Advanced Search (OLGA)

Gene: Uchl1 (ubiquitin C-terminal hydrolase L1) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Uchl1

Name:

ubiquitin C-terminal hydrolase L1

RGD ID:

8799930

Description:

ENCODES a protein that exhibits alpha-2A adrenergic receptor binding (ortholog); cysteine-type deubiquitinase activity (ortholog); cysteine-type endopeptidase activity (ortholog); INVOLVED IN adult walking behavior (ortholog); axon target recognition (ortholog); axonal transport of mitochondrion (ortholog); ASSOCIATED WITH Alzheimer's disease (ortholog); Deglutition Disorders (ortholog); Diaphragmatic Hernia (ortholog); FOUND IN axon (ortholog); cytoplasm (ortholog); cytosol (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	6,367,460 - 6,380,462 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	6,367,519 - 6,379,638 (-)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	Alzheimer's disease		ISO	UCHL1 (Homo sapiens)	9068941		RGD	PMID:14722078 and REF_RGD_ID:1580538
Uchl1	Chinchilla	Deglutition Disorders		ISO	Uchl1 (Mus musculus)	9068941	DNA:deletion	RGD	PMID:11555633 and REF_RGD_ID:1302546
Uchl1	Chinchilla	neuroaxonal dystrophy		ISO	Uchl1 (Mus musculus)	9068941	DNA:deletion	RGD	PMID:11555633 and REF_RGD_ID:1302546
Uchl1	Chinchilla	retinal disease		ISO	Uchl1 (Rattus norvegicus)	9068941	mRNA:decreased expression:retina	RGD	PMID:18836575 and REF_RGD_ID:5490154

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	genetic disease		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:17576681 more ...
Uchl1	Chinchilla	hereditary spastic paraplegia 79A		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic paraplegia 79A more ...	ClinVar	PMID:25741868 more ...
Uchl1	Chinchilla	hereditary spastic paraplegia 79B		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Early-onset progressive neurodegeneration-blindness-ataxia-spasticity syndrome	ClinVar	PMID:10203348 more ...
Uchl1	Chinchilla	Hyperglycinemia, Lactic Acidosis, and Seizures		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: HYPERGLYCINEMIA more ...	ClinVar	PMID:28492532
Uchl1	Chinchilla	Parkinson's disease		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parkinson Disease and Dominant	ClinVar	PMID:25741868 and PMID:28492532
Uchl1	Chinchilla	Parkinson's Disease 5		ISO	UCHL1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10203348 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	Diaphragmatic Hernia		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18958481
Uchl1	Chinchilla	Esophageal Neoplasms		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:15930319
Uchl1	Chinchilla	Gallbladder Neoplasms		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:16965602
Uchl1	Chinchilla	hepatocellular carcinoma		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18666234
Uchl1	Chinchilla	lung non-small cell carcinoma		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17094902
Uchl1	Chinchilla	peripheral nervous system disease		ISO	UCHL1 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:16797537

