Symbol:
Grb14
Name:
growth factor receptor bound protein 14
RGD ID:
61869
Description:
Enables phosphoprotein binding activity. Involved in several processes, including insulin receptor signaling pathway; negative regulation of insulin receptor signaling pathway; and negative regulation of meiotic cell cycle process involved in oocyte maturation. Located in endosome. Human ortholog(s) of this gene implicated in type 2 diabetes mellitus. Orthologous to human GRB14 (growth factor receptor bound protein 14); PARTICIPATES IN insulin signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GRB14 adapter protein; growth factor receptor-bound protein 14
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 69,976,331 - 70,091,921 (-) NCBI GRCr8 mRatBN7.2 3 49,568,210 - 49,683,805 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 49,568,210 - 49,683,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 52,905,764 - 53,021,646 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 61,489,289 - 61,605,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 59,273,965 - 59,396,250 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 50,937,403 - 51,054,447 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 50,937,669 - 51,054,378 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 57,679,758 - 57,695,025 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 3 57,578,226 - 57,619,404 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 46,832,380 - 46,952,670 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 46,728,757 - 46,849,042 (-) NCBI Celera 3 49,175,830 - 49,290,450 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grb14 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:62161 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GRB14 mRNA CTD PMID:36331819 Grb14 Rat 1,2-dimethylhydrazine increases expression ISO RGD:62161 6480464 1,2-Dimethylhydrazine results in increased expression of GRB14 mRNA CTD PMID:22206623 Grb14 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of GRB14 mRNA CTD PMID:12655037|PMID:15834898 Grb14 Rat 17beta-estradiol affects expression ISO RGD:732013 6480464 Estradiol affects the expression of GRB14 mRNA CTD PMID:21826169 Grb14 Rat 17beta-estradiol increases expression ISO RGD:62161 6480464 Estradiol results in increased expression of GRB14 mRNA CTD PMID:39298647 Grb14 Rat 17beta-estradiol decreases expression ISO RGD:732013 6480464 Estradiol results in decreased expression of GRB14 mRNA CTD PMID:16202921|PMID:19619570|PMID:20106945|PMID:31614463 Grb14 Rat 17beta-estradiol multiple interactions ISO RGD:732013 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of GRB14 mRNA CTD PMID:19619570 Grb14 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:62161 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:732013 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of GRB14 mRNA CTD PMID:19619570 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:62161 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:62161 6480464 Tetrachlorodibenzodioxin affects the expression of GRB14 mRNA CTD PMID:21570461 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRB14 mRNA CTD PMID:21215274 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:62161 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRB14 mRNA CTD PMID:19770486|PMID:21354282 Grb14 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732013 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRB14 mRNA CTD PMID:19619570|PMID:20106945 Grb14 Rat 2-palmitoylglycerol increases expression ISO RGD:732013 6480464 2-palmitoylglycerol results in increased expression of GRB14 mRNA CTD PMID:37199045 Grb14 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of GRB14 mRNA CTD PMID:23196670 Grb14 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:732013 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Grb14 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:62161 6480464 bisphenol S results in increased expression of GRB14 mRNA CTD PMID:39298647 Grb14 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:62161 6480464 Fenretinide results in decreased expression of GRB14 mRNA CTD PMID:28973697 Grb14 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GRB14 mRNA CTD PMID:24780913 Grb14 Rat 8-Br-cAMP decreases expression ISO RGD:732013 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of GRB14 mRNA CTD PMID:22079614 Grb14 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GRB14 mRNA CTD PMID:28959563 