Uchl1 (ubiquitin C-terminal hydrolase L1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Uchl1 (ubiquitin C-terminal hydrolase L1) Rattus norvegicus

Analyze

Symbol:

Uchl1

Name:

ubiquitin C-terminal hydrolase L1

RGD ID:

3928

Description:

Predicted to enable several functions, including alpha-2A adrenergic receptor binding activity; peptidase activity; and ubiquitin protein ligase binding activity. Involved in ubiquitin-dependent protein catabolic process. Predicted to be located in several cellular components, including neuron projection terminus; neuronal cell body; and nucleoplasm. Predicted to be active in cytoplasm. Predicted to colocalize with plasma membrane. Biomarker of retinal disease. Human ortholog(s) of this gene implicated in Alzheimer's disease; Parkinson's disease; hereditary spastic paraplegia 79A; and hereditary spastic paraplegia 79B. Orthologous to human UCHL1 (ubiquitin C-terminal hydrolase L1); PARTICIPATES IN Parkinson's disease pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

neuron cytoplasmic protein 9.5; PGP 9.5; PGP9.5; ubiquitin carboxy-terminal hydrolase L1; ubiquitin carboxyl-terminal esterase L1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L1; ubiquitin thioesterase L1; UCH-L1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UCHL1 (ubiquitin C-terminal hydrolase L1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):	Uchl1 (ubiquitin carboxy-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Uchl1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UCHL1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UCHL1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Uchl1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UCHL1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UCHL1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Uchl1 (ubiquitin C-terminal hydrolase L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	G0S2 (G0/G1 switch 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	UCHL1 (ubiquitin C-terminal hydrolase L1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Uchl1 (ubiquitin carboxy-terminal hydrolase L1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	uchl1 (ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Uch	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YUH1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	uchl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	41,485,031 - 41,495,590 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	41,831,048 - 41,841,616 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	43,131,128 - 43,141,696 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	41,611,942 - 41,622,510 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	43,133,224 - 43,143,942 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	43,133,218 - 43,143,973 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	42,928,247 - 42,938,981 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	44,114,392 - 44,124,947 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	44,116,782 - 44,127,338 (-)	NCBI
Celera	14	40,639,549 - 40,650,302 (-)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

Deglutition Disorders (ISO)

Diaphragmatic Hernia (ISO)

Esophageal Neoplasms (ISO)

Gallbladder Neoplasms (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

hereditary spastic paraplegia 79A (ISO)

hereditary spastic paraplegia 79B (ISO)

Hyperglycinemia, Lactic Acidosis, and Seizures (ISO)

lung non-small cell carcinoma (ISO)

neuroaxonal dystrophy (ISO)

Parkinson's disease (ISO)

Parkinson's Disease 5 (ISO)

peripheral nervous system disease (ISO)

retinal disease (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1,2-naphthoquinone (ISO)

1,3-dinitrobenzene (EXP)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

4-hydroxynon-2-enal (ISO)

4-methylcatechol (ISO)

4-phenylbutyric acid (EXP)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

actinomycin D (EXP)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

antimycin A (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azoxystrobin (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlordecone (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

choline (ISO)

cobalt atom (ISO)

cocaine (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

Cuprizon (ISO)

cycloheximide (EXP)

cyclosporin A (ISO)

daidzein (ISO)

deguelin (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

endosulfan (EXP)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (EXP,ISO)

fenvalerate (EXP)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

genistein (EXP,ISO)

glutathione (ISO)

glycitein (ISO)

glyphosate (ISO)

hydrogen peroxide (ISO)

isoprenaline (ISO)

ivermectin (ISO)

kainic acid (EXP)

L-methionine (ISO)

Licochalcone B (ISO)

lidocaine (ISO)

maneb (ISO)

manganese atom (EXP)

manganese(0) (EXP)

manganese(II) chloride (EXP)

mercury dibromide (ISO)

methamphetamine (EXP,ISO)

methylmercury chloride (ISO)

mevinphos (EXP)

mitomycin C (ISO)

mitoxantrone (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

naphthalene (ISO)

nickel dichloride (EXP)

nicotine (ISO)

nitrofen (EXP)

oxidopamine (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paclitaxel (EXP)

paracetamol (ISO)

paraquat (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl isothiocyanate (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

pinosylvin (ISO)

pirinixic acid (ISO)

progesterone (EXP)

pyrogallol (ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

resiniferatoxin (ISO)

rotenone (ISO)

rutin (EXP)

sarin (EXP)

SB 431542 (ISO)

silicon dioxide (EXP)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium chromate (ISO)

sodium fluoride (ISO)

streptozocin (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

T-2 toxin (EXP)

tebufenpyrad (ISO)

thapsigargin (EXP)

theophylline (EXP)

titanium dioxide (ISO)

topotecan (ISO)

trans-pinosylvin (ISO)

trichostatin A (ISO)

triptonide (ISO)

