Symbol:
Scn1b
Name:
sodium voltage-gated channel beta subunit 1
RGD ID:
3631
Description:
Enables sodium channel regulator activity. Involved in regulation of voltage-gated sodium channel activity and response to pyrethroid. Located in node of Ranvier and plasma membrane. Part of voltage-gated sodium channel complex. Biomarker of type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in Brugada syndrome 5; developmental and epileptic encephalopathy 52; familial atrial fibrillation; and generalized epilepsy with febrile seizures plus 1. Orthologous to human SCN1B (sodium voltage-gated channel beta subunit 1); PARTICIPATES IN alfentanil pharmacodynamics pathway; bupivacaine pharmacodynamics pathway; buprenorphine pharmacodynamics pathway; INTERACTS WITH (+)-trans-(S)-allethrin; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
sodium channel regulatory subunit beta-1; sodium channel subunit beta-1; sodium channel voltage-gated type 1 beta polypeptide; sodium channel voltage-gated type I beta polypeptide; sodium channel, voltage-gated, type 1, beta polypeptide; sodium channel, voltage-gated, type I, beta; sodium channel, voltage-gated, type I, beta polypeptide; sodium channel, voltage-gated, type I, beta subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SCN1B (sodium voltage-gated channel beta subunit 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Scn1b (sodium channel, voltage-gated, type I, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Scn1b (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SCN1B (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SCN1B (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scn1b (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SCN1B (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SCN1B (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Scn1b (sodium voltage-gated channel beta subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SCN3B (sodium voltage-gated channel beta subunit 3) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Scn1b (sodium channel, voltage-gated, type I, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SCN1B (sodium voltage-gated channel beta subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scn1ba (sodium channel, voltage-gated, type I, beta a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-225p5.8
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
scn1bb (sodium channel, voltage-gated, type I, beta b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 95,481,298 - 95,491,211 (-) NCBI GRCr8 mRatBN7.2 1 86,353,917 - 86,363,820 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 86,353,917 - 86,363,739 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 91,774,394 - 91,784,282 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 100,240,553 - 100,250,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 93,532,687 - 93,542,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 89,550,738 - 89,560,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 89,550,738 - 89,560,719 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 90,705,285 - 90,715,016 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 86,162,254 - 86,172,128 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 86,240,364 - 86,250,239 (-) NCBI Celera 1 80,722,797 - 80,732,619 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scn1b Rat (+)-trans-(S)-allethrin multiple interactions EXP 6480464 bioallethrin affects the reaction [[SCN2B protein co-treated with SCN1B protein co-treated with SCN8A protein mutant form] results in increased transport of Sodium] CTD PMID:22465659 Scn1b Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SCN1B mRNA CTD PMID:32145629 Scn1b Rat 17beta-estradiol increases expression ISO Scn1b (Mus musculus) 6480464 Estradiol results in increased expression of SCN1B mRNA CTD PMID:39298647 Scn1b Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Scn1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCN1B mRNA CTD PMID:21215274 Scn1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SCN1B mRNA CTD PMID:32109520 more ... Scn1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Scn1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SCN1B mRNA CTD PMID:24680724 Scn1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SCN1B mRNA CTD