Symbol:
Gabra1
Name:
gamma-aminobutyric acid type A receptor subunit alpha 1
RGD ID:
61855
Description:
Enables GABA-A receptor activity; diazepam binding activity; and ligand-gated monoatomic ion channel activity. Contributes to GABA receptor activity. Involved in several processes, including GABAergic synaptic transmission; cellular response to histamine; and response to auditory stimulus. Part of GABA receptor complex. Is active in GABA-ergic synapse and postsynaptic specialization membrane. Biomarker of hepatic encephalopathy. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 19. Orthologous to human GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1); INTERACTS WITH (+)-pilocarpine; 1-bromopropane; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GABA(A) receptor subunit alpha-1; GABAAR subunit alpha-1; gamma-aminobutyric acid (GABA) A receptor, alpha 1; gamma-aminobutyric acid (GABA-A) receptor subunit alpha 1; gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 1; gamma-aminobutyric acid A receptor, alpha 1; gamma-aminobutyric acid receptor subunit alpha-1; gamma-aminobutyric acid type A receptor alpha1 subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gabra1 (gamma-aminobutyric acid type A receptor subunit alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gabra1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gabra1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gabra1 (gamma-aminobutyric acid type A receptor subunit alpha1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Gabra1 (gamma-aminobutyric acid type A receptor subunit alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GABRA1 (gamma-aminobutyric acid type A receptor subunit alpha1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gabra1 (gamma-aminobutyric acid (GABA) A receptor, alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG8916
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
lgc-36
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lgc-37
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gabra1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 27,096,731 - 27,152,563 (-) NCBI GRCr8 mRatBN7.2 10 26,595,151 - 26,650,611 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 26,595,160 - 26,650,864 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 31,330,824 - 31,385,752 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 30,819,357 - 30,874,277 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 26,306,024 - 26,360,948 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 27,310,718 - 27,371,802 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 27,310,725 - 27,366,665 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 27,154,354 - 27,209,873 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 27,258,813 - 27,313,725 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 27,261,880 - 27,312,049 (-) NCBI Celera 10 26,109,305 - 26,164,180 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gabra1 Rat (+)-beta-thujone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 beta-thujone inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat (+)-isoborneol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 isoborneol promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat (+)-pilocarpine multiple interactions EXP 6480464 bacoside A inhibits the reaction [Pilocarpine results in decreased expression of GABRA1 mRNA] and Carbamazepine inhibits the reaction [Pilocarpine results in decreased expression of GABRA1 mRNA] CTD PMID:20821261 Gabra1 Rat (+)-pilocarpine decreases expression EXP 6480464 Pilocarpine results in decreased expression of GABRA1 mRNA CTD PMID:20821261 Gabra1 Rat (R)-camphor multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Camphor promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat 1,1,1-trichloroethane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1 more ... CTD PMID:10825391 Gabra1 Rat 1-(2-methoxyphenyl)piperazine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-(2-methoxyphenyl)piperazine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:26344803 Gabra1 Rat 1-(3-(trifluoromethyl)phenyl)piperazine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-(3-trifluoromethylphenyl)piperazine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:26344803 Gabra1 Rat 1-(3-chlorophenyl)piperazine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-(3-chlorophenyl)piperazine affects the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABBR2 protein co-treated with GABRG2 protein]] more ... CTD PMID:21729720 more ... Gabra1 Rat 1-benzylpiperazine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-benzylpiperazine analog inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and 1-benzylpiperazine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:26344803 Gabra1 Rat 1-bromopropane decreases expression EXP 6480464 1-bromopropane results in decreased expression of GABRA1 mRNA CTD PMID:19576243 Gabra1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GABRA1 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GABRA1 mRNA CTD PMID:26496021 and PMID:32741896 Gabra1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GABRA1 mRNA CTD PMID:32741896 Gabra1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO GABRA1 (Homo sapiens) 6480464 2 more ... CTD PMID:20819908 Gabra1 Rat 2,2',4,4'-tetrachlorobiphenyl multiple interactions ISO GABRA1 (Homo sapiens) 6480464 2 more ... CTD PMID:20819908 and PMID:20861069 Gabra1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [2 more ... CTD PMID:20819908 Gabra1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gabra1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gabra1 Rat 2,6-Dimethylphenol multiple interactions EXP 6480464 2 and 6-xylenol results in increased activity of [GABRG2 binds to GABRA1 binds to GABRB2] CTD PMID:11399263 Gabra1 Rat 3,3',5,5'-tetrabromobisphenol A multiple interactions ISO GABRA1 (Homo sapiens) 6480464 gabazine affects the reaction [tetrabromobisphenol A promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]]] more ... CTD PMID:22547355 Gabra1 Rat 3,4-Methylenedioxyamphetamine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-(3-chlorophenyl)piperazine promotes the reaction [3 more ... CTD PMID:21729720 and PMID:23266428 Gabra1 Rat 3,4-methylenedioxymethamphetamine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:23266428 Gabra1 Rat 3alpha-hydroxy-5beta-pregnan-20-one multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Pregnanolone results in increased activity of [GABRA1 protein binds to GABRB1 binds to GABRG2 protein alternative form] more ... CTD PMID:29038840 Gabra1 Rat 4-ethyl-4-methylpiperidine-2,6-dione multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Bemegride inhibits the reaction [Carisoprodol results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:19244096 Gabra1 Rat 6-Methoxyflavanone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 6-methoxyflavanone promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:24078264 Gabra1 Rat 6-Methoxyflavone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 6-methoxyflavone promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and 6-methoxyflavone promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein]] CTD PMID:24078264 Gabra1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GABRA1 mRNA CTD PMID:24780913 Gabra1 Rat aflatoxin B1 decreases methylation ISO GABRA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GABRA1 gene CTD PMID:27153756 Gabra1 Rat Aflatoxin B2 alpha decreases methylation ISO GABRA1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of GABRA1 polyA tail CTD PMID:30157460 Gabra1 Rat alpha-hexachlorocyclohexane decreases expression EXP 6480464 alpha-hexachlorocyclohexane results in decreased expression of GABRA1 mRNA CTD PMID:17785943 Gabra1 Rat alpha-hexachlorocyclohexane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 alpha-hexachlorocyclohexane inhibits the reaction [tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] and alpha-hexachlorocyclohexane promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] CTD PMID:9316872 Gabra1 Rat Alphaxolone multiple interactions EXP 6480464 alphaxalone promotes the reaction [Flunitrazepam binds to GABRA1 protein] more ... CTD PMID:12939268 and PMID:8397295 Gabra1 Rat amitriptyline increases expression EXP 6480464 Amitriptyline results in increased expression of GABRA1 mRNA CTD PMID:21820738 Gabra1 Rat amitriptyline decreases expression EXP 6480464 Amitriptyline results in decreased expression of GABRA1 mRNA CTD PMID:22341215 Gabra1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GABRA1 mRNA CTD PMID:16483693 Gabra1 Rat amphetamine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Amphetamine promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABBR2 protein co-treated with GABRG2 protein]] CTD PMID:21729720 Gabra1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of GABRA1 mRNA CTD PMID:30779732 Gabra1 Rat anthracenes decreases response to substance EXP 6480464 GABRA1 protein mutant form results in decreased susceptibility to Anthracenes analog CTD PMID:18275132 Gabra1 Rat anthracenes multiple interactions EXP 6480464 Anthracenes analog promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:18275132 Gabra1 Rat arsane affects methylation ISO GABRA1 (Homo sapiens) 6480464 Arsenic affects the methylation of GABRA1 gene CTD PMID:25304211 Gabra1 Rat arsenic atom affects methylation ISO GABRA1 (Homo sapiens) 6480464 Arsenic affects the methylation of GABRA1 gene CTD PMID:25304211 Gabra1 Rat arsenous acid increases expression ISO GABRA1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GABRA1 mRNA CTD PMID:20458559 Gabra1 Rat Bacoside a multiple interactions EXP 6480464 bacoside A inhibits the reaction [Pilocarpine results in decreased expression of GABRA1 mRNA] CTD PMID:20821261 Gabra1 Rat benzo[a]pyrene affects methylation ISO GABRA1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GABRA1 polyA tail and Benzo(a)pyrene affects the methylation of GABRA1 promoter CTD PMID:27901495 and PMID:30157460 Gabra1 Rat benzo[a]pyrene decreases methylation ISO GABRA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GABRA1 5' UTR CTD PMID:27901495 Gabra1 Rat benzo[e]pyrene decreases methylation ISO GABRA1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of GABRA1 polyA tail CTD PMID:30157460 Gabra1 Rat bicuculline multiple interactions EXP 6480464 Bicuculline inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]] and Bicuculline inhibits the reaction [methylmercuric chloride promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]]] CTD PMID:1977069 and PMID:27720918 Gabra1 Rat bicuculline multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Bicuculline promotes the reaction [tetramethylenedisulfotetramine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein alternative form]]] and Bicuculline results in decreased activity of [GABRA1 protein binds to GABRB1 binds to GABRG2 protein alternative form] CTD PMID:29038840 Gabra1 Rat bicuculline decreases expression EXP 6480464 Bicuculline results in decreased expression of GABRA1 mRNA CTD PMID:9600394 Gabra1 Rat bisphenol A decreases expression ISO Gabra1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GABRA1 mRNA CTD PMID:24465770 Gabra1 Rat bisphenol A increases methylation ISO GABRA1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of GABRA1 gene CTD PMID:31601247 Gabra1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GABRA1 mRNA and bisphenol A results in increased expression of GABRA1 protein CTD PMID:36136478 and PMID:37926988 Gabra1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GABRA1 mRNA CTD PMID:25181051 more ... Gabra1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GABRA1 mRNA CTD PMID:26496021 Gabra1 Rat bromoform multiple interactions ISO GABRA1 (Homo sapiens) 6480464 bromoform binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:12505655 Gabra1 Rat butan-1-ol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-Butanol affects the reaction [gamma-Aminobutyric Acid binds to and results in increased activity of [GABRG2 protein binds to GABRA1 protein binds to GABRB2 protein]] CTD PMID:11137757 Gabra1 Rat butan-1-ol increases activity ISO Gabra1 (Mus musculus) 6480464 1-Butanol results in increased activity of GABRA1 protein CTD PMID:16807363 Gabra1 Rat camphor multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Camphor promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat cannabidiol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [Dronabinol co-treated with Cannabidiol] inhibits the reaction [[APP gene mutant form co-treated with PSEN1 gene mutant form] results in decreased expression of GABRA1 protein] CTD PMID:27567873 Gabra1 Rat carbamazepine multiple interactions EXP 6480464 Carbamazepine inhibits the reaction [Pilocarpine results in decreased expression of GABRA1 mRNA] CTD PMID:20821261 Gabra1 Rat carbamazepine increases activity EXP 6480464 Carbamazepine results in increased activity of GABRA1 protein CTD PMID:18717705 Gabra1 Rat carisoprodol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Bemegride inhibits the reaction [Carisoprodol results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and Carisoprodol binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:19244096 Gabra1 Rat carvone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 carvone promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat CGP 52608 multiple interactions ISO GABRA1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GABRA1 gene] CTD PMID:28238834 Gabra1 Rat chlorpyrifos increases expression ISO Gabra1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GABRA1 mRNA CTD PMID:36796608 Gabra1 Rat clozapine increases expression ISO Gabra1 (Mus musculus) 6480464 Clozapine results in increased expression of GABRA1 mRNA CTD PMID:17266109 Gabra1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GABRA1 