Grb14 Rat aflatoxin B1 affects expression ISO RGD:732013 6480464 Aflatoxin B1 affects the expression of GRB14 protein CTD PMID:20106945 Grb14 Rat aflatoxin B1 decreases expression ISO RGD:732013 6480464 Aflatoxin B1 results in decreased expression of GRB14 mRNA CTD PMID:22100608 Grb14 Rat aldrin increases expression ISO RGD:62161 6480464 Aldrin results in increased expression of GRB14 mRNA CTD PMID:18579281 Grb14 Rat all-trans-retinoic acid increases expression ISO RGD:732013 6480464 Tretinoin results in increased expression of GRB14 mRNA CTD PMID:21934132 Grb14 Rat all-trans-retinoic acid decreases expression ISO RGD:732013 6480464 Tretinoin results in decreased expression of GRB14 mRNA CTD PMID:23724009 Grb14 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of GRB14 mRNA CTD PMID:18355885 Grb14 Rat amitriptyline affects expression EXP 6480464 Amitriptyline affects the expression of GRB14 mRNA CTD PMID:18355885 Grb14 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GRB14 mRNA CTD PMID:16483693 Grb14 Rat aristolochic acid A decreases expression ISO RGD:732013 6480464 aristolochic acid I results in decreased expression of GRB14 mRNA CTD PMID:33212167 Grb14 Rat arsane affects methylation ISO RGD:732013 6480464 Arsenic affects the methylation of GRB14 gene CTD PMID:25304211 Grb14 Rat arsenic atom affects methylation ISO RGD:732013 6480464 Arsenic affects the methylation of GRB14 gene CTD PMID:25304211 Grb14 Rat arsenite(3-) multiple interactions ISO RGD:62161 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of GRB14 mRNA] CTD PMID:18929588 Grb14 Rat arsenite(3-) increases expression ISO RGD:62161 6480464 arsenite results in increased expression of GRB14 protein CTD PMID:37955338 Grb14 Rat arsenite(3-) decreases expression ISO RGD:62161 6480464 arsenite results in decreased expression of GRB14 mRNA CTD PMID:18929588 Grb14 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of GRB14 gene CTD PMID:28931070 Grb14 Rat azathioprine decreases expression ISO RGD:732013 6480464 Azathioprine results in decreased expression of GRB14 mRNA CTD PMID:22623647 Grb14 Rat benzo[a]pyrene decreases expression ISO RGD:62161 6480464 Benzo(a)pyrene results in decreased expression of GRB14 mRNA CTD PMID:19770486|PMID:21569818 Grb14 Rat benzo[a]pyrene decreases expression ISO RGD:732013 6480464 Benzo(a)pyrene results in decreased expression of GRB14 mRNA CTD PMID:32234424 Grb14 Rat benzo[a]pyrene increases methylation ISO RGD:62161 6480464 Benzo(a)pyrene results in increased methylation of GRB14 exon; Benzo(a)pyrene results in increased methylation of GRB14 more ... CTD PMID:27901495 Grb14 Rat benzo[a]pyrene increases methylation ISO RGD:732013 6480464 Benzo(a)pyrene results in increased methylation of GRB14 exon; Benzo(a)pyrene results in increased methylation of GRB14 more ... CTD PMID:27901495 Grb14 Rat benzo[a]pyrene increases expression ISO RGD:62161 6480464 Benzo(a)pyrene results in increased expression of GRB14 mRNA CTD PMID:22228805 Grb14 Rat benzo[a]pyrene multiple interactions ISO RGD:62161 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of GRB14 mRNA] CTD PMID:22228805 Grb14 Rat beta-lapachone decreases expression ISO RGD:732013 6480464 beta-lapachone results in decreased expression of GRB14 mRNA CTD PMID:38218311 Grb14 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of GRB14 mRNA CTD PMID:15728792 Grb14 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:62161 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Grb14 Rat bisphenol A affects expression ISO RGD:732013 6480464 bisphenol A affects the expression of GRB14 mRNA CTD PMID:21826169 Grb14 Rat bisphenol A decreases expression ISO RGD:62161 6480464 bisphenol A results in decreased expression of GRB14 mRNA CTD PMID:33221593 Grb14 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRB14 mRNA CTD PMID:32145629 Grb14 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GRB14 mRNA CTD PMID:31129395 Grb14 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GRB14 gene CTD PMID:28505145 Grb14 Rat bisphenol A multiple interactions ISO RGD:62161 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Grb14 Rat bisphenol A multiple interactions ISO RGD:732013 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Grb14 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GRB14 mRNA CTD PMID:25181051 Grb14 Rat Butylbenzyl phthalate increases expression EXP 6480464 butylbenzyl phthalate results in increased expression of GRB14 mRNA CTD