Atp5pd (ATP synthase peripheral stalk subunit d)

Advanced Search (OLGA)

Gene: Atp5pd (ATP synthase peripheral stalk subunit d) Rattus norvegicus

Analyze

Symbol:

Atp5pd

Name:

ATP synthase peripheral stalk subunit d

RGD ID:

620083

Description:

Predicted to enable proton transmembrane transporter activity. Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Involved in cellular response to peptide. Part of mitochondrial proton-transporting ATP synthase complex and proton-transporting ATP synthase complex, coupling factor F(o). Used to study depressive disorder. Biomarker of congenital hypothyroidism. Orthologous to human ATP5PD (ATP synthase peripheral stalk subunit d); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-bromopropane; 2,2',5,5'-tetrachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

ATP synthase subunit d; ATP synthase subunit d, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; Atp5h; Atp5jd; ATPase subunit d; ATPQ

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5PD (ATP synthase peripheral stalk subunit d)	RGD	RGD
Mus musculus (house mouse):	Atp5pd (ATP synthase peripheral stalk subunit d)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Atp5pd (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5PD (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC102151342 (ATP synthase subunit d, mitochondrial-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5pd (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5PD (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5PD (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5pd (ATP synthase peripheral stalk subunit d)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Atp5pd (ATP synthase peripheral stalk subunit d)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	ATP5PD (ATP synthase peripheral stalk subunit d)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5pd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATP7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ATPsynD	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atp-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	knon	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	atp5pd	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Atp5hl1 Atp5pd-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,156,673 - 101,161,926 (-)	NCBI		GRCr8
mRatBN7.2	10	100,657,700 - 100,662,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,657,708 - 100,663,479 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	105,717,816 - 105,722,979 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,180,884 - 105,186,047 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,578,681 - 100,583,844 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	103,967,340 - 103,972,552 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	103,967,312 - 103,972,668 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,306,420 - 104,330,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	105,474,107 - 105,499,413 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,421,360 - 172,421,928 (-)	NCBI
Celera	10	99,232,881 - 99,238,044 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (IDA)

congenital hypothyroidism (IEP)

depressive disorder (IDA)

Experimental Diabetes Mellitus (IEP)

hepatocellular carcinoma (ISO)

lung adenocarcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-bromopropane (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3-methyladenine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

chloropicrin (ISO)

clobetasol (ISO)

clofibrate (EXP)

clotrimazole (EXP)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

corosolic acid (ISO)

cypermethrin (EXP)

deoxynivalenol (ISO)

diallyl trisulfide (ISO)

dicrotophos (ISO)

diquat (ISO)

disodium selenite (ISO)

diuron (ISO)

dopamine (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

isoprenaline (EXP)

ivermectin (ISO)

josamycin (ISO)

lamivudine (ISO)

lipopolysaccharide (ISO)

menthofuran (EXP)

methamphetamine (EXP)

methapyrilene (ISO)

methimazole (EXP)

metronidazole (EXP)

microcystin RR (ISO)

minocycline (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

neomycin (EXP)

paracetamol (ISO)

paraquat (ISO)

PCB138 (EXP)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

Propiverine (EXP)

rac-lactic acid (ISO)

sarin (EXP)

selenium atom (ISO)

sodium arsenite (EXP)

sodium dodecyl sulfate (ISO)

sodium nitrate (ISO)

T-2 toxin (EXP)

taurine (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (EXP)

zidovudine (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to peptide (IEP)

proton motive force-driven ATP synthesis (IBA,IEA)

proton motive force-driven mitochondrial ATP synthesis (ISO)

proton transmembrane transport (IEA)

Cellular Component

mitochondrial inner membrane (IEA,ISO)

mitochondrion (ISO)

proton-transporting ATP synthase complex (IDA,ISO)

proton-transporting ATP synthase complex, coupling factor F(o) (IDA,IEA)

proton-transporting ATP synthase, stator stalk (IBA)

Molecular Function

protein binding (ISO)

protein-containing complex binding (IDA)

proton transmembrane transporter activity (IEA)