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	hereditary spastic paraplegia 79A		ISO	UCHL1 (Homo sapiens)	7240710		OMIM
Uchl1	Chinchilla	hereditary spastic paraplegia 79B		ISO	UCHL1 (Homo sapiens)	7240710		OMIM
Uchl1	Chinchilla	Parkinson's Disease 5		ISO	UCHL1 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	adult walking behavior	acts_upstream_of_or_within	ISO	MGI:1355274	9068941	PMID:11555633	MGI	PMID:11555633
Uchl1	Chinchilla	adult walking behavior	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:11555633 and PMID:3340629	MGI	PMID:11555633 and PMID:3340629
Uchl1	Chinchilla	axon target recognition	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:8474599	MGI	PMID:8474599
Uchl1	Chinchilla	axonal transport of mitochondrion	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:2558488	MGI	PMID:2558488
Uchl1	Chinchilla	axonogenesis	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:1630580	MGI	PMID:1630580
Uchl1	Chinchilla	cellular response to xenobiotic stimulus	involved_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:23064229	MGI	PMID:23064229
Uchl1	Chinchilla	eating behavior	acts_upstream_of_or_within	ISO	MGI:1355274	9068941	PMID:11555633	MGI	PMID:11555633
Uchl1	Chinchilla	male germ cell proliferation	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:12638230	MGI	PMID:12638230
Uchl1	Chinchilla	muscle cell development	acts_upstream_of_or_within	ISO	MGI:94909	9068941	PMID:8007658	MGI	PMID:8007658
Uchl1	Chinchilla	negative regulation of MAPK cascade	involved_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:19477270	BHF-UCL	PMID:19477270
Uchl1	Chinchilla	neuromuscular process	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:3340629 and PMID:7555927	MGI	PMID:3340629 and PMID:7555927
Uchl1	Chinchilla	positive regulation of glycolytic process	involved_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:34244144	FlyBase	PMID:34244144
Uchl1	Chinchilla	protein deubiquitination	involved_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:9521656	UniProt	PMID:9521656
Uchl1	Chinchilla	response to ischemia	acts_upstream_of_or_within	ISO	MGI:1856882	9068941	PMID:14695319	MGI	PMID:14695319
Uchl1	Chinchilla	substantia nigra development	involved_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:22926577	UniProt	PMID:22926577
Uchl1	Chinchilla	ubiquitin-dependent protein catabolic process		ISO	Uchl1 (Rattus norvegicus)	9068941		RGD	PMID:11850463 and REF_RGD_ID:70392

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	axon	located_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:11466438 more ...	MGI	PMID:11466438 more ...
Uchl1	Chinchilla	cytoplasm	located_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:19477270	BHF-UCL	PMID:19477270
Uchl1	Chinchilla	cytoplasm	located_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:12913066	UniProt	PMID:12913066
Uchl1	Chinchilla	cytosol	located_in	ISO	UCHL1 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Uchl1	Chinchilla	cytosol	located_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:12913066	MGI	PMID:12913066
Uchl1	Chinchilla	neuron projection terminus	located_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:24760869	MGI	PMID:24760869
Uchl1	Chinchilla	neuronal cell body	located_in	ISO	Uchl1 (Mus musculus)	9068941	PMID:11549719 and PMID:23284756	MGI	PMID:11549719 and PMID:23284756
Uchl1	Chinchilla	nucleoplasm	located_in	ISO	UCHL1 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Uchl1	Chinchilla	plasma membrane	located_in	ISO	UCHL1 (Homo sapiens)	9068941	PMID:19477270	BHF-UCL	PMID:19477270

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Uchl1	Chinchilla	alpha-2A adrenergic receptor binding	enables	ISO	UniProtKB:P08913	9068941	PMID:19477270	BHF-UCL	PMID:19477270
Uchl1	Chinchilla	cysteine-type deubiquitinase activity	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:34244144	FlyBase	PMID:34244144
Uchl1	Chinchilla	cysteine-type deubiquitinase activity	enables	ISO	Uchl1 (Mus musculus)	9068941	PMID:12913066	MGI	PMID:12913066
Uchl1	Chinchilla	cysteine-type deubiquitinase activity	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:9521656	UniProt	PMID:9521656
Uchl1	Chinchilla	cysteine-type endopeptidase activity	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:8639624	UniProt	PMID:8639624
Uchl1	Chinchilla	omega peptidase activity	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:9521656	UniProt	PMID:9521656
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9NYB0	9068941	PMID:21044950	IntAct	PMID:21044950
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:P11802 and UniProtKB:Q00535	9068941	PMID:23543736	IntAct	PMID:23543736
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:P83916 and UniProtKB:Q15843	9068941	PMID:16169070	IntAct	PMID:16169070
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:A4FUJ8 more ...	9068941	PMID:32814053	IntAct	PMID:32814053
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9UK80	9068941	PMID:19615732	IntAct	PMID:19615732
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:P05067	9068941	PMID:16049941	IntAct	PMID:16049941
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:P00533	9068941	PMID:20029029 and PMID:31980649	IntAct	PMID:20029029 and PMID:31980649
Uchl1	Chinchilla	protein binding	enables	ISO	UniProtKB:Q92905	9068941	PMID:12082530	IntAct	PMID:12082530
Uchl1	Chinchilla	ribosome binding	enables	ISO	Uchl1 (Mus musculus)	9068941	PMID:23064229	MGI	PMID:23064229
Uchl1	Chinchilla	signaling receptor inhibitor activity	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:19477270	BHF-UCL	PMID:19477270
Uchl1	Chinchilla	ubiquitin binding	enables	ISO	UCHL1 (Homo sapiens)	9068941	PMID:9521656	UniProt	PMID:9521656
Uchl1	Chinchilla	ubiquitin binding	enables	ISO	Uchl1 (Mus musculus)	9068941	PMID:12913066	MGI	PMID:12913066
Uchl1	Chinchilla	ubiquitin protein ligase binding	enables	ISO	UniProtKB:O60260	9068941	PMID:19725078	ParkinsonsUK-UCL	PMID:19725078