protein CTD PMID:20826313 Gabra1 Rat cocaine multiple interactions EXP 6480464 Cocaine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:32209479 Gabra1 Rat cocaine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1-(3-chlorophenyl)piperazine promotes the reaction [Cocaine results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] more ... CTD PMID:23266428 Gabra1 Rat colforsin daropate hydrochloride increases expression EXP 6480464 Colforsin results in increased expression of GABRA1 CTD PMID:9147380 Gabra1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GABRA1 mRNA CTD PMID:26577399 Gabra1 Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of GABRA1 mRNA CTD PMID:18299980 Gabra1 Rat cypermethrin multiple interactions EXP 6480464 cypermethrin promotes the reaction [cypermethrin results in decreased expression of GABRA1 mRNA] and cypermethrin promotes the reaction [cypermethrin results in decreased expression of GABRA1 protein] CTD PMID:25288152 Gabra1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of GABRA1 mRNA and cypermethrin results in decreased expression of GABRA1 protein CTD PMID:25288152 Gabra1 Rat delta-hexachlorocyclohexane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [delta-hexachlorocyclohexane co-treated with Lanthanum] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:11156579 and PMID:9316872 Gabra1 Rat dexamethasone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Dexamethasone results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:9316872 Gabra1 Rat dexamethasone multiple interactions ISO Gabra1 (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Ovalbumin results in increased expression of GABRA1 mRNA] CTD PMID:37004399 Gabra1 Rat diarsenic trioxide increases expression ISO GABRA1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GABRA1 mRNA CTD PMID:20458559 Gabra1 Rat diazepam affects activity ISO GABRA1 (Homo sapiens) 6480464 Diazepam affects the activity of GABRA1 protein CTD PMID:15864560 Gabra1 Rat diazepam multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Diazepam promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] more ... CTD PMID:26344803 and PMID:29038840 Gabra1 Rat diazepam affects binding EXP 728715 Diazepam binds to Gabra1 protein RGD Gabra1 Rat diazepam decreases expression EXP 6480464 Diazepam results in decreased expression of GABRA1 mRNA CTD PMID:11804615 and PMID:15802192 Gabra1 Rat diazepam multiple interactions EXP 6480464 Diazepam promotes the reaction [Ethanol deficiency results in decreased expression of GABRA1 mRNA] CTD PMID:14684873 Gabra1 Rat diazepam increases activity EXP 6480464 Diazepam results in increased activity of GABRA1 protein CTD PMID:15613639 Gabra1 Rat diazepam multiple interactions ISO Gabra1 (Mus musculus) 6480464 Diazepam promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein]] CTD PMID:1712603 Gabra1 Rat dieldrin multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Dieldrin inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:14637376 Gabra1 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of GABRA1 mRNA CTD PMID:9600394 Gabra1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GABRA1 mRNA CTD PMID:29391264 Gabra1 Rat enflurane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Enflurane inhibits the reaction [Trichloroethylene promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]]] CTD PMID:10825391 Gabra1 Rat epoxiconazole increases expression ISO Gabra1 (Mus musculus) 6480464 epoxiconazole results in increased expression of GABRA1 mRNA CTD PMID:35436446 Gabra1 Rat ethanol multiple interactions ISO Gabra1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of GABRA1 mRNA and Ethanol promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein]] CTD PMID:1712603 and PMID:30319688 Gabra1 Rat ethanol increases expression ISO Gabra1 (Mus musculus) 6480464 Ethanol results in increased expression of GABRA1 protein CTD PMID:29044621 Gabra1 Rat ethanol affects localization EXP 6480464 Ethanol affects the localization of GABRA1 protein CTD PMID:25456265 Gabra1 Rat ethanol decreases expression ISO Gabra1 (Mus musculus) 6480464 Ethanol results in decreased expression of GABRA1 protein CTD PMID:25456265 Gabra1 Rat ethanol decreases expression EXP 6480464 Ethanol deficiency results in decreased expression of GABRA1 mRNA and Ethanol results in decreased expression of GABRA1 mRNA CTD PMID:14684873 more ... Gabra1 Rat ethanol multiple interactions EXP 6480464 Diazepam promotes the reaction [Ethanol deficiency results in decreased expression of GABRA1 mRNA] and Flumazenil inhibits the reaction [Ethanol deficiency results in decreased expression of GABRA1 mRNA] CTD PMID:14684873 and PMID:17403139 Gabra1 Rat ethanol affects response to substance ISO Gabra1 (Mus musculus) 6480464 GABRA1 protein affects the susceptibility to Ethanol CTD PMID:12490572 Gabra1 Rat ethanol increases activity ISO Gabra1 (Mus musculus) 6480464 Ethanol results in increased activity of GABRA1 protein CTD PMID:16807363 Gabra1 Rat etomidate multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Etomidate promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 binds to GABRB1 binds to GABRE]] and Etomidate promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 binds to GABRB1 binds to GABRG2]] CTD PMID:10049148 Gabra1 Rat etomidate multiple interactions EXP 6480464 Etomidate promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and Etomidate results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:12939268 Gabra1 Rat famotidine multiple interactions EXP 6480464 Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG1 protein]] more ... CTD PMID:15363660 Gabra1 Rat felbamate multiple interactions ISO GABRA1 (Homo sapiens) 6480464 felbamate results in decreased activity of [GABRA1 protein binds to GABRB1 protein] more ... CTD PMID:17056029 Gabra1 Rat fipronil multiple interactions ISO GABRA1 (Homo sapiens) 6480464 fipronil promotes the reaction [tetramethylenedisulfotetramine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein alternative form]]] more ... CTD PMID:29038840 Gabra1 Rat flumazenil affects binding EXP 728715 Flumazenil binds to Gabra1 protein RGD Gabra1 Rat flumazenil multiple interactions EXP 6480464 Flumazenil inhibits the reaction [Ethanol deficiency results in decreased expression of GABRA1 mRNA] and Flumazenil promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]] CTD PMID:17403139 and PMID:1977069 Gabra1 Rat flunitrazepam multiple interactions ISO GABRA1 (Homo sapiens) 6480464 2 more ... CTD PMID:22029276 and PMID:8632757 Gabra1 Rat flunitrazepam affects binding EXP 6480464 Flunitrazepam binds to GABRA1 protein CTD PMID:8397295 Gabra1 Rat flunitrazepam multiple interactions EXP 6480464 alphaxalone promotes the reaction [Flunitrazepam binds to GABRA1 protein] and Pentobarbital promotes the reaction [Flunitrazepam binds to GABRA1 protein] CTD PMID:8397295 Gabra1 Rat flunitrazepam affects binding ISO GABRA1 (Homo sapiens) 6480464 Flunitrazepam binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:22029276 Gabra1 Rat flurazepam affects response to substance ISO Gabra1 (Mus musculus) 6480464 GABRA1 protein affects the susceptibility to Flurazepam CTD PMID:12490572 Gabra1 Rat flurotyl multiple interactions EXP 6480464 Flurothyl results in decreased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein] CTD PMID:11090101 Gabra1 Rat gamma-aminobutyric acid multiple interactions ISO GABRA1 (Homo sapiens) 6480464 1 more ... CTD PMID:10049148 more ... Gabra1 Rat gamma-aminobutyric acid increases expression EXP 6480464 gamma-Aminobutyric Acid results in increased expression of GABRA1 mRNA CTD PMID:26924987 Gabra1 Rat gamma-aminobutyric acid increases response to substance ISO GABRA1 (Homo sapiens) 6480464 GABRA1 protein results in increased susceptibility to gamma-Aminobutyric Acid CTD PMID:15765150 Gabra1 Rat gamma-aminobutyric acid multiple interactions EXP 6480464 [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABRB2 protein co-treated with GABRG2 protein]] which results in increased transport of Chlorides more ... CTD PMID:11123204 more ... Gabra1 Rat gamma-aminobutyric acid multiple interactions ISO Gabra1 (Mus musculus) 6480464 Diazepam promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein]] more ... CTD PMID:1712603 Gabra1 Rat gamma-hexachlorocyclohexane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Hexachlorocyclohexane inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:11156579 more ... Gabra1 Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of GABRA1 mRNA CTD PMID:25572523 Gabra1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GABRA1 mRNA CTD PMID:33387578 Gabra1 Rat haloperidol decreases expression ISO Gabra1 (Mus musculus) 6480464 Haloperidol results in decreased expression of GABRA1 mRNA CTD PMID:18797397 Gabra1 Rat hexachlorophene affects expression ISO Gabra1 (Mus musculus) 6480464 Hexachlorophene affects the expression of GABRA1 mRNA CTD PMID:29301063 Gabra1 Rat iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of GABRA1 mRNA CTD PMID:18771689 Gabra1 Rat iron atom increases expression EXP 6480464 Iron deficiency results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat iron atom multiple interactions EXP 6480464 [Iron deficiency co-treated with manganese chloride] results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat iron(0) multiple interactions EXP 6480464 [Iron deficiency co-treated with manganese chloride] results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of GABRA1 mRNA CTD PMID:18771689 Gabra1 Rat iron(0) increases expression EXP 6480464 Iron deficiency results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat isoflurane increases activity ISO Gabra1 (Mus musculus) 6480464 Isoflurane results in increased activity of GABRA1 protein CTD PMID:16807363 Gabra1 Rat lanthanum atom multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [delta-hexachlorocyclohexane co-treated with Lanthanum] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] and Lanthanum promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] CTD PMID:9316872 Gabra1 Rat lead(0) increases expression ISO GABRA1 (Homo sapiens) 6480464 Lead results in increased expression of GABRA1 mRNA CTD PMID:19921347 Gabra1 Rat lead(0) affects expression ISO GABRA1 (Homo sapiens) 6480464 Lead affects the expression of GABRA1 mRNA CTD PMID:28903495 Gabra1 Rat lipopolysaccharide increases expression ISO Gabra1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of GABRA1 mRNA CTD PMID:12057914 Gabra1 Rat Lorazepam decreases expression EXP 6480464 Lorazepam results in decreased expression of GABRA1 mRNA CTD PMID:16107249 Gabra1 Rat manganese atom multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GABRA1 protein CTD PMID:32659473 Gabra1 Rat manganese(0) multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GABRA1 protein CTD PMID:32659473 Gabra1 Rat manganese(II) chloride multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GABRA1 protein CTD PMID:32659473 Gabra1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of GABRA1 mRNA CTD PMID:18771689 Gabra1 Rat manganese(II) chloride multiple interactions EXP 6480464 [Iron deficiency co-treated with manganese chloride] results in increased expression of GABRA1 protein CTD PMID:18771689 Gabra1 Rat menthone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 menthone promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat methamphetamine multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Methamphetamine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABBR2 protein co-treated with GABRG2 protein]] CTD PMID:21729720 Gabra1 Rat methapyrilene decreases methylation ISO GABRA1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of GABRA1 polyA tail CTD PMID:30157460 Gabra1 Rat methyl tert-butyl ether increases expression EXP 6480464 methyl tert-butyl ether results in increased expression of GABRA1 mRNA and methyl tert-butyl ether results in increased expression of GABRA1 protein CTD PMID:19344668 Gabra1 Rat methylmercury chloride decreases expression ISO Gabra1 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of GABRA1 mRNA CTD PMID:21385734 Gabra1 Rat methylmercury chloride multiple interactions EXP 6480464 Bicuculline inhibits the reaction [methylmercuric chloride promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]]] and methylmercuric chloride promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:27720918 Gabra1 Rat Methylone multiple interactions ISO GABRA1 (Homo sapiens) 6480464 methylone inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABBR2 protein co-treated with GABRG2 protein]] CTD PMID:21729720 Gabra1 Rat morphine decreases expression EXP 6480464 Morphine results in decreased expression of GABRA1 mRNA CTD PMID:15183518 Gabra1 Rat morphine increases expression EXP 6480464 Morphine results in increased expression of GABRA1 mRNA CTD PMID:15183518 Gabra1 Rat muscimol multiple interactions ISO Gabra1 (Mus musculus) 6480464 GABRA1 protein affects the reaction [Muscimol results in increased uptake of Chlorides] CTD PMID:12490572 Gabra1 Rat muscimol affects binding ISO GABRA1 (Homo sapiens) 6480464 Muscimol binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:22029276 Gabra1 Rat muscimol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 2 more ... CTD PMID:22029276 Gabra1 Rat Niflumic acid multiple interactions EXP 6480464 Niflumic Acid promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:27720918 Gabra1 Rat o-cresol multiple interactions EXP 6480464 2-cresol results in increased activity of [GABRG2 protein binds to GABRA1 protein binds to GABRB2 protein] CTD PMID:11399263 Gabra1 Rat oxcarbazepine increases activity EXP 6480464 oxcarbazepine results in increased activity of GABRA1 protein CTD PMID:18717705 Gabra1 Rat oxybenzone increases expression ISO Gabra1 (Mus musculus) 6480464 oxybenzone results in increased expression of GABRA1 mRNA CTD PMID:39343157 Gabra1 Rat