PMID:22298810 Scn1b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Scn1b Rat 3,4-methylenedioxymethamphetamine increases expression ISO Scn1b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SCN1B mRNA CTD PMID:20188158 Scn1b Rat 4,4'-sulfonyldiphenol increases expression ISO Scn1b (Mus musculus) 6480464 bisphenol S results in increased expression of SCN1B mRNA CTD PMID:39298647 Scn1b Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SCN1B mRNA CTD PMID:36041667 Scn1b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SCN1B mRNA CTD PMID:24780913 Scn1b Rat acetylsalicylic acid increases expression ISO SCN1B (Homo sapiens) 6480464 Aspirin results in increased expression of SCN1B mRNA CTD PMID:11906190 Scn1b Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SCN1B mRNA CTD PMID:28959563 Scn1b Rat acrylamide increases expression ISO SCN1B (Homo sapiens) 6480464 Acrylamide results in increased expression of SCN1B mRNA CTD PMID:32763439 Scn1b Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SCN1B mRNA CTD PMID:35163327 Scn1b Rat amiodarone decreases expression ISO Scn1b (Mus musculus) 6480464 Amiodarone results in decreased expression of SCN1B mRNA CTD PMID:15520326 Scn1b Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SCN1B mRNA CTD PMID:38685447 Scn1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SCN1B mRNA CTD PMID:16483693 Scn1b Rat benzo[a]pyrene decreases expression ISO Scn1b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SCN1B mRNA CTD PMID:21715664 Scn1b Rat benzo[a]pyrene affects methylation ISO SCN1B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SCN1B intron and Benzo(a)pyrene affects the methylation of SCN1B promoter CTD PMID:27901495 and PMID:30157460 Scn1b Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of SCN1B mRNA CTD PMID:20920545 Scn1b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SCN1B mRNA CTD PMID:25181051 and PMID:32145629 Scn1b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SCN1B mRNA CTD PMID:36041667 Scn1b Rat bisphenol A decreases expression ISO Scn1b (Mus musculus) 6480464 bisphenol A results in decreased expression of SCN1B mRNA CTD PMID:35598803 Scn1b Rat bisphenol A increases expression ISO Scn1b (Mus musculus) 6480464 bisphenol A results in increased expression of SCN1B mRNA CTD PMID:32156529 and PMID:35479511 Scn1b Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SCN1B mRNA CTD PMID:36041667 Scn1b Rat calcitriol multiple interactions ISO SCN1B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SCN1B mRNA CTD PMID:21592394 Scn1b Rat calcitriol increases expression ISO SCN1B (Homo sapiens) 6480464 Calcitriol results in increased expression of SCN1B mRNA CTD PMID:21592394 Scn1b Rat carmustine increases expression EXP 6480464 Carmustine results in increased expression of SCN1B mRNA CTD PMID:16005536 Scn1b Rat casticin increases expression ISO Scn1b (Mus musculus) 6480464 casticin results in increased expression of SCN1B mRNA CTD PMID:28444820 Scn1b Rat CGP 52608 multiple interactions ISO SCN1B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SCN1B gene] CTD PMID:28238834 Scn1b Rat chlordecone decreases expression ISO Scn1b (Mus musculus) 6480464 Chlordecone results in decreased expression of SCN1B mRNA CTD PMID:29980752 Scn1b Rat cobalt dichloride increases expression ISO SCN1B (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SCN1B mRNA CTD PMID:19376846 Scn1b Rat cobalt dichloride decreases expression ISO SCN1B (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SCN1B mRNA CTD PMID:19320972 Scn1b Rat corn oil affects expression EXP 6480464 Corn Oil affects the expression of SCN1B mRNA CTD PMID:16360708 Scn1b Rat crocidolite asbestos decreases expression ISO Scn1b (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SCN1B mRNA CTD PMID:29279043 Scn1b Rat cyclosporin A decreases expression ISO SCN1B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SCN1B mRNA CTD PMID:20106945 Scn1b Rat cyfluthrin multiple interactions EXP 6480464 cyfluthrin affects the reaction [[SCN2A protein binds to SCN1B protein] which results in increased transport of Sodium] CTD PMID:18538810 Scn1b Rat cypermethrin multiple interactions EXP 6480464 cypermethrin affects the reaction [[SCN2A protein binds to SCN1B protein] which results in increased transport of Sodium] and SCN1B protein