Tungsten carbide (ISO)

valproic acid (EXP,ISO)

vincristine (EXP)

vitamin E (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult walking behavior (ISO)

axon target recognition (ISO)

axonal transport of mitochondrion (ISO)

axonogenesis (ISO)

cellular response to xenobiotic stimulus (ISO)

eating behavior (ISO)

male germ cell proliferation (ISO)

muscle cell development (ISO)

neuromuscular process (ISO)

response to ischemia (ISO)

substantia nigra development (ISO)

ubiquitin-dependent protein catabolic process (IDA,IEA)

Cellular Component

axon (ISO)

axon cytoplasm (IEA)

cytoplasm (IBA,ISO)

cytosol (ISO)

endoplasmic reticulum membrane (IEA)

neuron projection terminus (ISO)

neuronal cell body (ISO)

nucleoplasm (IEA,ISO)

plasma membrane (ISO)

Molecular Function

alpha-2A adrenergic receptor binding (ISO)

cysteine-type deubiquitinase activity (IBA,IEA,ISO)

cysteine-type endopeptidase activity (ISO)

omega peptidase activity (ISO)

protein binding (ISO)

ubiquitin binding (ISO)

ubiquitin protein ligase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Oxidative modifications and down-regulation of ubiquitin carboxyl-terminal hydrolase L1 associated with idiopathic Parkinson's and Alzheimer's diseases.	Choi J, etal., J Biol Chem. 2004 Mar 26;279(13):13256-64. Epub 2004 Jan 13.
2.	The ubiquitin proteasome system in neurodegenerative diseases: sometimes the chicken, sometimes the egg.	Ciechanover A and Brundin P, Neuron 2003 Oct 9;40(2):427-46.
3.	Changes in ocular aquaporin-4 (AQP4) expression following retinal injury.	Dibas A, etal., Mol Vis. 2008 Sep 25;14:1770-83.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Patient education: how we designed our own program.	Hoffman LE Jr Group Pract 1976 Sep-Oct;25(5):21-4.
7.	cDNA cloning and tissue distribution of a rat ubiquitin carboxyl-terminal hydrolase PGP9.5.	Kajimoto Y, etal., J Biochem (Tokyo) 1992 Jul;112(1):28-32.
8.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
9.	Loss of Uch-L1 and Uch-L3 leads to neurodegeneration, posterior paralysis and dysphagia.	Kurihara LJ, etal., Hum Mol Genet 2001 Sep 1;10(18):1963-70.
10.	The ubiquitin pathway in Parkinson's disease.	Leroy E, etal., Nature 1998 Oct 1;395(6701):451-2.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	A role of the ubiquitin-proteasome system in neuropathic pain.	Moss A, etal., J Neurosci 2002 Feb 15;22(4):1363-72.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Intragenic deletion in the gene encoding ubiquitin carboxy-terminal hydrolase in gad mice.	Saigoh K, etal., Nat Genet 1999 Sep;23(1):47-51.
20.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1630580	PMID:2558488	PMID:3340629	PMID:7555927	PMID:8007658	PMID:8474599	PMID:8639624	PMID:8896700	PMID:9521656	PMID:11466438	PMID:11549719	PMID:11739622
PMID:12074562	PMID:12107488	PMID:12408865	PMID:12477932	PMID:12638230	PMID:12866128	PMID:12913066	PMID:14695319	PMID:14973275	PMID:15489334	PMID:17011532	PMID:17599367
PMID:17634366	PMID:17690318	PMID:18616865	PMID:19267071	PMID:19477270	PMID:19725078	PMID:20231490	PMID:20387083	PMID:20933087	PMID:21069350	PMID:21606356	PMID:22871113
PMID:22926577	PMID:23064229	PMID:23284756	PMID:23376485	PMID:23599427	PMID:24090154	PMID:24625528	PMID:24760869	PMID:25326379	PMID:25638021	PMID:25763798	PMID:28500221
PMID:29339092	PMID:29964011	PMID:30305579	PMID:30551363	PMID:31041655	PMID:34130526	PMID:36952018

Genomics

Comparative Map Data

Uchl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	41,485,031 - 41,495,590 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	41,831,048 - 41,841,616 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	43,131,128 - 43,141,696 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	41,611,942 - 41,622,510 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	43,133,224 - 43,143,942 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	43,133,218 - 43,143,973 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	42,928,247 - 42,938,981 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	44,114,392 - 44,124,947 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	44,116,782 - 44,127,338 (-)	NCBI
Celera	14	40,639,549 - 40,650,302 (-)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