PMID:15728792 Grb14 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of GRB14 mRNA CTD PMID:33453195 Grb14 Rat cadmium dichloride decreases expression ISO RGD:732013 6480464 Cadmium Chloride results in decreased expression of GRB14 mRNA CTD PMID:38382870 Grb14 Rat cantharidin decreases expression ISO RGD:62161 6480464 Cantharidin results in decreased expression of GRB14 mRNA CTD PMID:36907384 Grb14 Rat carbamazepine affects expression ISO RGD:732013 6480464 Carbamazepine affects the expression of GRB14 mRNA CTD PMID:25979313 Grb14 Rat carbon nanotube decreases expression ISO RGD:62161 6480464 Nanotubes, Carbon analog results in decreased expression of GRB14 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Grb14 Rat CGP 52608 multiple interactions ISO RGD:732013 6480464 CGP 52608 promotes the reaction [RORA protein binds to GRB14 gene] CTD PMID:28238834 Grb14 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of GRB14 mRNA CTD PMID:18668222 Grb14 Rat clofibrate decreases expression ISO RGD:62161 6480464 Clofibrate results in decreased expression of GRB14 mRNA CTD PMID:23811191 Grb14 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of GRB14 mRNA CTD PMID:17602206 Grb14 Rat clomipramine affects expression EXP 6480464 Clomipramine affects the expression of GRB14 mRNA CTD PMID:18355885 Grb14 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GRB14 mRNA CTD PMID:24386269 Grb14 Rat copper atom multiple interactions ISO RGD:732013 6480464 [NSC 689534 binds to Copper] which results in decreased expression of GRB14 mRNA CTD PMID:20971185 Grb14 Rat copper(0) multiple interactions ISO RGD:732013 6480464 [NSC 689534 binds to Copper] which results in decreased expression of GRB14 mRNA CTD PMID:20971185 Grb14 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GRB14 mRNA CTD PMID:26577399 Grb14 Rat cyclosporin A decreases expression ISO RGD:62161 6480464 Cyclosporine results in decreased expression of GRB14 mRNA CTD PMID:19770486 Grb14 Rat cyclosporin A decreases expression ISO RGD:732013 6480464 Cyclosporine results in decreased expression of GRB14 mRNA CTD PMID:20106945|PMID:25562108|PMID:27989131 Grb14 Rat deguelin increases expression ISO RGD:732013 6480464 deguelin results in increased expression of GRB14 mRNA CTD PMID:33512557 Grb14 Rat dexamethasone multiple interactions ISO RGD:732013 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Grb14 Rat dibutyl phthalate increases expression ISO RGD:62161 6480464 Dibutyl Phthalate results in increased expression of GRB14 mRNA CTD PMID:17361019|PMID:21266533 Grb14 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of GRB14 mRNA; Dibutyl Phthalate results in increased expression more ... CTD PMID:15728792|PMID:21266533|PMID:21745491 Grb14 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of GRB14 protein CTD PMID:21745491 Grb14 Rat dipentyl phthalate increases expression EXP 6480464 di-n-pentyl phthalate results in increased expression of GRB14 mRNA CTD PMID:15728792 Grb14 Rat dorsomorphin multiple interactions ISO RGD:732013 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Grb14 Rat entinostat increases expression ISO RGD:732013 6480464 entinostat results in increased expression of GRB14 mRNA CTD PMID:26272509 Grb14 Rat entinostat multiple interactions ISO RGD:732013 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Grb14 Rat epoxiconazole increases expression ISO RGD:62161 6480464 epoxiconazole results in increased expression of GRB14 mRNA CTD PMID:35436446 Grb14 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of GRB14 mRNA CTD PMID:17347304 Grb14 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GRB14 mRNA CTD PMID:24793618 Grb14 Rat fonofos increases methylation ISO RGD:732013 6480464 Fonofos results in increased methylation of GRB14 promoter CTD PMID:22847954 Grb14 Rat furan increases methylation EXP 6480464 furan results in increased methylation of GRB14 gene CTD PMID:22079235 Grb14 Rat hydroxyurea increases mutagenesis ISO RGD:62161 6480464 Hydroxyurea results in increased mutagenesis of GRB14 gene CTD PMID:16868089 Grb14 Rat imipramine affects expression EXP 6480464 Imipramine affects the expression of GRB14 mRNA CTD PMID:18355885 Grb14 Rat indometacin multiple interactions ISO RGD:732013 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Grb14 Rat inulin multiple interactions ISO RGD:62161 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GRB14 mRNA CTD PMID:36331819 Grb14 Rat ketoconazole affects expression EXP 