proton-transporting ATP synthase activity, rotational mechanism (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Differential proteomic analysis of the anti-depressive effects of oleamide in a rat chronic mild stress model of depression.	Ge L, etal., Pharmacol Biochem Behav. 2015 Apr;131:77-86. doi: 10.1016/j.pbb.2015.01.017. Epub 2015 Jan 29.
3.	The complete amino acid sequence of subunit d of rat liver mitochondrial H(+)-ATP synthase.	Higuti T, etal., J Biochem (Tokyo) 1993 Nov;114(5):714-7.
4.	A simple, rapid method for purification of epsilon-subunit, coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP synthase and determination of the complete amino acid sequence of epsilon-subunit.	Higuti T, etal., J Biol Chem. 1992 Nov 5;267(31):22658-61.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
7.	Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary Arterial Hypertension in Rats.	Li N, etal., Am J Med Sci. 2016 Dec;352(6):631-636. doi: 10.1016/j.amjms.2016.08.002. Epub 2016 Aug 15.
8.	[Proteomic changes in cerebral cortex of neonatal rats with experimental congenital hypothyroidism].	Liu CR, etal., Zhonghua Er Ke Za Zhi. 2011 Mar;49(3):209-13.
9.	Differences in expression of retinal proteins between diabetic and normal rats.	Liu SQ, etal., World J Gastroenterol. 2007 Apr 14;13(14):2118-24.
10.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	cDNA cloning for and preparation of antibodies against subunit d of H(+)-ATP synthase in rat mitochondria.	Motojima K and Imanaka T, Biochem Biophys Res Commun 1992 Feb 14;182(3):1130-8.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	GOA pipeline	RGD automated data pipeline
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Proteome analysis of rat pancreatic acinar cells: implication for cerulein-induced acute pancreatitis.	Yu JH, etal., Proteomics. 2003 Dec;3(12):2446-53. doi: 10.1002/pmic.200300545.
18.	Mechanisms of propofol attenuation of ketamine-induced neonatal brain injury.	Zhao CH, etal., Eur Rev Med Pharmacol Sci. 2016;20(1):133-7.
19.	Marine collagen peptides reduce endothelial cell injury in diabetic rats by inhibiting apoptosis and the expression of coupling factor 6 and microparticles.	Zhu C, etal., Mol Med Rep. 2017 Oct;16(4):3947-3957. doi: 10.3892/mmr.2017.7061. Epub 2017 Jul 21.

Additional References at PubMed

PMID:12110673	PMID:12477932	PMID:12865426	PMID:14651853	PMID:15489334	PMID:17634366	PMID:18614015	PMID:19016746	PMID:20833797	PMID:23376485	PMID:25002582	PMID:26316108
PMID:26519110	PMID:29476059	PMID:35352799

Genomics

Comparative Map Data

Atp5pd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,156,673 - 101,161,926 (-)	NCBI		GRCr8
mRatBN7.2	10	100,657,700 - 100,662,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,657,708 - 100,663,479 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	105,717,816 - 105,722,979 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,180,884 - 105,186,047 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,578,681 - 100,583,844 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	103,967,340 - 103,972,552 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	103,967,312 - 103,972,668 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,306,420 - 104,330,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	105,474,107 - 105,499,413 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,421,360 - 172,421,928 (-)	NCBI
Celera	10	99,232,881 - 99,238,044 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

ATP5PD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	75,038,863 - 75,046,969 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	75,038,863 - 75,046,985 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	73,034,958 - 73,043,064 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	70,546,550 - 70,554,669 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	70,546,549 - 70,554,669	NCBI
Celera	17	69,628,209 - 69,636,011 (-)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	68,445,036 - 68,452,842 (-)	NCBI		HuRef
CHM1_1	17	73,099,751 - 73,107,553 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	75,930,610 - 75,938,401 (-)	NCBI		T2T-CHM13v2.0

Atp5pd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	115,306,517 - 115,310,775 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	115,306,515 - 115,310,788 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	115,415,691 - 115,419,919 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	115,415,689 - 115,419,962 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	115,277,011 - 115,281,233 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	115,231,787 - 115,236,009 (-)	NCBI		MGSCv36	mm8
Celera	11	127,181,768 - 127,186,018 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	80.84	NCBI

Atp5pd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955553	1,892,670 - 1,897,175 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955553	1,893,767 - 1,897,175 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP5PD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	91,077,905 - 91,085,794 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	95,900,959 - 95,908,845 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	68,986,362 - 68,994,246 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	74,541,363 - 74,549,700 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	74,541,363 - 74,549,700 (-)	Ensembl	panpan1.1		panPan2

LOC102151342
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	66,856,651 - 66,857,162 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	66,310,455 - 66,310,966 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	66,921,267 - 66,921,778 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	7	66,586,318 - 66,586,829 (-)	NCBI		UMICH_Zoey_3.1
UU_Cfam_GSD_1.0	7	66,912,013 - 66,912,524 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5pd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	6,052,504 - 6,057,540 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	353,980 - 359,414 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	354,416 - 359,415 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5PD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	6,241,467 - 6,247,344 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	6,320,537 - 6,321,045 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5PD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	46,625,512 - 46,630,613 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	17,410,867 - 17,416,350 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5pd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	4,857,692 - 4,861,430 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	4,857,689 - 4,863,249 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5pd
17 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	73
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000004836
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	92238497	101012337	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