promotes the reaction [cypermethrin binds to SCN2A protein] CTD PMID:18538810 and PMID:9863771 Scn1b Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of SCN1B mRNA CTD PMID:23914054 Scn1b Rat dibenz[a,h]anthracene increases expression ISO Scn1b (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Scn1b Rat doxorubicin decreases expression ISO SCN1B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SCN1B mRNA CTD PMID:29803840 Scn1b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SCN1B mRNA CTD PMID:29391264 Scn1b Rat ethanol affects splicing ISO Scn1b (Mus musculus) 6480464 Ethanol affects the splicing of SCN1B mRNA CTD PMID:30319688 Scn1b Rat fenpropathrin multiple interactions EXP 6480464 fenpropathrin affects the reaction [[SCN2A protein binds to SCN1B protein] which results in increased transport of Sodium] CTD PMID:18538810 Scn1b Rat fenvalerate multiple interactions EXP 6480464 fenvalerate affects the reaction [[SCN2A protein binds to SCN1B protein] which results in increased transport of Sodium] CTD PMID:18538810 Scn1b Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SCN1B mRNA CTD PMID:24136188 Scn1b Rat furan decreases expression EXP 6480464 furan results in decreased expression of SCN1B mRNA CTD PMID:25539665 Scn1b Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO SCN1B (Homo sapiens) 6480464 Arbutin results in increased expression of SCN1B mRNA CTD PMID:17103032 Scn1b Rat lipopolysaccharide increases expression ISO SCN1B (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of SCN1B mRNA CTD PMID:35811015 Scn1b Rat lipopolysaccharide multiple interactions ISO SCN1B (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SCN1B mRNA] CTD PMID:35811015 Scn1b Rat methotrexate increases expression EXP 6480464 Methotrexate results in increased expression of SCN1B mRNA CTD PMID:16005536 Scn1b Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SCN1B mRNA CTD PMID:28801915 Scn1b Rat paracetamol affects expression ISO Scn1b (Mus musculus) 6480464 Acetaminophen affects the expression of SCN1B mRNA CTD PMID:17562736 Scn1b Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SCN1B mRNA CTD PMID:33387578 Scn1b Rat paracetamol decreases expression ISO SCN1B (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SCN1B mRNA CTD PMID:22230336 Scn1b Rat perfluorohexanesulfonic acid increases expression ISO Scn1b (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SCN1B mRNA CTD PMID:37995155 Scn1b Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SCN1B mRNA CTD PMID:35163327 Scn1b Rat phenytoin affects binding ISO SCN1B (Homo sapiens) 6480464 Phenytoin binds to [SCN1B protein binds to SCN3A protein] CTD PMID:15922564 Scn1b Rat phenytoin decreases response to substance ISO SCN1B (Homo sapiens) 6480464 SCN1B protein mutant form results in decreased susceptibility to Phenytoin CTD PMID:15922564 Scn1b Rat phenytoin multiple interactions ISO SCN1B (Homo sapiens) 6480464 Phenytoin results in decreased activity of [SCN1B protein binds to SCN3A protein] CTD PMID:15922564 Scn1b Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SCN1B mRNA CTD PMID:19162173 Scn1b Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of SCN1B mRNA CTD PMID:20726854 Scn1b Rat prostaglandin F2alpha increases expression EXP 6480464 Dinoprost results in increased expression of SCN1B mRNA CTD PMID:11517196 Scn1b Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of SCN1B mRNA CTD PMID:28374803 Scn1b Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO SCN1B (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of SCN1B mRNA CTD PMID:33725128 Scn1b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SCN1B (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SCN1B mRNA] CTD PMID:35811015 Scn1b Rat silicon dioxide decreases expression ISO SCN1B (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SCN1B mRNA CTD PMID:25895662 Scn1b Rat sodium arsenite affects methylation ISO SCN1B (Homo sapiens) 6480464 sodium arsenite affects the methylation of SCN1B gene CTD PMID:28589171 Scn1b Rat sodium atom multiple interactions EXP 6480464 2 more ... CTD PMID:18538810 more ... Scn1b Rat sodium atom multiple interactions ISO SCN1B (Homo sapiens) 6480464 2 more ... CTD PMID:19026681 Scn1b Rat sodium fluoride decreases expression ISO Scn1b (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of