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

PMID:22301074	PMID:30032202

Uchl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	6,367,460 - 6,380,462 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955443	6,367,519 - 6,379,638 (-)	NCBI	ChiLan1.0	ChiLan1.0

UCHL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	41,256,928 - 41,268,455 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	41,256,413 - 41,268,455 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	41,258,945 - 41,270,472 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	40,953,686 - 40,965,203 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	41,099,856 - 41,111,373	NCBI
Celera	4	41,702,199 - 41,713,746 (+)	NCBI		Celera
Cytogenetic Map	4	p13	NCBI
HuRef	4	40,580,844 - 40,592,391 (+)	NCBI		HuRef
CHM1_1	4	41,259,044 - 41,270,591 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	41,230,716 - 41,242,242 (+)	NCBI		T2T-CHM13v2.0

Uchl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	66,833,464 - 66,844,577 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	66,833,434 - 66,844,577 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	66,676,121 - 66,687,234 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	66,676,091 - 66,687,234 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	67,067,360 - 67,078,473 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	66,955,425 - 66,966,369 (+)	NCBI		MGSCv36	mm8
Celera	5	63,976,841 - 63,987,914 (+)	NCBI		Celera
Cytogenetic Map	5	C3.1	NCBI
cM Map	5	35.95	NCBI

Uchl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	41,838,859 - 41,849,743 (-)	NCBI		GRCr8
mRatBN7.2	14	41,485,031 - 41,495,590 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	41,485,031 - 41,495,590 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	41,831,048 - 41,841,616 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	43,131,128 - 43,141,696 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	41,611,942 - 41,622,510 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	43,133,224 - 43,143,942 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	43,133,218 - 43,143,973 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	42,928,247 - 42,938,981 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	44,114,392 - 44,124,947 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	44,116,782 - 44,127,338 (-)	NCBI
Celera	14	40,639,549 - 40,650,302 (-)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

UCHL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	41,440,064 - 41,451,601 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	41,633,489 - 41,645,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	35,580,755 - 35,592,314 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	41,432,367 - 41,440,129 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	41,428,759 - 41,440,129 (+)	Ensembl	panpan1.1		panPan2

UCHL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	71,396,694 - 71,430,395 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	71,370,822 - 71,411,350 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	73,946,978 - 73,961,370 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	72,157,557 - 72,171,966 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	3	71,427,585 - 71,441,983 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	71,589,640 - 71,604,050 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	71,972,745 - 71,987,146 (-)	NCBI		UU_Cfam_GSD_1.0

Uchl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	37,734,649 - 37,746,530 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	8,551,603 - 8,563,651 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936482	8,551,749 - 8,563,586 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UCHL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	32,353,246 - 32,367,332 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	32,353,766 - 32,367,288 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	33,970,620 - 33,982,399 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UCHL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	9,074,961 - 9,086,606 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	9,074,923 - 9,086,517 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	55,406,774 - 55,418,174 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Uchl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	25,784,257 - 25,797,549 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	25,786,028 - 25,797,641 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005391935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_013518123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01038251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AGCD01038252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBCQ01038244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000001951 ⟹ ENSCLAP00000001908