p-menthan-3-ol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Menthol promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15588619 Gabra1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GABRA1 mRNA CTD PMID:33387578 Gabra1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GABRA1 mRNA CTD PMID:32680482 Gabra1 Rat pentetrazol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Pentylenetetrazole inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:14637376 Gabra1 Rat pentobarbital multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [Propofol co-treated with Pentobarbital] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:10049148 and PMID:9316872 Gabra1 Rat pentobarbital decreases expression EXP 6480464 Pentobarbital results in decreased expression of GABRA1 mRNA CTD PMID:8207435 Gabra1 Rat pentobarbital multiple interactions EXP 6480464 Pentobarbital promotes the reaction [Flunitrazepam binds to GABRA1 protein] more ... CTD PMID:12939268 more ... Gabra1 Rat pentobarbital affects expression EXP 6480464 Pentobarbital affects the expression of GABRA1 mRNA CTD PMID:8787126 Gabra1 Rat pentobarbital multiple interactions ISO Gabra1 (Mus musculus) 6480464 Pentobarbital promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein]] CTD PMID:1712603 Gabra1 Rat phencyclidine increases expression ISO Gabra1 (Mus musculus) 6480464 Phencyclidine results in increased expression of GABRA1 mRNA CTD PMID:17266109 Gabra1 Rat picrotoxin multiple interactions ISO GABRA1 (Homo sapiens) 6480464 delta-hexachlorocyclohexane inhibits the reaction [Picrotoxin inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]]] more ... CTD PMID:14637376 and PMID:9316872 Gabra1 Rat picrotoxin multiple interactions EXP 6480464 Picrotoxin inhibits the reaction [gamma-Aminobutyric Acid binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and Picrotoxin results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:17054655 Gabra1 Rat picrotoxinin multiple interactions ISO GABRA1 (Homo sapiens) 6480464 picrotoxinin inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein binds to GABRG2 protein alternative form]] and picrotoxinin inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein alternative form]] CTD PMID:29038840 Gabra1 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of GABRA1 mRNA CTD PMID:26923065 Gabra1 Rat pregnenolone sulfate multiple interactions EXP 6480464 pregnenolone sulfate inhibits the reaction [gamma-Aminobutyric Acid binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and pregnenolone sulfate results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:17054655 Gabra1 Rat propofol multiple interactions ISO GABRA1 (Homo sapiens) 6480464 [Propofol co-treated with Pentobarbital] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:10049148 more ... Gabra1 Rat propofol multiple interactions EXP 6480464 Propofol promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] more ... CTD PMID:11399263 and PMID:12939268 Gabra1 Rat tert-Butylbicyclophosphorothionate multiple interactions ISO GABRA1 (Homo sapiens) 6480464 alpha-hexachlorocyclohexane inhibits the reaction [tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:14637376 and PMID:9316872 Gabra1 Rat tert-Butylbicyclophosphorothionate affects binding ISO GABRA1 (Homo sapiens) 6480464 tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] and tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:14637376 and PMID:9316872 Gabra1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GABRA1 mRNA CTD PMID:32741896 Gabra1 Rat Testosterone propionate decreases expression ISO Gabra1 (Mus musculus) 6480464 Testosterone Propionate results in decreased expression of GABRA1 mRNA CTD PMID:16957604 Gabra1 Rat theophylline multiple interactions ISO Gabra1 (Mus musculus) 6480464 Theophylline results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:11234751 Gabra1 Rat thimerosal increases expression ISO GABRA1 (Homo sapiens) 6480464 Thimerosal results in increased expression of GABRA1 mRNA CTD PMID:27188386 Gabra1 Rat thymol multiple interactions EXP 6480464 Thymol results in increased activity of [GABRG2 binds to GABRA1 binds to GABRB2] CTD PMID:11399263 Gabra1 Rat thymol sulfate(1-) multiple interactions EXP 6480464 Thymol results in increased activity of [GABRG2 binds to GABRA1 binds to GABRB2] CTD PMID:11399263 Gabra1 Rat toluene multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Toluene promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]] CTD PMID:10825391 Gabra1 Rat toluene affects expression EXP 6480464 Toluene affects the expression of GABRA1 mRNA CTD PMID:17108153 and PMID:21827849 Gabra1 Rat topiramate multiple interactions EXP 6480464 topiramate inhibits the reaction [[gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein co-treated with GABRB2 protein co-treated with GABRG2 protein]] which results in increased transport of Chlorides] CTD PMID:11123204 Gabra1 Rat trichloroethene multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Enflurane inhibits the reaction [Trichloroethylene promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]]] and Trichloroethylene promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB1 protein]] CTD PMID:10825391 Gabra1 Rat trichostatin A increases expression ISO GABRA1 (Homo sapiens) 6480464 trichostatin A results in increased expression of GABRA1 mRNA CTD PMID:24935251 Gabra1 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of GABRA1 mRNA CTD PMID:33078273 Gabra1 Rat urethane multiple interactions ISO GABRA1 (Homo sapiens) 6480464 Urethane promotes the reaction [gamma-Aminobutyric Acid binds to and results in increased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:11812690 Gabra1 Rat valproic acid decreases methylation ISO GABRA1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GABRA1 gene CTD PMID:29154799 Gabra1 Rat valproic acid decreases expression ISO Gabra1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of GABRA1 mRNA CTD PMID:24896083 Gabra1 Rat valproic acid increases expression ISO GABRA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GABRA1 mRNA CTD PMID:24935251 Gabra1 Rat wogonin multiple interactions ISO Gabra1 (Mus musculus) 6480464 wogonin inhibits the reaction [Ovalbumin results in increased expression of GABRA1 mRNA] CTD PMID:37004399 Gabra1 Rat zaleplon decreases expression EXP 6480464 zaleplon deficiency results in decreased expression of GABRA1 mRNA CTD PMID:11804615 Gabra1 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [gamma-Aminobutyric Acid binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and Zinc results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:17054655 Gabra1 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [gamma-Aminobutyric Acid binds to and affects the activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein]] and Zinc results in decreased activity of [GABRA1 protein binds to GABRB2 protein binds to GABRG2 protein] CTD PMID:17054655 Gabra1 Rat zolpidem affects binding EXP 728715 Zolpidem binds to Gabra1 protein RGD Gabra1 Rat zolpidem multiple interactions ISO GABRA1 (Homo sapiens) 6480464 zolpidem binds to and results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:8632757 Gabra1 Rat zolpidem increases response to substance EXP 6480464 GABRA1 protein results in increased susceptibility to zolpidem CTD PMID:16630580 Gabra1 Rat zolpidem affects response to substance ISO Gabra1 (Mus musculus) 6480464 GABRA1 protein affects the susceptibility to zolpidem CTD PMID:12490572 Gabra1 Rat zolpidem multiple interactions EXP 6480464 [tert-butyl beta-carboline-3-carboxylate binds to and results in decreased activity of GABRA1 protein] which results in decreased susceptibility to zolpidem and zolpidem binds to and results in increased activity of GABRA1 protein CTD PMID:15698896 Gabra1 Rat zolpidem decreases expression EXP 6480464 zolpidem deficiency results in decreased expression of GABRA1 mRNA CTD PMID:11804615