6480464 Ketoconazole affects the expression of GRB14 mRNA CTD PMID:18355885 Grb14 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of GRB14 mRNA CTD PMID:16393664 Grb14 Rat Monobutylphthalate decreases expression ISO RGD:62161 6480464 monobutyl phthalate results in decreased expression of GRB14 mRNA CTD PMID:35278568 Grb14 Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of GRB14 mRNA CTD PMID:29162477 Grb14 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of GRB14 mRNA CTD PMID:28801915 Grb14 Rat N-methyl-N-nitrosourea increases mutagenesis ISO RGD:62161 6480464 Methylnitrosourea results in increased mutagenesis of GRB14 gene CTD PMID:16868089 Grb14 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of GRB14 mRNA CTD PMID:17602206 Grb14 Rat nickel atom decreases expression ISO RGD:732013 6480464 Nickel results in decreased expression of GRB14 mRNA CTD PMID:24768652|PMID:25583101 Grb14 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of GRB14 mRNA CTD PMID:22110744 Grb14 Rat okadaic acid decreases expression ISO RGD:732013 6480464 Okadaic Acid results in decreased expression of GRB14 mRNA CTD PMID:38832940 Grb14 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of GRB14 mRNA CTD PMID:25729387 Grb14 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GRB14 mRNA CTD PMID:25729387 Grb14 Rat paracetamol decreases expression ISO RGD:732013 6480464 Acetaminophen results in decreased expression of GRB14 mRNA CTD PMID:21420995 Grb14 Rat parathion increases methylation ISO RGD:732013 6480464 Parathion results in increased methylation of GRB14 promoter CTD PMID:22847954 Grb14 Rat pentachlorophenol decreases expression ISO RGD:62161 6480464 Pentachlorophenol results in decreased expression of GRB14 mRNA CTD PMID:23892564 Grb14 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:732013 6480464 perfluorooctane sulfonic acid results in decreased expression of GRB14 mRNA CTD PMID:27153767 Grb14 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:62161 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GRB14 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Grb14 Rat phenobarbital decreases expression ISO RGD:62161 6480464 Phenobarbital results in decreased expression of GRB14 protein CTD PMID:35881160 Grb14 Rat phenobarbital increases expression ISO RGD:732013 6480464 Phenobarbital results in increased expression of GRB14 protein CTD PMID:35881160 Grb14 Rat propiconazole decreases expression ISO RGD:62161 6480464 propiconazole results in decreased expression of GRB14 mRNA CTD PMID:21278054 Grb14 Rat quercetin decreases expression ISO RGD:732013 6480464 Quercetin results in decreased expression of GRB14 mRNA CTD PMID:15309432|PMID:21632981 Grb14 Rat rimonabant affects expression ISO RGD:62161 6480464 Rimonabant affects the expression of GRB14 mRNA CTD PMID:19030233 Grb14 Rat rimonabant multiple interactions ISO RGD:62161 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of GRB14 mRNA] CTD PMID:19030233 Grb14 Rat SB 431542 multiple interactions ISO RGD:732013 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Grb14 Rat silicon dioxide decreases expression ISO RGD:732013 6480464 Silicon Dioxide analog results in decreased expression of GRB14 mRNA CTD PMID:25895662 Grb14 Rat sodium arsenite decreases expression ISO RGD:732013 6480464 sodium arsenite results in decreased expression of GRB14 mRNA CTD PMID:29301061|PMID:38568856 Grb14 Rat terbufos increases methylation ISO RGD:732013 6480464 terbufos results in increased methylation of GRB14 promoter CTD PMID:22847954 Grb14 Rat tetrachloromethane affects expression ISO RGD:62161 6480464 Carbon Tetrachloride affects the expression of GRB14 mRNA CTD PMID:17484886 Grb14 Rat tetrachloromethane decreases expression ISO RGD:62161 6480464 Carbon Tetrachloride results in decreased expression of GRB14 mRNA CTD PMID:31919559 Grb14 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GRB14 mRNA CTD PMID:31150632 Grb14 Rat titanium dioxide decreases methylation ISO RGD:62161 6480464 titanium dioxide results in decreased methylation of GRB14 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Grb14 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GRB14 mRNA CTD PMID:25729387 Grb14 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of GRB14 mRNA CTD PMID:25729387 Grb14 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of GRB14 mRNA CTD PMID:31129395 Grb14 Rat trichostatin A increases expression ISO RGD:732013 6480464 trichostatin A