SCN1B mRNA CTD PMID:27862939 Scn1b Rat testosterone multiple interactions ISO SCN1B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SCN1B mRNA CTD PMID:21592394 Scn1b Rat testosterone increases expression ISO SCN1B (Homo sapiens) 6480464 Testosterone results in increased expression of SCN1B mRNA CTD PMID:21592394 Scn1b Rat tetrodotoxin multiple interactions EXP 6480464 Tetrodotoxin results in decreased activity of [SCN2A protein binds to SCN1B protein] and Tetrodotoxin results in decreased activity of [SCN8A protein binds to SCN1B protein binds to SCN2B protein] CTD PMID:21983428 and PMID:9236205 Scn1b Rat tioguanine increases expression EXP 6480464 Thioguanine results in increased expression of SCN1B mRNA CTD PMID:16005536 Scn1b Rat titanium dioxide decreases methylation ISO Scn1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SCN1B gene CTD PMID:35295148 Scn1b Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SCN1B mRNA CTD PMID:33387578 Scn1b Rat tris(2-butoxyethyl) phosphate affects expression ISO SCN1B (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of SCN1B mRNA CTD PMID:29024780 Scn1b Rat urethane decreases expression ISO SCN1B (Homo sapiens) 6480464 Urethane results in decreased expression of SCN1B mRNA CTD PMID:28818685 Scn1b Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of SCN1B mRNA CTD PMID:24136188 Scn1b Rat valproic acid affects expression ISO Scn1b (Mus musculus) 6480464 Valproic Acid affects the expression of SCN1B mRNA CTD PMID:17292431 Scn1b Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SCN1B mRNA CTD PMID:34779009
Imported Annotations - SMPDB
(+)-trans-(S)-allethrin (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrylamide (EXP,ISO) alpha-Zearalanol (EXP) amiodarone (ISO) amitrole (EXP) ammonium chloride (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) calcitriol (ISO) carmustine (EXP) casticin (ISO) CGP 52608 (ISO) chlordecone (ISO) cobalt dichloride (ISO) corn oil (EXP) crocidolite asbestos (ISO) cyclosporin A (ISO) cyfluthrin (EXP) cypermethrin (EXP) decabromodiphenyl ether (EXP) dibenz[a,h]anthracene (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) fenpropathrin (EXP) fenvalerate (EXP) flutamide (EXP) furan (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) lipopolysaccharide (ISO) methotrexate (EXP) N-methyl-4-phenylpyridinium (EXP) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenytoin (ISO) pirinixic acid (EXP) progesterone (EXP) prostaglandin F2alpha (EXP) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium atom (EXP,ISO) sodium fluoride (ISO) testosterone (ISO) tetrodotoxin (EXP) tioguanine (EXP) titanium dioxide (ISO) trichloroethene (EXP) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (EXP,ISO)
Biological Process
axon guidance (IEA,ISO) cardiac conduction (IEA,ISO) cardiac muscle cell action potential involved in contraction (IBA,IEA,ISO) cardiac muscle contraction (IEA,ISO) corticospinal neuron axon guidance (IEA,ISO) locomotion (IEA,ISO) membrane depolarization (IEA,ISO) membrane depolarization during action potential (IEA,ISO) membrane depolarization during cardiac muscle cell action potential (IBA,IEA,ISO) membrane depolarization during Purkinje myocyte cell action potential (IEA,ISO) monoatomic ion transport (IEA) neuron projection development (IEA,ISO) neuronal action potential propagation (IEA,ISO) positive regulation of neuron projection development (IEA,ISO) positive regulation of sodium ion transport (IEA,ISO) positive regulation of voltage-gated sodium channel activity (ISO,ISS) regulation of atrial cardiac muscle cell membrane depolarization (IEA,ISO) regulation of heart rate by cardiac conduction (IBA,IEA,ISO) regulation of sodium ion transmembrane transport (ISO) regulation of sodium ion transport (IDA,IEA,ISO) regulation of ventricular cardiac muscle cell membrane repolarization (IEA,ISO) regulation of voltage-gated sodium channel activity (IDA) response to pyrethroid (IDA) sodium ion transmembrane transport (IBA,IEA,ISO) sodium ion transport (IEA)
Cellular Component
axon (IEA) cell projection (IEA) intercalated disc (IEA,ISO) membrane (IEA) node of Ranvier (IDA,IEA,ISO) perikaryon (IEA) plasma membrane (IDA,IEA,ISO,TAS) sodium channel complex (IEA,ISO) T-tubule (IEA,ISO) voltage-gated sodium channel complex (IBA,IDA,IEA,ISO)
1.
Post-transcriptional gene silencing of KChIP2 and Navbeta1 in neonatal rat cardiac myocytes reveals a functional association between Na and Ito currents.
Deschenes I, etal., J Mol Cell Cardiol. 2008 Sep;45(3):336-46. Epub 2008 May 12.
2.
Characterization of sodium channel alpha- and beta-subunits in rat and mouse cardiac myocytes.
Dhar Malhotra J, etal., Circulation. 2001 Mar 6;103(9):1303-10.
3.
Genes encoding the beta 1 subunit of voltage-dependent Na+ channel in rat, mouse and human contain conserved introns.
Dib-Hajj SD and Waxman SG, FEBS Lett 1995 Dec 27;377(3):485-8.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Primary structure and functional expression of the beta 1 subunit of the rat brain sodium channel.
Isom LL, etal., Science 1992 May 8;256(5058):839-42.
6.
Cloning, localization, and functional expression of sodium channel beta1A subunits.
Kazen-Gillespie KA, etal., J Biol Chem 2000 Jan 14;275(2):1079-88.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
The beta 1 subunit mRNA of the rat brain Na+ channel is expressed in glial cells.
Oh Y and Waxman SG, Proc Natl Acad Sci U S A 1994 Oct 11;91(21):9985-9.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
Sodium channel beta1 and beta3 subunits associate with neurofascin through their extracellular immunoglobulin-like domain.
Ratcliffe CF, etal., J Cell Biol. 2001 Jul 23;154(2):427-34.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Shortening and intracellular Ca2+ in ventricular myocytes and expression of genes encoding cardiac muscle proteins in early onset type 2 diabetic Goto-Kakizaki rats.
Salem KA, etal., Exp Physiol. 2012 May 11.
17.
Direct interaction between synaptotagmin and the intracellular loop I-II of neuronal voltage-sensitive sodium channels.
Sampo B, etal., Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3666-71.
18.
Characterization of specific allosteric effects of the Na+ channel β1 subunit on the Nav1.4 isoform.
Sánchez-Solano A, etal., Eur Biophys J. 2017 Jul;46(5):485-494. doi: 10.1007/s00249-016-1193-3. Epub 2016 Dec 23.
19.
Human and rat Nav1.3 voltage-gated sodium channels differ in inactivation properties and sensitivity to the pyrethroid insecticide tefluthrin.
Tan J and Soderlund DM, Neurotoxicology. 2009 Jan;30(1):81-9. Epub 2008 Nov 5.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
Modulatory effect of auxiliary beta1 subunit on Nav1.3 voltage-gated sodium channel expressed in Xenopus oocyte.
Wang YW, etal., Chin Med J (Engl). 2007 Apr 20;120(8):721-3.
Scn1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 95,481,298 - 95,491,211 (-) NCBI GRCr8 mRatBN7.2 1 86,353,917 - 86,363,820 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 86,353,917 - 86,363,739 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 91,774,394 - 91,784,282 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 100,240,553 - 100,250,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 93,532,687 - 93,542,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 89,550,738 - 89,560,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 89,550,738 - 89,560,719 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 90,705,285 - 90,715,016 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 86,162,254 - 86,172,128 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 86,240,364 - 86,250,239 (-) NCBI Celera 1 80,722,797 - 80,732,619 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
SCN1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 35,030,470 - 35,040,449 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 35,030,470 - 35,040,449 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 35,521,374 - 35,531,353 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 40,213,374 - 40,223,193 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 40,213,373 - 40,217,014 NCBI Celera 19 32,237,030 - 32,244,951 (+) NCBI Celera Cytogenetic Map 19 q13.11 NCBI HuRef 19 32,031,550 - 32,039,386 (+) NCBI HuRef CHM1_1 19 35,523,533 - 35,533,294 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 37,575,088 - 37,585,067 (+) NCBI T2T-CHM13v2.0
Scn1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 30,815,949 - 30,826,436 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 30,815,949 - 30,826,428 (-) Ensembl GRCm39 Ensembl GRCm38 7 31,116,524 - 31,127,023 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 31,116,524 - 31,127,003 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 31,901,543 - 31,911,964 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 30,825,284 - 30,835,705 (-) NCBI MGSCv36 mm8 Celera 7 25,685,753 - 25,696,176 (-) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 19.3 NCBI
Scn1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 4,375,157 - 4,383,502 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 4,375,517 - 4,383,383 (+) NCBI ChiLan1.0 ChiLan1.0
SCN1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 41,041,639 - 41,051,647 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 43,024,053 - 43,034,048 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 31,974,499 - 31,984,488 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 40,714,949 - 40,724,052 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 40,711,281 - 40,724,052 (+) Ensembl panpan1.1 panPan2
SCN1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 117,504,428 - 117,510,666 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 117,503,828 - 117,511,727 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 116,904,982 - 116,912,817 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 118,101,274 - 118,110,870 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 118,101,277 - 118,109,849 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 117,664,454 - 117,672,298 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 117,289,863 - 117,297,724 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 118,346,453 - 118,354,295 (-) NCBI UU_Cfam_GSD_1.0
Scn1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 10,450,449 - 10,457,966 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 1,186,711 - 1,195,388 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 1,187,916 - 1,195,423 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCN1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 44,597,482 - 44,607,481 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 44,597,461 - 44,607,488 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 40,022,785 - 40,032,360 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCN1B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 29,962,993 - 29,972,845 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 29,962,843 - 29,973,325 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 7,732,359 - 7,742,427 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scn1b
.
Predicted Target Of
Count of predictions: 102 Count of miRNA genes: 74 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000028653 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
U85786
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 86,353,982 - 86,354,124 (+) MAPPER mRatBN7.2 Rnor_6.0 1 89,550,804 - 89,550,945 NCBI Rnor6.0 Rnor_5.0 1 90,705,351 - 90,705,492 UniSTS Rnor5.0 RGSC_v3.4 1 86,162,320 - 86,162,461 UniSTS RGSC3.4 Celera 1 80,722,863 - 80,723,004 UniSTS Cytogenetic Map 1 q21 UniSTS
PMC15797P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 86,354,090 - 86,354,306 (+) MAPPER mRatBN7.2 Rnor_6.0 1 89,550,912 - 89,551,127 NCBI Rnor6.0 Rnor_5.0 1 90,705,459 - 90,705,674 UniSTS Rnor5.0 RGSC_v3.4 1 86,162,428 - 86,162,643 UniSTS RGSC3.4 Celera 1 80,722,971 - 80,723,186 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
101
91
90
59
25
59
6
216
95
81
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028653 ⟹ ENSRNOP00000028653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,353,917 - 86,363,739 (-) Ensembl Rnor_6.0 Ensembl 1 89,550,739 - 89,560,719 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079091 ⟹ ENSRNOP00000074323
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 89,550,739 - 89,560,469 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092133 ⟹ ENSRNOP00000070450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 86,353,917 - 86,362,259 (-) Ensembl Rnor_6.0 Ensembl 1 89,550,738 - 89,559,960 (-) Ensembl
RefSeq Acc Id:
NM_001271045 ⟹ NP_001257974
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,481,298 - 95,491,197 (-) NCBI mRatBN7.2 1 86,353,917 - 86,363,820 (-) NCBI Rnor_6.0 1 89,550,738 - 89,560,469 (-) NCBI Rnor_5.0 1 90,705,285 - 90,715,016 (-) NCBI Celera 1 80,722,797 - 80,732,533 (-) NCBI
Sequence:
CGGGGCTTGGCCCCCGGCGGTAACCGGAGCGGGGGGGCGCGCCCCCCCAGCAGCAGCTGCGGCGCCCGCGCCCGGGCCAGTCGCCGCCGGGGCCCATCTCCTGTCGCCGCGCTCTGCGCACCCACCGC
hide sequence
RefSeq Acc Id:
NM_001271046 ⟹ NP_001257975
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,481,298 - 95,490,520 (-) NCBI mRatBN7.2 1 86,353,917 - 86,363,143 (-) NCBI Rnor_6.0 1 89,550,738 - 89,559,960 (-) NCBI Rnor_5.0 1 90,705,285 - 90,715,016 (-) NCBI Celera 1 80,722,797 - 80,732,022 (-) NCBI
Sequence:
AGACATGGATACCGAGTGAGAACTCGGGCATGTCCCGGACGCGGAGTATCCTCAGCCTGGGGGGGCTGCGTGGAGGTGGATTCTGAGACCGAGGCAGTGTATGGGATGACCTTCAAAATCCTGTGTAT
hide sequence
RefSeq Acc Id:
NM_017288 ⟹ NP_058984
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,481,298 - 95,491,197 (-) NCBI mRatBN7.2 1 86,353,917 - 86,363,820 (-) NCBI Rnor_6.0 1 89,550,738 - 89,560,459 (-) NCBI Rnor_5.0 1 90,705,285 - 90,715,016 (-) NCBI RGSC_v3.4 1 86,162,254 - 86,172,128 (-) RGD Celera 1 80,722,797 - 80,732,619 (-) NCBI
Sequence:
CGCAGCCTGGATGCGCCCTGTGGCGCACGCACGCAGCATCCCGAGCCTCCCGCCGCGCGCGGGA
hide sequence
RefSeq Acc Id:
XM_063287840 ⟹ XP_063143910
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 95,487,222 - 95,491,211 (-) NCBI
RefSeq Acc Id:
NP_058984 ⟸ NM_017288
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q505J0 (UniProtKB/Swiss-Prot), Q00954 (UniProtKB/Swiss-Prot), A6JA73 (UniProtKB/TrEMBL), A0A0G2JXY6 (UniProtKB/TrEMBL)
- Sequence:
MGTLLALVVGAVLVSSAWGGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLF
hide sequence
RefSeq Acc Id:
NP_001257974 ⟸ NM_001271045
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q505J0 (UniProtKB/Swiss-Prot), Q00954 (UniProtKB/Swiss-Prot), A6JA73 (UniProtKB/TrEMBL), A0A0G2JXY6 (UniProtKB/TrEMBL)
- Sequence:
MGTLLALVVGAVLVSSAWGGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLF
hide sequence
RefSeq Acc Id:
NP_001257975 ⟸ NM_001271046
- Peptide Label:
isoform 2
- UniProtKB:
A0A0G2JXY6 (UniProtKB/TrEMBL)
- Sequence:
MTFKILCISCKRRSETTAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFDNYEHNTSVVKKIHLEVVDKANRDMASIVSEI
hide sequence
Ensembl Acc Id:
ENSRNOP00000074323 ⟸ ENSRNOT00000079091
Ensembl Acc Id:
ENSRNOP00000070450 ⟸ ENSRNOT00000092133
Ensembl Acc Id:
ENSRNOP00000028653 ⟸ ENSRNOT00000028653
RefSeq Acc Id:
XP_063143910 ⟸ XM_063287840
- Peptide Label:
isoform X1
- UniProtKB:
Q9QXU3 (UniProtKB/TrEMBL)
RGD ID: 13689945 Promoter ID: EPDNEW_R470 Type: single initiation site Name: Scn1b_2 Description: sodium voltage-gated channel beta subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R471 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 89,560,392 - 89,560,452 EPDNEW
RGD ID: 13689950 Promoter ID: EPDNEW_R471 Type: initiation region Name: Scn1b_1 Description: sodium voltage-gated channel beta subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R470 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 89,560,799 - 89,560,859 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Scn1b
sodium voltage-gated channel beta subunit 1
Scn1b
sodium channel, voltage-gated, type I, beta subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-11-11
Scn1b
sodium channel, voltage-gated, type I, beta subunit
Scn1b
sodium channel, voltage-gated, type I, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Scn1b
sodium channel, voltage-gated, type I, beta
sodium channel, voltage-gated, type I, beta polypeptide
Name updated
1299863 APPROVED
2003-04-09
Scn1b
sodium channel, voltage-gated, type I, beta polypeptide
sodium channel, voltage-gated, type 1, beta polypeptide
Symbol and Name status set to approved
629479 APPROVED
2002-06-10
Scn1b
sodium channel, voltage-gated, type 1, beta polypeptide
Name updated
70585 PROVISIONAL