D10Rat262

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	10	104,325,512 - 104,325,725	UniSTS	Rnor5.0
FHH x ACI Map	10	88.0	RGD
FHH x ACI Map	10	88.0	UniSTS

RH128098

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	100,657,809 - 100,659,111 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	166,164,415 - 166,164,608 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,003,593 - 173,003,785	NCBI	Rnor6.0
Rnor_6.0	10	103,967,452 - 103,968,753	NCBI	Rnor6.0
Rnor_5.0	5	176,478,715 - 176,478,907	UniSTS	Rnor5.0
RGSC_v3.4	5	172,410,957 - 172,411,149	UniSTS	RGSC3.4
Celera	5	164,365,931 - 164,366,123	UniSTS
Celera	10	99,232,983 - 99,234,284	UniSTS
RH 3.4 Map	16	486.79	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH141812

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	11,421,483 - 11,421,686 (-)	MAPPER	mRatBN7.2
mRatBN7.2	6	11,421,355 - 11,421,686 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	6,470,748 - 6,471,111	NCBI	Rnor6.0
Rnor_6.0	6	6,470,748 - 6,470,950	NCBI	Rnor6.0
Rnor_5.0	6	6,427,708 - 6,427,910	UniSTS	Rnor5.0
Rnor_5.0	6	6,427,708 - 6,428,071	UniSTS	Rnor5.0
RGSC_v3.4	6	6,606,574 - 6,606,776	UniSTS	RGSC3.4
RGSC_v3.4	10	105,493,315 - 105,493,517	UniSTS	RGSC3.4
Celera	6	11,125,752 - 11,125,954	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

130

226

146

250

114

145

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004836 ⟹ ENSRNOP00000004836

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,657,708 - 100,663,479 (-)	Ensembl
Rnor_6.0 Ensembl	10	103,967,312 - 103,972,668 (-)	Ensembl

RefSeq Acc Id:

NM_019383 ⟹ NP_062256

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,156,673 - 101,161,836 (-)	NCBI
mRatBN7.2	10	100,657,708 - 100,662,871 (-)	NCBI
Rnor_6.0	10	103,967,350 - 103,972,513 (-)	NCBI
Rnor_5.0	10	104,306,420 - 104,330,303 (+)	NCBI
RGSC_v3.4	10	105,474,107 - 105,499,413 (-)	RGD
Celera	10	99,232,881 - 99,238,044 (-)	RGD

Sequence:

show sequence

GTTCCTTTCTGCTGGAGACAGCGCTCCGCCGGGGGTCGGTGAAGTATCCAAGATGGCTGGGCGC
AAACTTGCTCTAAAAACCATCGATTGGGTATCTTTTGTGGAGATCATGCCCCAAAACCAGAAGG
CAATTGGAAACGCTCTGAAGTCCTGGAATGAGACCTTCCACACCAGGTTGGCTAGTCTGTCTGA
GAAACCACCAGCGATTGACTGGGCTTACTACAGGGCCAATGTGGACAAGCCTGGCTTGGTGGAT
GATTTTAAAAACAAGTATAATGCTCTGAAGATCCCTGTGCCTGAGGATAAATACACAGCCCTAG
TGGACGCCGAGGAGAAGGAGGATGTGAAGAACTGTGCCCAGTTCGTGACTGGATCTCAGGCTAG
GGTCCGGGAATATGAGAAGCAGCTGGAGAAAATAAAGAACATGATTCCCTTTGACCAGATGACG
ATTGATGACTTGAATGAGGTCTTCCCTGAAACCAAGCTGGACAAGAGGAAGTACCCATACTGGC
CCCATCAGCCCATCGAGAACCTGTGAAGCAGCCCAGGAGGGAGCCCTGGCTGACTTGAAATAAA
ACATTTACATAGTCTTGCTATGGTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008768390 ⟹ XP_008766612

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,156,684 - 101,161,926 (-)	NCBI
mRatBN7.2	10	100,657,700 - 100,662,960 (-)	NCBI
Rnor_6.0	10	103,967,340 - 103,972,552 (-)	NCBI