results in increased expression of GRB14 mRNA CTD PMID:24935251 Grb14 Rat triclosan decreases expression ISO RGD:732013 6480464 Triclosan results in decreased expression of GRB14 mRNA CTD PMID:30510588 Grb14 Rat triptonide decreases expression ISO RGD:62161 6480464 triptonide results in decreased expression of GRB14 mRNA CTD PMID:33045310 Grb14 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:732013 6480464 tris(2-butoxyethyl) phosphate affects the expression of GRB14 mRNA CTD PMID:29024780 Grb14 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of GRB14 mRNA CTD PMID:15885361 Grb14 Rat valproic acid affects expression ISO RGD:62161 6480464 Valproic Acid affects the expression of GRB14 mRNA CTD PMID:17963808 Grb14 Rat valproic acid increases expression ISO RGD:62161 6480464 Valproic Acid results in increased expression of GRB14 mRNA CTD PMID:21427059 Grb14 Rat valproic acid decreases expression ISO RGD:732013 6480464 Valproic Acid results in decreased expression of GRB14 mRNA CTD PMID:24935251|PMID:29154799 Grb14 Rat valproic acid affects expression ISO RGD:732013 6480464 Valproic Acid affects the expression of GRB14 mRNA CTD PMID:25979313 Grb14 Rat valproic acid increases expression ISO RGD:732013 6480464 Valproic Acid results in increased expression of GRB14 mRNA CTD PMID:23179753|PMID:23527032|PMID:26272509|PMID:27188386|PMID:28001369 Grb14 Rat valproic acid multiple interactions ISO RGD:732013 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Grb14 Rat zoledronic acid decreases expression ISO RGD:732013 6480464 zoledronic acid results in decreased expression of GRB14 mRNA CTD PMID:24714768
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acrylamide (EXP) aflatoxin B1 (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitriptyline (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) azathioprine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (EXP,ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) clofibrate (ISO) clofibric acid (EXP) clomipramine (EXP) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclosporin A (ISO) deguelin (ISO) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) dipentyl phthalate (EXP) dorsomorphin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (EXP) flutamide (EXP) fonofos (ISO) furan (EXP) hydroxyurea (ISO) imipramine (EXP) indometacin (ISO) inulin (ISO) ketoconazole (EXP) methapyrilene (EXP) Monobutylphthalate (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nickel dichloride (EXP) okadaic acid (ISO) oxaliplatin (EXP) paracetamol (ISO) parathion (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) propiconazole (ISO) quercetin (ISO) rimonabant (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) topotecan (EXP) tributylstannane (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) zoledronic acid (ISO)
1.
Grb14 inhibits FGF receptor signaling through the regulation of PLCgamma recruitment and activation.
Browaeys-Poly E, etal., FEBS Lett. 2010 Nov 5;584(21):4383-8. doi: 10.1016/j.febslet.2010.09.048. Epub 2010 Oct 8.
2.
Compartmentalization and in vivo insulin-induced translocation of the insulin-signaling inhibitor Grb14 in rat liver.
Desbuquois B, etal., FEBS J. 2008 Sep;275(17):4363-77. Epub 2008 Jul 24.
3.
Air pollution and diabetes association: Modification by type 2 diabetes genetic risk score.
Eze IC, etal., Environ Int. 2016 Sep;94:263-271. doi: 10.1016/j.envint.2016.04.032. Epub 2016 Jun 6.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Identification of the rat adapter Grb14 as an inhibitor of insulin actions.
Kasus-Jacobi A, etal., J Biol Chem 1998 Oct 2;273(40):26026-35.
7.
Endosomal proteolysis of internalised -human insulin at neutral pH generates the mature insulin peptide in rat liver in vivo.
Kouach M, etal., Diabetologia. 2009 Dec;52(12):2621-32. Epub 2009 Oct 16.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
SAXS study of the PIR domain from the Grb14 molecular adaptor: a natively unfolded protein with a transient structure primer?
Moncoq K, etal., Biophys J. 2004 Dec;87(6):4056-64. doi: 10.1529/biophysj.104.048645. Epub 2004 Oct 1.
10.
The PIR domain of Grb14 is an intrinsically unstructured protein: implication in insulin signaling.
Moncoq K, etal., FEBS Lett. 2003 Nov 20;554(3):240-6.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
Identification of IGF1, SLC4A4, WWOX, and SFMBT1 as hypertension susceptibility genes in Han Chinese with a genome-wide gene-based association study.