UCHL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	41,256,928 - 41,268,455 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	41,256,413 - 41,268,455 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	41,258,945 - 41,270,472 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	40,953,686 - 40,965,203 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	41,099,856 - 41,111,373	NCBI
Celera	4	41,702,199 - 41,713,746 (+)	NCBI		Celera
Cytogenetic Map	4	p13	NCBI
HuRef	4	40,580,844 - 40,592,391 (+)	NCBI		HuRef
CHM1_1	4	41,259,044 - 41,270,591 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	41,230,716 - 41,242,242 (+)	NCBI		T2T-CHM13v2.0

Uchl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	66,833,464 - 66,844,577 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	66,833,434 - 66,844,577 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	66,676,121 - 66,687,234 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	66,676,091 - 66,687,234 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	67,067,360 - 67,078,473 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	66,955,425 - 66,966,369 (+)	NCBI		MGSCv36	mm8
Celera	5	63,976,841 - 63,987,914 (+)	NCBI		Celera
Cytogenetic Map	5	C3.1	NCBI
cM Map	5	35.95	NCBI

Uchl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	6,367,460 - 6,380,462 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	6,367,519 - 6,379,638 (-)	NCBI	ChiLan1.0	ChiLan1.0

UCHL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	41,633,489 - 41,645,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	35,580,755 - 35,592,314 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	41,432,367 - 41,440,129 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	41,428,759 - 41,440,129 (+)	Ensembl	panpan1.1		panPan2

UCHL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	71,396,694 - 71,430,395 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	71,370,822 - 71,411,350 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	73,946,978 - 73,961,370 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	72,157,557 - 72,171,966 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	3	71,427,585 - 71,441,983 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	71,589,640 - 71,604,050 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	71,972,745 - 71,987,146 (-)	NCBI		UU_Cfam_GSD_1.0

Uchl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	37,734,649 - 37,746,530 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	8,551,603 - 8,563,651 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936482	8,551,749 - 8,563,586 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UCHL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	32,353,246 - 32,367,332 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	32,353,766 - 32,367,288 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	33,970,620 - 33,982,399 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UCHL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	9,074,961 - 9,086,606 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	9,074,923 - 9,086,517 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	55,406,774 - 55,418,174 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Uchl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	25,784,257 - 25,797,549 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	25,786,028 - 25,797,641 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Uchl1
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	57
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000003248
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39998251	75582726	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat

Markers in Region

RH128109

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	41,485,066 - 41,485,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	43,133,258 - 43,133,443	NCBI	Rnor6.0
Rnor_5.0	14	42,928,281 - 42,928,466	UniSTS	Rnor5.0
RGSC_v3.4	14	44,114,426 - 44,114,611	UniSTS	RGSC3.4
Celera	14	40,639,583 - 40,639,768	UniSTS
Cytogenetic Map	14	p11	UniSTS

BF399140

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	41,492,213 - 41,492,422 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	43,140,568 - 43,140,776	NCBI	Rnor6.0
Rnor_5.0	14	42,935,591 - 42,935,799	UniSTS	Rnor5.0
RGSC_v3.4	14	44,121,573 - 44,121,781	UniSTS	RGSC3.4
Celera	14	40,646,926 - 40,647,134	UniSTS
Cytogenetic Map	14	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High									46
Medium	3	24	20	6	6	6			28	23	38
Low		19	26	24	13	24	7	9		12	3	11	7
Below cutoff			9	9		9	1	2					1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060573	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212714	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003248 ⟹ ENSRNOP00000003248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl
Rnor_6.0 Ensembl	14	43,133,218 - 43,143,973 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094226 ⟹ ENSRNOP00000086461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106879 ⟹ ENSRNOP00000082700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl

RefSeq Acc Id:

NM_017237 ⟹ NP_058933

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	41,485,031 - 41,495,590 (-)	NCBI
Rnor_6.0	14	43,133,224 - 43,143,942 (-)	NCBI
Rnor_5.0	14	42,928,247 - 42,938,981 (-)	NCBI
RGSC_v3.4	14	44,114,392 - 44,124,947 (-)	RGD
Celera	14	40,639,549 - 40,650,302 (-)	RGD

Sequence:

show sequence

GGCTGTTTTTTGGCTCCTGCGCTTGTTCTTCCCTGTGCACTCCGCAAAGATGCAGCTGAAACCG
ATGGAGATTAACCCCGAGATGCTGAACAAAGTGTTGGCCAAGCTGGGGGTCGCCGGGCAGTGGC
GCTTTGCCGACGTGCTAGGGCTGGAGGAGGAGACTCTGGGCTCAGTGCCATCTCCTGCCTGCGC
CCTGCTGCTGCTGTTTCCCCTCACGGCCCAGCATGAAAACTTCAGGAAAAAACAAATTGAGGAA
CTGAAGGGACAAGAAGTTAGCCCTAAAGTTTACTTCATGAAGCAGACCATCGGGAACTCCTGTG
GTACCATTGGGCTGATCCACGCAGTGGCCAATAACCAAGACAAGCTGGAATTTGAGGATGGATC
AGTCCTGAAACAGTTTCTGTCTGAAACGGAGAAGTTGTCCCCTGAAGACAGAGCCAAGTGTTTC
GAGAAGAACGAGGCCATTCAGGCAGCCCATGACTCCGTGGCCCAGGAGGGCCAGTGCCGGGTAG
ACGACAAAGTGAATTTCCATTTTATCCTGTTCAATAATGTGGACGGCCACCTCTACGAGCTCGA
TGGGCGAATGCCTTTCCCGGTGAACCATGGCGCCAGTTCAGAGGACTCTCTGCTGCAGGATGCC
GCCAAGGTCTGCAGAGAATTCACTGAGCGCGAGCAGGGAGAGGTCCGCTTCTCCGCAGTGGCTC
TCTGCAAAGCAGCCTAAGTAGGGAGAGAGAACCAGCCGCTCCCCCATCCCTGGGCAGGTGCGCG
CTGCCCTGCCCTTGGTTTGCAGCTTTAGCACTTAACAACCACAGCTGTCTTCTTGCGTTCTACT
GCCCCGTCCCCTCCACCCCACCCAGGCCACCAGGGAGCTCTGTGACAGCCACACCAGTGTGAAC
TTCAGAGGCTAAGCTCTTACCCTCCTGTGTCTTGTACCTTGCTCTCTATGGTCTCTTTGGTTTC
TGTAAGTTACGGCCTTGGATGTGGTTTGTCTAGTCCTCAAGAGGAAGAATAAAACTTTTCTGCT
GGCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058933	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60573	(Get FASTA)	NCBI Sequence Viewer
	BAA01541	(Get FASTA)	NCBI Sequence Viewer
	EDL90037	(Get FASTA)	NCBI Sequence Viewer
	EDL90038	(Get FASTA)	NCBI Sequence Viewer
	EDL90039	(Get FASTA)	NCBI Sequence Viewer
	EDL90040	(Get FASTA)	NCBI Sequence Viewer
	Q00981	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058933 ⟸ NM_017237
- UniProtKB:	Q6P9V8 (UniProtKB/Swiss-Prot), Q00981 (UniProtKB/Swiss-Prot), A6JDB6 (UniProtKB/TrEMBL), A0A8I6G7R6 (UniProtKB/TrEMBL), A0A8L2Q0S4 (UniProtKB/TrEMBL), A6JDB5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRK KQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPED RAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDS LLQDAAKVCREFTEREQGEVRFSAVALCKAA hide sequence

RefSeq Acc Id:

ENSRNOP00000003248 ⟸ ENSRNOT00000003248

RefSeq Acc Id:

ENSRNOP00000086461 ⟸ ENSRNOT00000094226

RefSeq Acc Id:

ENSRNOP00000082700 ⟸ ENSRNOT00000106879

Protein Domains

Ubiquitin carboxyl-terminal hydrolase family

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q00981-F1-model_v2	AlphaFold	Q00981	1-223	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3928	AgrOrtholog
BioCyc Gene	G2FUF-15768	BioCyc
Ensembl Genes	ENSRNOG00000002343	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000003248.4	UniProtKB/TrEMBL
	ENSRNOP00000082700.1	UniProtKB/TrEMBL
	ENSRNOP00000086461	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003248.6	UniProtKB/TrEMBL
	ENSRNOT00000094226	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000106879.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.532.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6920680	IMAGE-MGC_LOAD
InterPro	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C12_UCH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C12_UCH_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29545	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72862	IMAGE-MGC_LOAD
NCBI Gene	29545	ENTREZGENE
PANTHER	PTHR10589	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10589:SF19	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Peptidase_C12	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Uchl1	PhenoGen
PRINTS	UBCTHYDRLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	UCH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228392
UniProt	A0A8I6G7R6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q0S4	ENTREZGENE, UniProtKB/TrEMBL
	A6JDB5	ENTREZGENE, UniProtKB/TrEMBL
	A6JDB6	ENTREZGENE, UniProtKB/TrEMBL
	A6JDB7_RAT	UniProtKB/TrEMBL
	A6JDB8_RAT	UniProtKB/TrEMBL
	Q00981	ENTREZGENE
	Q6P9V8	ENTREZGENE
	UCHL1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q6P9V8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-19	Uchl1	ubiquitin C-terminal hydrolase L1	Uchl1	ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-08-29	Uchl1	ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)	Uchl1	ubiquitin carboxy-terminal hydrolase L1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Uchl1	ubiquitin carboxy-terminal hydrolase L1			Name updated	70584	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)