (UniProtKB/Swiss-Prot), G3V6E9 (UniProtKB/TrEMBL), A6KKI1 (UniProtKB/TrEMBL)
- Sequence:
MATPPKRFCSSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCNVQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFIFQSYACLSRIRAQLASLNGSLRDAEKPVLFFER
hide sequence
Ensembl Acc Id:
ENSRNOP00000004440 ⟸ ENSRNOT00000004440
RGD ID: 13699238 Promoter ID: EPDNEW_R9763 Type: initiation region Name: Dck_1 Description: deoxycytidine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 20,953,031 - 20,953,091 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Dck
deoxycytidine kinase
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Dck
deoxycytidine kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
high expression in thymus and weak expression in liver and lung
727775
gene_homology
shows 89.7 and 92.2% nucleotide identity with the human and mouse Dck
727775
gene_protein
encodes 260 aa protein
727775