Yang HC, etal., PLoS One. 2012;7(3):e32907. doi: 10.1371/journal.pone.0032907. Epub 2012 Mar 29.
18.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
Grb14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 69,976,331 - 70,091,921 (-) NCBI GRCr8 mRatBN7.2 3 49,568,210 - 49,683,805 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 49,568,210 - 49,683,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 52,905,764 - 53,021,646 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 61,489,289 - 61,605,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 59,273,965 - 59,396,250 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 50,937,403 - 51,054,447 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 50,937,669 - 51,054,378 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 57,679,758 - 57,695,025 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 3 57,578,226 - 57,619,404 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 46,832,380 - 46,952,670 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 46,728,757 - 46,849,042 (-) NCBI Celera 3 49,175,830 - 49,290,450 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
GRB14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 164,492,417 - 164,621,482 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 164,492,417 - 164,621,482 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 165,348,927 - 165,477,992 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 165,057,569 - 165,186,606 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 165,174,839 - 165,303,865 NCBI Celera 2 158,959,227 - 159,088,293 (-) NCBI Celera Cytogenetic Map 2 q24.3 NCBI HuRef 2 157,231,772 - 157,360,824 (-) NCBI HuRef CHM1_1 2 165,355,217 - 165,484,258 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 164,949,755 - 165,079,884 (-) NCBI T2T-CHM13v2.0
Grb14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 64,742,820 - 64,853,143 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 64,742,820 - 64,855,331 (-) Ensembl GRCm39 Ensembl GRCm38 2 64,912,476 - 65,022,766 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 64,912,476 - 65,024,987 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 64,750,535 - 64,860,823 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 64,713,317 - 64,823,605 (-) NCBI MGSCv36 mm8 Celera 2 66,583,155 - 66,693,422 (-) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 38.35 NCBI
Grb14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 9,466,706 - 9,591,598 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 9,466,764 - 9,589,559 (+) NCBI ChiLan1.0 ChiLan1.0
GRB14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 67,158,657 - 67,287,266 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 67,173,633 - 67,302,223 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 51,773,844 - 51,902,420 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 169,135,019 - 169,262,834 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 169,135,231 - 169,263,874 (-) Ensembl panpan1.1 panPan2
GRB14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 9,711,885 - 9,843,266 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 9,712,142 - 9,721,769 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 9,856,214 - 9,987,580 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 9,844,049 - 9,975,461 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 9,844,059 - 9,975,446 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 9,855,062 - 9,986,361 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 9,897,060 - 10,011,627 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 10,011,150 - 10,142,536 (-) NCBI UU_Cfam_GSD_1.0
Grb14 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 126,875,121 - 126,989,222 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 14,628,546 - 14,743,916 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 14,628,478 - 14,742,327 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRB14 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 71,119,926 - 71,247,383 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 71,119,928 - 71,247,426 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 79,273,968 - 79,340,255 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRB14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 49,952,835 - 50,085,274 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 49,953,059 - 50,084,869 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 149,415,172 - 149,544,225 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grb14
.