(+)-beta-thujone (ISO) (+)-isoborneol (ISO) (+)-pilocarpine (EXP) (R)-camphor (ISO) 1,1,1-trichloroethane (ISO) 1-(2-methoxyphenyl)piperazine (ISO) 1-(3-(trifluoromethyl)phenyl)piperazine (ISO) 1-(3-chlorophenyl)piperazine (ISO) 1-benzylpiperazine (ISO) 1-bromopropane (EXP) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-tetrachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-Dimethylphenol (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-Methylenedioxyamphetamine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3alpha-hydroxy-5beta-pregnan-20-one (ISO) 4-ethyl-4-methylpiperidine-2,6-dione (ISO) 6-Methoxyflavanone (ISO) 6-Methoxyflavone (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) alpha-hexachlorocyclohexane (EXP,ISO) Alphaxolone (EXP) amitriptyline (EXP) ammonium chloride (EXP) amphetamine (EXP,ISO) anthracenes (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) Bacoside a (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bicuculline (EXP,ISO) bisphenol A (EXP,ISO) bromoform (ISO) butan-1-ol (ISO) camphor (ISO) cannabidiol (ISO) carbamazepine (EXP) carisoprodol (ISO) carvone (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) clozapine (ISO) cocaine (EXP,ISO) colforsin daropate hydrochloride (EXP) Cuprizon (EXP) curcumin (EXP) cypermethrin (EXP) delta-hexachlorocyclohexane (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazepam (EXP,ISO) dieldrin (EXP,ISO) endosulfan (EXP) enflurane (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) etomidate (EXP,ISO) famotidine (EXP) felbamate (ISO) fipronil (ISO) flumazenil (EXP) flunitrazepam (EXP,ISO) flurazepam (ISO) flurotyl (EXP) gamma-aminobutyric acid (EXP,ISO) gamma-hexachlorocyclohexane (EXP,ISO) gentamycin (EXP) haloperidol (ISO) hexachlorophene (ISO) iron atom (EXP) iron(0) (EXP) isoflurane (ISO) lanthanum atom (ISO) lead(0) (ISO) lipopolysaccharide (ISO) Lorazepam (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP,ISO) menthone (ISO) methamphetamine (ISO) methapyrilene (ISO) methyl tert-butyl ether (EXP) methylmercury chloride (EXP,ISO) Methylone (ISO) morphine (EXP) muscimol (ISO) Niflumic acid (EXP) o-cresol (EXP) oxcarbazepine (EXP) oxybenzone (ISO) p-menthan-3-ol (ISO) paracetamol (EXP) paraquat (EXP) pentetrazol (ISO) pentobarbital (EXP,ISO) phencyclidine (ISO) picrotoxin (EXP,ISO) picrotoxinin (ISO) poly(I:C) (EXP) pregnenolone sulfate (EXP) propofol (EXP,ISO) tert-Butylbicyclophosphorothionate (ISO) testosterone (EXP) Testosterone propionate (ISO) theophylline (ISO) thimerosal (ISO) thymol (EXP) thymol sulfate(1-) (EXP) toluene (EXP,ISO) topiramate (EXP) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (EXP) urethane (ISO) valproic acid (ISO) wogonin (ISO) zaleplon (EXP) zinc atom (EXP) zinc(0) (EXP) zolpidem (EXP,ISO)
Biological Process
cellular response to histamine (IDA) chloride transmembrane transport (IBA,IEA,ISO) chloride transport (IEA) gamma-aminobutyric acid signaling pathway (IBA,IEA,ISO) inhibitory synapse assembly (IBA,IEA,ISO,ISS) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) regulation of postsynaptic membrane potential (IEA) regulation of presynaptic membrane potential (IEA) response to auditory stimulus (IEP) response to methamphetamine hydrochloride (IEP) synaptic transmission, GABAergic (IBA,IDA,IEA,ISO,NAS)
Molecular Function
benzodiazepine receptor activity (IBA) chloride channel activity (IBA,IEA) diazepam binding (IDA) extracellular ligand-gated monoatomic ion channel activity (IEA) GABA receptor activity (IDA) GABA-A receptor activity (IDA,IEA,ISO,TAS) GABA-gated chloride ion channel activity (IBA,IDA,IEA,ISO,ISS) ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential (IDA,IMP,NAS) monoatomic ion channel activity (IEA) protein binding (IPI,ISO) transmembrane signaling receptor activity (IEA) transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (IEA,ISO)
1.
Slow phases of GABA(A) receptor desensitization: structural determinants and possible relevance for synaptic function.
Bianchi MT and Macdonald RL, J Physiol 2002 Oct 1;544(Pt 1):3-18.
2.
Neonatal development of the rat visual cortex: synaptic function of GABAA receptor alpha subunits.
Bosman LW, etal., J Physiol 2002 Nov 15;545(Pt 1):169-81.
3.
Tracking the expression of excitatory and inhibitory neurotransmission-related proteins and neuroplasticity markers after noise induced hearing loss.
Browne CJ, etal., PLoS One. 2012;7(3):e33272. doi: 10.1371/journal.pone.0033272. Epub 2012 Mar 12.
4.
Setting the time course of inhibitory synaptic currents by mixing multiple GABA(A) receptor a subunit isoforms.
Eyre MD, etal., J Neurosci. 2012 Apr 25;32(17):5853-67. doi: 10.1523/JNEUROSCI.6495-11.2012.
5.
Early phylogenetic value of the major GABA(A) receptor subunit mRNAs in the telencephalon.
Facciolo RM, etal., Exp Brain Res 2002 Feb;142(4):504-11.
6.
Proton modulation of alpha 1 beta 3 delta GABAA receptor channel gating and desensitization.
Feng HJ and Macdonald RL, J Neurophysiol 2004 Sep;92(3):1577-85. Epub 2004 May 19.
7.
Functional excitatory synapses in HEK293 cells expressing neuroligin and glutamate receptors.
Fu Z, etal., J Neurophysiol. 2003 Dec;90(6):3950-7. Epub 2003 Aug 20.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
The GABA(A) receptor alpha1 subtype in the ventral pallidum regulates alcohol-seeking behaviors.
Harvey SC, etal., J Neurosci 2002 May 1;22(9):3765-75.
11.
GABAergic Alterations in the Rat Testis after Methamphetamine Exposure.
Kaewman P, etal., Int J Med Sci. 2018 Aug 10;15(12):1349-1354. doi: 10.7150/ijms.27609. eCollection 2018.
12.
Quantitative localisation of synaptic and extrasynaptic GABAA receptor subunits on hippocampal pyramidal cells by freeze-fracture replica immunolabelling.
Kasugai Y, etal., Eur J Neurosci. 2010 Dec;32(11):1868-88. doi: 10.1111/j.1460-9568.2010.07473.x. Epub 2010 Nov 14.
13.
Cell type- and input-specific differences in the number and subtypes of synaptic GABA(A) receptors in the hippocampus.
Klausberger T, etal., J Neurosci 2002 Apr 1;22(7):2513-21.