Sequence:

show sequence

TGGATTGGCCAAAGAGGGAACTTCCGGTAACACACTTCCGTTCCTTTCTGCTGGAGACAGCGCT
CCGCCGGGGGTCGGTGAAGTATCCAAGATGGCTGGGCGCAAACTTGCTCTAAAAACCATCGATT
GGGTATCTTTTGTGGAGATCATGCCCCAAAACCAGAAGGCAATTGGAAACGCTCTGAAGTCCTG
GAATGAGACCTTCCACACCAGGTTGGCTAGTCTGTCTGAGAAACCACCAGCGATTGACTGGGCT
TACTACAGGGCCAATGTGGACAAGCCTGGCTTGGTGGATGATTTTAAAAACAAGGTGAAGAACT
GTGCCCAGTTCGTGACTGGATCTCAGGCTAGGGTCCGGGAATATGAGAAGCAGCTGGAGAAAAT
AAAGAACATGATTCCCTTTGACCAGATGACGATTGATGACTTGAATGAGGTCTTCCCTGAAACC
AAGCTGGACAAGAGGAAGTACCCATACTGGCCCCATCAGCCCATCGAGAACCTGTGAAGCAGCC
CAGGAGGGAGCCCTGGCTGACTTGAAATAAAACATTTACATAGTCTTGTTATGGTCTTTAAGTA
GA

hide sequence

RefSeq Acc Id:

XM_039086785 ⟹ XP_038942713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,156,684 - 101,160,134 (-)	NCBI
mRatBN7.2	10	100,657,700 - 100,661,163 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062256	(Get FASTA)	NCBI Sequence Viewer
	XP_008766612	(Get FASTA)	NCBI Sequence Viewer
	XP_038942713	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH59139	(Get FASTA)	NCBI Sequence Viewer
	AAH78846	(Get FASTA)	NCBI Sequence Viewer
	BAA00911	(Get FASTA)	NCBI Sequence Viewer
	BAA02422	(Get FASTA)	NCBI Sequence Viewer
	EDM06576	(Get FASTA)	NCBI Sequence Viewer
	EDM06577	(Get FASTA)	NCBI Sequence Viewer
	EDM06578	(Get FASTA)	NCBI Sequence Viewer
	EDM06579	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004836.7
GenBank Protein	P31399	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062256 ⟸ NM_019383
- UniProtKB:	P31399 (UniProtKB/Swiss-Prot), A6HKM5 (UniProtKB/TrEMBL), A6HKM3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGRKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRANVDKP GLVDDFKNKYNALKIPVPEDKYTALVDAEEKEDVKNCAQFVTGSQARVREYEKQLEKIKNMIPF DQMTIDDLNEVFPETKLDKRKYPYWPHQPIENL hide sequence

RefSeq Acc Id:	XP_008766612 ⟸ XM_008768390
- Peptide Label:	isoform X2
- UniProtKB:	A6HKM2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGRKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRANVDKP GLVDDFKNKVKNCAQFVTGSQARVREYEKQLEKIKNMIPFDQMTIDDLNEVFPETKLDKRKYPY WPHQPIENL hide sequence

Ensembl Acc Id:

ENSRNOP00000004836 ⟸ ENSRNOT00000004836

RefSeq Acc Id:	XP_038942713 ⟸ XM_039086785
- Peptide Label:	isoform X1
- UniProtKB:	P31399 (UniProtKB/Swiss-Prot), A6HKM5 (UniProtKB/TrEMBL), A6HKM3 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P31399-F1-model_v2	AlphaFold	P31399	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697885

Promoter ID:

EPDNEW_R8410

Type:

multiple initiation site

Name:

Atp5h_1

Description:

ATP synthase, H+ transporting, mitochondrial Fo complex, subunitd

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	103,972,524 - 103,972,584	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620083	AgrOrtholog
BioCyc Gene	G2FUF-22680	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000003626	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004836.7	UniProtKB/TrEMBL
Gene3D-CATH	6.10.280.70	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6921557	IMAGE-MGC_LOAD
	IMAGE:7133871	IMAGE-MGC_LOAD
InterPro	ATP_synth_F0_dsu_mt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP_synth_F0_dsu_sf_mt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:641434	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72861	IMAGE-MGC_LOAD
	MGC:93491	IMAGE-MGC_LOAD
NCBI Gene	641434	ENTREZGENE
PANTHER	ATP SYNTHASE SUBUNIT D, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12700	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Mt_ATP-synt_D	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Atp5pd	PhenoGen
PIRSF	ATPase_F0_D_mt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003626	RatGTEx
Superfamily-SCOP	SSF161065	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q170_RAT	UniProtKB/TrEMBL
	A6HKM2	ENTREZGENE, UniProtKB/TrEMBL
	A6HKM3	ENTREZGENE, UniProtKB/TrEMBL
	A6HKM5	ENTREZGENE, UniProtKB/TrEMBL
	ATP5H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-01-10	Atp5pd	ATP synthase peripheral stalk subunit d	Atp5h	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-10-18	Atp5h	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d	Atp5h	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Atp5h	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d	Atp5jd	ATP synthase subunit d	Symbol and Name updated	1299863	APPROVED
2002-08-07	Atp5jd	ATP synthase subunit d			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to mitochondria	632023
gene_protein	160 amino acids	632024
gene_protein	isoelectric point of subunit d is 6.19	632024

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

BioCyc Pathways