Predicted Target Of
Count of predictions: 107 Count of miRNA genes: 91 Interacting mature miRNAs: 100 Transcripts: ENSRNOT00000052395 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 10450816 Scl75 Serum cholesterol level QTL 75 4.4 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 10450852 Stl33 Serum triglyceride level QTL 33 3.4 0.05 blood LDL triglyceride amount (VT:0010699) blood lipoprotein triglyceride level (CMO:0002685) 3 38192233 50749747 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 4889975 Bmd81 Bone mineral density QTL 81 4.3 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 38710365 50302886 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 634317 Bw117 Body weight QTL 117 3.58 abdominal fat pad mass (VT:1000711) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 39454637 53296578 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 10450813 Scl74 Serum cholesterol level QTL 74 5.8 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
D3Wox38
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 69,976,466 - 69,976,574 (+) Marker Load Pipeline mRatBN7.2 3 49,568,345 - 49,568,455 (+) MAPPER mRatBN7.2 Rnor_6.0 3 50,937,537 - 50,937,644 NCBI Rnor6.0 Rnor_5.0 3 57,578,360 - 57,578,467 UniSTS Rnor5.0 RGSC_v3.4 3 46,832,514 - 46,832,621 UniSTS RGSC3.4 Celera 3 49,175,964 - 49,176,071 UniSTS Cytogenetic Map 3 q21 UniSTS
AI505286
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 49,568,477 - 49,568,589 (+) MAPPER mRatBN7.2 Rnor_6.0 3 50,937,667 - 50,937,778 NCBI Rnor6.0 Rnor_5.0 3 57,578,490 - 57,578,601 UniSTS Rnor5.0 RGSC_v3.4 3 46,832,644 - 46,832,755 UniSTS RGSC3.4 Celera 3 49,176,094 - 49,176,205 UniSTS Cytogenetic Map 3 q21 UniSTS
RH137906
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 49,684,771 - 49,684,957 (+) MAPPER mRatBN7.2 Rnor_6.0 3 51,066,278 - 51,066,463 NCBI Rnor6.0 Rnor_5.0 3 57,706,527 - 57,706,712 UniSTS Rnor5.0 RGSC_v3.4 3 46,953,780 - 46,953,965 UniSTS RGSC3.4 Celera 3 49,291,278 - 49,291,463 UniSTS RH 3.4 Map 3 625.3 UniSTS Cytogenetic Map 3 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000089243 ⟹ ENSRNOP00000072564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 49,568,213 - 49,683,889 (-) Ensembl Rnor_6.0 Ensembl 3 50,937,669 - 51,054,378 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097641 ⟹ ENSRNOP00000082236
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 49,588,872 - 49,638,518 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100574 ⟹ ENSRNOP00000083261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 49,568,210 - 49,683,878 (-) Ensembl
RefSeq Acc Id:
NM_031623 ⟹ NP_113811
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 69,976,333 - 70,091,921 (-) NCBI mRatBN7.2 3 49,568,212 - 49,683,805 (-) NCBI Rnor_6.0 3 50,937,403 - 51,054,447 (-) NCBI Rnor_5.0 3 57,578,226 - 57,619,404 (-) NCBI Rnor_5.0 3 57,679,758 - 57,695,025 (-) NCBI RGSC_v3.4 3 46,832,380 - 46,952,670 (-) RGD Celera 3 49,175,830 - 49,290,450 (-) RGD
Sequence:
GCTGGACCCCAGCCTTTCTTCGCTTTCGCCTCGCGGTCGATGACTCCCTAGACCCCCTGGCCTACGATCATGACCACGTCCCTGCAAGATGGGCAGAGCGCCGCGGGCCGGGCGGGCGCCCAGGACTC
hide sequence
RefSeq Acc Id:
XM_039105748 ⟹ XP_038961676
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 69,976,331 - 70,046,595 (-) NCBI mRatBN7.2 3 49,568,210 - 49,638,478 (-) NCBI
RefSeq Acc Id:
XM_039105749 ⟹ XP_038961677
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 69,976,331 - 70,032,080 (-) NCBI mRatBN7.2 3 49,568,210 - 49,623,965 (-) NCBI
RefSeq Acc Id:
NP_113811 ⟸ NM_031623
- UniProtKB:
O88900 (UniProtKB/Swiss-Prot), A0A0G2K3B0 (UniProtKB/TrEMBL), A6HLW6 (UniProtKB/TrEMBL)
- Sequence:
MTTSLQDGQSAAGRAGAQDSPLAVQVCRVAQGKGDAQDPAQVPGLHALSPASDATRRGAMDRRKAKDLEVQETPSIPNPFPELCCSPLTSVLSAGLFPRSNSRKKQVIKVYSEDETSRALEVPSDVTA
hide sequence
Ensembl Acc Id:
ENSRNOP00000072564 ⟸ ENSRNOT00000089243
RefSeq Acc Id:
XP_038961676 ⟸ XM_039105748
- Peptide Label:
isoform X1
- UniProtKB:
O88900 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038961677 ⟸ XM_039105749
- Peptide Label:
isoform X2
- UniProtKB:
O88900 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000083261 ⟸ ENSRNOT00000100574
Ensembl Acc Id:
ENSRNOP00000082236 ⟸ ENSRNOT00000097641
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Grb14
growth factor receptor bound protein 14
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_mutations_overexpression
overexpression decreases insulin stimulation of both DNA and glycogen synthesis
61620
gene_physical_interaction
binds to phosphorylated activation loop of insulin receptor
61620