14.
Cryo-EM structure of the human α1β3γ2 GABAA receptor in a lipid bilayer.
Laverty D, etal., Nature. 2019 Jan;565(7740):516-520. doi: 10.1038/s41586-018-0833-4. Epub 2019 Jan 2.
15.
Expression of gamma-aminobutyric acid A receptor subunits alpha1, beta1, gamma2 mRNA in rats with hepatic encephalopathy.
Li XQ, etal., World J Gastroenterol. 2005 Jun 7;11(21):3319-22.
16.
Cerebellar GABAA receptor selective for a behavioural alcohol antagonist.
Luddens H, etal., Nature 1990 Aug 16;346(6285):648-51.
17.
Divergent GABA(A) receptor-mediated synaptic transmission in genetically seizure-prone and seizure-resistant rats.
McIntyre DC, etal., J Neurosci 2002 Nov 15;22(22):9922-31.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
Spontaneous and gamma-aminobutyric acid (GABA)-activated GABA(A) receptor channels formed by epsilon subunit-containing isoforms.
Neelands TR, etal., Mol Pharmacol. 1999 Jan;55(1):168-78. doi: 10.1124/mol.55.1.168.
21.
The alpha 6 subunit of the GABAA receptor is concentrated in both inhibitory and excitatory synapses on cerebellar granule cells.
Nusser Z, etal., J Neurosci. 1996 Jan;16(1):103-14.
22.
Segregation of different GABAA receptors to synaptic and extrasynaptic membranes of cerebellar granule cells.
Nusser Z, etal., J Neurosci. 1998 Mar 1;18(5):1693-703.
23.
Differential synaptic localization of two major gamma-aminobutyric acid type A receptor alpha subunits on hippocampal pyramidal cells.
Nusser Z, etal., Proc Natl Acad Sci U S A. 1996 Oct 15;93(21):11939-44.
24.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
25.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
26.
GOA pipeline
RGD automated data pipeline
27.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Gamma-aminobutyric acid receptor (GABA(A)) subunits in rat nucleus tractus solitarii (NTS) revealed by polymerase chain reaction (PCR) and immunohistochemistry.PG - 241-57
Saha S, etal., Mol Cell Neurosci 2001 Jan;17(1):241-57.
30.
Histamine action on vertebrate GABAA receptors: direct channel gating and potentiation of GABA responses.
Saras A, etal., J Biol Chem. 2008 Apr 18;283(16):10470-5. doi: 10.1074/jbc.M709993200. Epub 2008 Feb 15.
31.
Ethanol concentration-dependent alterations in gene expression during acute binge drinking in the HIV-1 transgenic rat.
Sarkar S and Chang SL, Alcohol Clin Exp Res. 2013 Jul;37(7):1082-90. doi: 10.1111/acer.12077. Epub 2013 Feb 15.
32.
The GABAA receptor family: molecular and functional diversity.
Seeburg PH, etal., Cold Spring Harb Symp Quant Biol 1990;55(48):29-40.
33.
Comparative surface accessibility of a pore-lining threonine residue (T6') in the glycine and GABA(A) receptors.
Shan Q, etal., J Biol Chem 2002 Nov 22;277(47):44845-53.
34.
GABAA receptor-associated phosphoinositide 3-kinase is required for insulin-induced recruitment of postsynaptic GABAA receptors.
Vetiska SM, etal., Neuropharmacology. 2007 Jan;52(1):146-55. Epub 2006 Aug 4.
35.
A single histidine in GABAA receptors is essential for benzodiazepine agonist binding.
Wieland HA, etal., J Biol Chem 1992 Jan 25;267(3):1426-9.
36.
Chronic alcohol exposure induced gut microbiota dysbiosis and its correlations with neuropsychic behaviors and brain BDNF/Gabra1 changes in mice.
Xu Z, etal., Biofactors. 2019 Mar;45(2):187-199. doi: 10.1002/biof.1469. Epub 2018 Nov 12.
37.
GARLH Family Proteins Stabilize GABAA Receptors at Synapses.
Yamasaki T, etal., Neuron. 2017 Mar 8;93(5):1138-1152.e6. doi: 10.1016/j.neuron.2017.02.023.
38.
Structure of a human synaptic GABAA receptor.
Zhu S, etal., Nature. 2018 Jul;559(7712):67-72. doi: 10.1038/s41586-018-0255-3. Epub 2018 Jun 27.
Gabra1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 27,096,731 - 27,152,563 (-) NCBI GRCr8 mRatBN7.2 10 26,595,151 - 26,650,611 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 26,595,160 - 26,650,864 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 31,330,824 - 31,385,752 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 30,819,357 - 30,874,277 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 26,306,024 - 26,360,948 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 27,310,718 - 27,371,802 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 27,310,725 - 27,366,665 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 27,154,354 - 27,209,873 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 27,258,813 - 27,313,725 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 27,261,880 - 27,312,049 (-) NCBI Celera 10 26,109,305 - 26,164,180 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
GABRA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 161,847,191 - 161,899,971 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 161,847,063 - 161,899,981 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 161,274,197 - 161,326,977 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 161,206,983 - 161,258,992 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 161,206,982 - 161,258,990 NCBI Celera 5 157,305,487 - 157,357,959 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI HuRef 5 156,366,532 - 156,419,379 (+) NCBI HuRef CHM1_1 5 160,706,630 - 160,759,375 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 162,376,027 - 162,428,794 (+) NCBI T2T-CHM13v2.0
Gabra1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 42,021,766 - 42,073,893 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 42,021,766 - 42,073,757 (-) Ensembl GRCm39 Ensembl GRCm38 11 42,130,939 - 42,183,066 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 42,130,939 - 42,182,930 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 41,944,982 - 41,996,432 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 41,974,903 - 42,026,353 (-) NCBI MGSCv36 mm8 Celera 11 45,953,528 - 46,009,149 (-) NCBI Celera Cytogenetic Map 11 A5 NCBI cM Map 11 24.97 NCBI
Gabra1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 15,608,984 - 15,662,597 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 15,608,984 - 15,662,309 (+) NCBI ChiLan1.0 ChiLan1.0
GABRA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 157,030,426 - 157,083,204 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 155,169,973 - 155,222,751 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 157,234,725 - 157,287,475 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 163,928,392 - 163,981,127 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 163,928,392 - 163,981,117 (+) Ensembl panpan1.1 panPan2
GABRA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 49,006,981 - 49,065,205 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 49,009,495 - 49,062,581 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 48,898,592 - 48,956,801 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 49,439,269 - 49,497,701 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 49,421,345 - 49,497,509 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 49,246,182 - 49,304,589 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 49,379,685 - 49,437,823 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 49,902,613 - 49,960,850 (-) NCBI UU_Cfam_GSD_1.0
Gabra1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 103,356,153 - 103,409,858 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936515 1,805,239 - 1,859,600 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936515 1,806,721 - 1,859,227 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GABRA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 61,656,587 - 61,723,119 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 61,656,583 - 61,723,428 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 66,816,724 - 66,883,547 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GABRA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 64,199,372 - 64,255,996 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 64,200,752 - 64,255,996 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 13,304,237 - 13,354,528 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gabra1
.
Predicted Target Of
Count of predictions: 415 Count of miRNA genes: 221 Interacting mature miRNAs: 301 Transcripts: ENSRNOT00000004725 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
8
38
113
76
75
44
24
44
6
175
76
93
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004725 ⟹ ENSRNOP00000004725
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 26,595,160 - 26,650,864 (-) Ensembl Rnor_6.0 Ensembl 10 27,310,725 - 27,366,665 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104024 ⟹ ENSRNOP00000087043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 26,595,160 - 26,648,523 (-) Ensembl
RefSeq Acc Id:
NM_183326 ⟹ NP_899155
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 27,097,277 - 27,152,189 (-) NCBI mRatBN7.2 10 26,595,697 - 26,650,611 (-) NCBI Rnor_6.0 10 27,311,264 - 27,366,241 (-) NCBI Rnor_5.0 10 27,154,354 - 27,209,873 (-) NCBI RGSC_v3.4 10 27,258,813 - 27,313,725 (-) RGD Celera 10 26,109,305 - 26,164,180 (-) RGD
Sequence:
TGGGAAGCAAATTTGGGTATGAAATCTCTAGTGCAGGAGCACGCAGAGTCCATGATGGCTCAAACCGTGTGAGTGAGCGCGGCGCGAGGACGCCCTCCGCCCGGCGCGCCCGCGCTCGCACACTCGCG
hide sequence
RefSeq Acc Id:
XM_006246123 ⟹ XP_006246185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 27,096,731 - 27,151,649 (-) NCBI mRatBN7.2 10 26,595,151 - 26,649,962 (-) NCBI Rnor_6.0 10 27,310,718 - 27,365,666 (-) NCBI Rnor_5.0 10 27,154,354 - 27,209,873 (-) NCBI
Sequence:
ATCAGCTAAAGTTGAGAGGTTAGGACAGAAAACCTGTCACGCAGTTTCATTCTAAGGAAGACTG
hide sequence
RefSeq Acc Id:
XM_006246124 ⟹ XP_006246186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 27,096,731 - 27,152,563 (-) NCBI mRatBN7.2 10 26,595,151 - 26,650,315 (-) NCBI Rnor_6.0 10 27,310,718 - 27,366,004 (-) NCBI Rnor_5.0 10 27,154,354 - 27,209,873 (-) NCBI
Sequence:
CACAGCTTGCAATCTGCCTTTGTCCTAGCTGGAGAGGCAGAGATGTTCTAGTGGGGAAGAGAGCAGGAGCAGCAGGACAGGAGCTGAAGCTGGGAGCAGCTGGACAAGCCCGTGATGAAGAAAAGTCG
hide sequence
RefSeq Acc Id:
NP_899155 ⟸ NM_183326
- Peptide Label:
precursor
- UniProtKB:
Q53YK4 (UniProtKB/Swiss-Prot), P62813 (UniProtKB/Swiss-Prot), A6HDL5 (UniProtKB/TrEMBL), A0A8I6A7P4 (UniProtKB/TrEMBL)
- Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFH
hide sequence
RefSeq Acc Id:
XP_006246186 ⟸ XM_006246124
- Peptide Label:
isoform X1
- UniProtKB:
Q53YK4 (UniProtKB/Swiss-Prot), P62813 (UniProtKB/Swiss-Prot), A6HDL5 (UniProtKB/TrEMBL), A0A8I6A7P4 (UniProtKB/TrEMBL)
- Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFH
hide sequence
RefSeq Acc Id:
XP_006246185 ⟸ XM_006246123
- Peptide Label:
isoform X1
- UniProtKB:
Q53YK4 (UniProtKB/Swiss-Prot), P62813 (UniProtKB/Swiss-Prot), A6HDL5 (UniProtKB/TrEMBL), A0A8I6A7P4 (UniProtKB/TrEMBL)
- Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFH
hide sequence
Ensembl Acc Id:
ENSRNOP00000004725 ⟸ ENSRNOT00000004725
Ensembl Acc Id:
ENSRNOP00000087043 ⟸ ENSRNOT00000104024
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-06
Gabra1
gamma-aminobutyric acid type A receptor subunit alpha 1
Gabra1
gamma-aminobutyric acid type A receptor alpha1 subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-11
Gabra1
gamma-aminobutyric acid type A receptor alpha1 subunit
Gabra1
gamma-aminobutyric acid (GABA) A receptor, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-04
Gabra1
gamma-aminobutyric acid (GABA) A receptor, alpha 1
Gabra1
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-11
Gabra1
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 1
Gabra1
gamma-aminobutyric acid (GABA) A receptor, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Gabra1
gamma-aminobutyric acid (GABA) A receptor, alpha 1
Gabra1
gamma-aminobutyric acid A receptor, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Gabra1
gamma-aminobutyric acid A receptor, alpha 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to both cytoplasmic and subsynaptic sites of NTS neurons
625528
gene_cellular_localization
localized to synapses made by PV-positive and PV-negative boutons
625672
gene_cellular_localization
localized to synapses made by PV-positive and PV-negative boutons
628376
gene_expression
mRNA highly expressed in nucleus tractus solitarii and protein expression was seen in many neurons throughout most areas of the medulla
625528
gene_expression
expressed in pyramidal cell somata
625672
gene_expression
amygdala kindling models of temporal lobe epilepsy (TLE) differential kindling rates are correlated with differences in Gabra1 subunit expression
628376
gene_other
inhibitory synaptic signals differ considerably in strains of rats that have different profiles of GABAA receptor subunit expression and concomitant genetic predispositions for or against kindling
628376
gene_process
may mediate inhibitory GABA responses in nucleus tractus solitarii (NTS) in brain
625528
gene_process
plays a role in regulating the reinforcing properties of alcohol in the ventral pallidum (VP)
625694
gene_process
may mediate the rhythmicity of neural networks
628376