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955443	6,367,460 - 6,380,462 (-)	Ensembl

RefSeq Acc Id:

XM_005391935 ⟹ XP_005391992

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955443	6,367,519 - 6,379,637 (-)	NCBI

Sequence:

show sequence

CAGTGCATCAGGCCGGCGCTTTAAAGCGGCCGCCTGGGCGGCTCCGCTCGCTGTTTTTCTTCCCTGGGCTGGGTCTTGCTCTACGGTCCGCGAAGATGCAGCTCAAGCCGATGGAGATCAACCCCGAG
ATGCTGAACAAAGTGCTGGCCCGGCTGGGGGTTGCCGGCCACTGGCGCTTCGCCGACGTGCTGGGGCTGGAGGACGACGCTCTGGGCGCGGTGCCAGCGCCTGCCTGCGCGCTGCTGCTGCTCTTTCC
CCTCACCGCCCAGCATGAGAACTTCAGGAAAAAACAGATTGAAGAACTGAAAGGACAAGCAGTGAGTCCCAAAGTGTATTTCATGAAGCAGACCATCGGGAACTCCTGTGGTACCATCGGACTGATCC
ATGCAGTGGCCAATAACCGAGACAAACTGGAATTTGAGGATGGATCGGTCCTGAAACAATTTCTTTCTGAAACGGAGAAGATGTCCCCTGAAGACAGAGCAAAGTGCTTTGAGAAGAATGAGGCCATC
CAGGCAGCCCACGATGCTGTGGCCCAGGAAGGCCAGTGTCGGGTAGATGACAAAGTGAATTTTCATTTTATTCTATTTAACAACGTGGACGGCCATCTCTATGAACTGGATGGGCGAATGCCTTTTCC
AGTGAACCATGGCACCAGTTCGGAGGACGCCTTGCTGCAGGACGCCGCCAAGGTCTGCAGAGAGTTCACCGAGCGCGAGCAAGGAGAGGTCCGCTTCTCTGCTGTGGCCCTTTGCAAGGCAGCCTAGG
TCCCCAGGGAGGGCCTGGCCGTTCTCCCCTCTTTCCTTCAGTGTGAAAGCACACACCTGCCCAAGCAGTCCGCACCGCTTCCGTGCGTGTAAACACAGCTGTCTCCTTCAGTTCTGCAGACACACGCT
TCCCTCCACCACCCCCAAGCACTGGCAGAGCTCAGCTGTTGCAAGCCGAGCTGGTGAGAGCTTCAGTCCAGAAGCCTTTCCCCCACCGTGTGTCTGGTACCTCAGTATCTAACGCTTTCATGCTCCTT
CAGTTTGTGTGTGTAAGTTAAGCCCTTGGATGTGGTTTCATTGTCTTTAAAAGAAATAAACCTTTTCTGCTGATAAACGATAA

hide sequence

RefSeq Acc Id:

XM_013518123 ⟹ XP_013373577

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955443	6,367,519 - 6,379,638 (-)	NCBI

Sequence:

show sequence

ACAGTGCATCAGGCCGGCGCTTTAAAGCGGCCGCCTGGGCGGCTCCGCTCGCTGTTTTTCTTCCCTGGGCTGGGTCTTGCTCTACGGTCCGCGAAGATGCAGCTCAAGCCGATGGAGATCAACCCCGA
GATGCTGAACAAAGTGCTGGCCCGGCTGGGGGTTGCCGGCCACTGGCGCTTCGCCGACGTGCTGGGGCTGGAGGACGACGCTCTGGGCGCGGTGCCAGCGCCTGCCTGCGCGCTGCTGCTGCTCTTTC
CCCTCACCGCCCAGCATGAGAACTTCAGGAAAAAACAGATTGAAGAACTGAAAGGACAAGCAGTGAGTCCCAAAGTGTATTTCATGAAGCAGACCATCGGGAACTCCTGTGGTACCATCGGACTGATC
CATGCAGTGGCCAATAACCGAGACAAACTGGAATTTGAGGATGGATCGGTCCTGAAACAATTTCTTTCTGAAACGGAGAAGATGTCCCCTGAAGACAGAGCAAAGTGCTTTGAGAAGAATGAGGCCAT
CCAGGCAGCCCACGATGCTGTGGCCCAGGAAGGCCAGTGTCGGGTAAATGCACACACAAGTCCCGGCCGGGCAGCTCAGGTAGATGACAAAGTGAATTTTCATTTTATTCTATTTAACAACGTGGACG
GCCATCTCTATGAACTGGATGGGCGAATGCCTTTTCCAGTGAACCATGGCACCAGTTCGGAGGACGCCTTGCTGCAGGACGCCGCCAAGGTCTGCAGAGAGTTCACCGAGCGCGAGCAAGGAGAGGTC
CGCTTCTCTGCTGTGGCCCTTTGCAAGGCAGCCTAGGTCCCCAGGGAGGGCCTGGCCGTTCTCCCCTCTTTCCTTCAGTGTGAAAGCACACACCTGCCCAAGCAGTCCGCACCGCTTCCGTGCGTGTA
AACACAGCTGTCTCCTTCAGTTCTGCAGACACACGCTTCCCTCCACCACCCCCAAGCACTGGCAGAGCTCAGCTGTTGCAAGCCGAGCTGGTGAGAGCTTCAGTCCAGAAGCCTTTCCCCCACCGTGT
GTCTGGTACCTCAGTATCTAACGCTTTCATGCTCCTTCAGTTTGTGTGTGTAAGTTAAGCCCTTGGATGTGGTTTCATTGTCTTTAAAAGAAATAAACCTTTTCTGCTGATAAACGATAA

hide sequence


Protein RefSeqs	XP_005391992	(Get FASTA)	NCBI Sequence Viewer
	XP_013373577	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000001908
	ENSCLAP00000001908.1

RefSeq Acc Id:	XP_005391992 ⟸ XM_005391935
- Peptide Label:	isoform X2
- UniProtKB:	A0A8C2UQZ9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQLKPMEINPEMLNKVLARLGVAGHWRFADVLGLEDDALGAVPAPACALLLLFPLTAQHENFRKKQIEELKGQAVSPKVYFMKQTIGNSCGTIGLIHAVANNRDKLEFEDGSVLKQFLSETEKMSPED RAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGTSSEDALLQDAAKVCREFTEREQGEVRFSAVALCKAA hide sequence

RefSeq Acc Id:

XP_013373577 ⟸ XM_013518123

- Peptide Label:

isoform X1

- Sequence:

show sequence

MQLKPMEINPEMLNKVLARLGVAGHWRFADVLGLEDDALGAVPAPACALLLLFPLTAQHENFRKKQIEELKGQAVSPKVYFMKQTIGNSCGTIGLIHAVANNRDKLEFEDGSVLKQFLSETEKMSPED
RAKCFEKNEAIQAAHDAVAQEGQCRVNAHTSPGRAAQVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGTSSEDALLQDAAKVCREFTEREQGEVRFSAVALCKAA

hide sequence

Ensembl Acc Id:

ENSCLAP00000001908 ⟸ ENSCLAT00000001951

Protein Domains

Ubiquitin carboxyl-terminal hydrolase family

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000001405	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000001951	ENTREZGENE
	ENSCLAT00000001951.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.532.10	UniProtKB/TrEMBL
InterPro	Papain-like_cys_pep_sf	UniProtKB/TrEMBL
	Peptidase_C12_UCH	UniProtKB/TrEMBL
	Peptidase_C12_UCH_sf	UniProtKB/TrEMBL
NCBI Gene	Uchl1	ENTREZGENE
PANTHER	PTHR10589	UniProtKB/TrEMBL
	PTHR10589:SF19	UniProtKB/TrEMBL
Pfam	Peptidase_C12	UniProtKB/TrEMBL
PRINTS	UBCTHYDRLASE	UniProtKB/TrEMBL
PROSITE	UCH_1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A0A8C2UQZ9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-16	Uchl1	ubiquitin C-terminal hydrolase L1		ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM