Psmb8 (proteasome 20S subunit beta 8)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Psmb8 (proteasome 20S subunit beta 8) Rattus norvegicus

Analyze

Symbol:

Psmb8

Name:

proteasome 20S subunit beta 8

RGD ID:

3426

Description:

Predicted to enable endopeptidase activity. Predicted to be involved in fat cell differentiation and regulation of endopeptidase activity. Predicted to act upstream of or within antigen processing and presentation. Predicted to be located in cytoplasm. Predicted to be part of proteasome core complex, beta-subunit complex and spermatoproteasome complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in JMP syndrome. Orthologous to human PSMB8 (proteasome 20S subunit beta 8); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

large multifunctional protease 7; Lmp7; LOC103690099; low molecular mass polypeptide 7; macropain subunit C13; MGC124945; multicatalytic endopeptidase complex subunit C13; proteasome (prosome macropain) subunit beta type 8 (low molecular mass polypeptide 7); proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7); proteasome (prosome, macropain) subunit, beta type, 8; proteasome component C13; proteasome subunit beta 8; proteasome subunit beta type-8; proteasome subunit beta type-8-like; proteasome subunit beta-5i; proteosome (prosome macropain) subunit beta type 8 (large multifunctional protease 7); proteosome (prosome, macropain) subunit, beta type 8; Ring10

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMB8 (proteasome 20S subunit beta 8)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Psmb8 (proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmb8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMB8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMB8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmb8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMB8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMB8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmb8 (proteasome 20S subunit beta 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSMB8 (proteasome 20S subunit beta 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psmb8 (proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmb8a (proteasome subunit beta 8A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRE2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta5R1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pbs-5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Candidate Gene For:

Pur27 Pur30

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	4,652,159 - 4,655,122 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,652,159 - 4,655,283 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	5,404,875 - 5,407,839 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,766,618 - 4,769,582 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	5,248,299 - 5,251,264 (-)	NCBI	Rnor_WKY
Rnor_6.0	20	3,990,809 - 3,993,772 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	3,990,613 - 3,993,769 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,070,355 - 6,073,317 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	20	7,275,040 - 7,276,378 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,786,260 - 4,789,223 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,786,490 - 4,789,389 (-)	NCBI
Celera	20	6,253,214 - 6,256,177 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chediak-Higashi syndrome (ISO)

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

JMP syndrome (ISO)

MHC class I deficiency (ISO)

type 1 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrobenzenesulfonic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-nitrofluorene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-dihydrocoumarin (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

C60 fullerene (EXP)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chloroprene (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

diethylstilbestrol (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

flavonoids (EXP)

folic acid (ISO)

fulvestrant (ISO)

Genipin (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

ionomycin (ISO)

isoprenaline (EXP)

ivermectin (ISO)

lactacystin (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenformin (EXP)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

picrotoxin (EXP)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

SB 431542 (ISO)

sibutramine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

Soman (EXP)

sulforaphane (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

theophylline (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

trimellitic anhydride (EXP)

valproic acid (EXP,ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation (ISO,NAS)

fat cell differentiation (ISO,ISS)

proteasomal protein catabolic process (IBA)

proteolysis involved in protein catabolic process (IEA)

regulation of endopeptidase activity (ISO)

Cellular Component

cytoplasm (IEA)

nucleus (IBA,IEA)

proteasome complex (ISO)

proteasome core complex (IBA,IEA,ISO,ISS,TAS)

proteasome core complex, beta-subunit complex (IBA,ISS)

spermatoproteasome complex (ISO,ISS)

Molecular Function

endopeptidase activity (IBA)

protein binding (ISO)

threonine-type endopeptidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	cDNA cloning of rat proteasome subunit RC1, a homologue of RING10 located in the human MHC class II region.	Aki M, etal., FEBS Lett 1992 Apr 13;301(1):65-8.
2.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15060004	PMID:15356141	PMID:16769238	PMID:16857966	PMID:17540904	PMID:19032866	PMID:20458337	PMID:20888554	PMID:21881205	PMID:23376485	PMID:23706739
PMID:24586191	PMID:26524591	PMID:32255680

Genomics

Comparative Map Data

Psmb8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	4,652,159 - 4,655,122 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,652,159 - 4,655,283 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	5,404,875 - 5,407,839 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,766,618 - 4,769,582 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	20	5,248,299 - 5,251,264 (-)	NCBI	Rnor_WKY
Rnor_6.0	20	3,990,809 - 3,993,772 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	3,990,613 - 3,993,769 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,070,355 - 6,073,317 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	20	7,275,040 - 7,276,378 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,786,260 - 4,789,223 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,786,490 - 4,789,389 (-)	NCBI
Celera	20	6,253,214 - 6,256,177 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

PSMB8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	32,840,717 - 32,844,679 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	32,840,717 - 32,844,679 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	32,808,494 - 32,812,456 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	32,916,472 - 32,920,690 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	32,916,472 - 32,919,792	NCBI
Celera	6	34,357,387 - 34,361,605 (-)	NCBI		Celera
Cytogenetic Map	6	p21.32	NCBI
HuRef	6	32,550,700 - 32,554,918 (-)	NCBI		HuRef
CHM1_1	6	32,809,321 - 32,813,539 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	32,662,092 - 32,666,054 (-)	NCBI		T2T-CHM13v2.0

Psmb8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	34,417,169 - 34,420,428 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	34,416,695 - 34,420,428 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	34,198,195 - 34,201,454 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	34,197,721 - 34,201,454 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	34,335,140 - 34,338,399 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	33,808,611 - 33,811,478 (+)	NCBI		MGSCv36	mm8
Celera	17	36,951,781 - 36,955,036 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	17.98	NCBI

Psmb8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	1,500,477 - 1,504,072 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	1,500,477 - 1,504,072 (-)	NCBI	ChiLan1.0	ChiLan1.0

PSMB8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	6	33,525,681 - 33,529,897 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	33,525,681 - 33,529,897 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	6	32,410,172 - 32,414,136 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PSMB8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	2,419,456 - 2,422,832 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	2,378,126 - 2,432,303 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	2,501,125 - 2,504,497 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	2,701,094 - 2,704,475 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	2,701,094 - 2,714,024 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	2,418,542 - 2,421,918 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	2,500,008 - 2,503,382 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	2,574,324 - 2,577,715 (-)	NCBI		UU_Cfam_GSD_1.0

Psmb8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	38,048,353 - 38,051,993 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	25,908,490 - 25,911,925 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936476	25,908,533 - 25,911,914 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMB8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	25,058,465 - 25,062,245 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	25,058,456 - 25,061,666 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	29,425,070 - 29,428,073 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMB8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	39,260,774 - 39,264,990 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	39,260,511 - 39,265,166 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	32,627,347 - 32,631,067 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmb8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	23,823,115 - 23,826,367 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	23,822,965 - 23,826,367 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Psmb8
108 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	70
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000000528
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
7175099	Tcs2	T cell selection QTL 2			T cell selection	expression	20	4502557	4693102	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	4606607	6691706	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat

Markers in Region

RH132773

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,652,206 - 4,653,401 (-)	MAPPER	mRatBN7.2
mRatBN7.2	20	4,652,206 - 4,653,401 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,214,027 - 5,215,221	NCBI	Rnor6.0
Rnor_6.0	20	3,992,530 - 3,993,724	NCBI	Rnor6.0
Rnor_5.0	20	6,072,078 - 6,073,272	UniSTS	Rnor5.0
Rnor_5.0	20	7,275,088 - 7,276,282	UniSTS	Rnor5.0
RGSC_v3.4	20	4,786,308 - 4,787,502	UniSTS	RGSC3.4
Celera	20	6,253,262 - 6,254,456	UniSTS
RH 3.4 Map	20	72.0	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH139398

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,656,317 - 4,656,544 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	3,989,387 - 3,989,613	NCBI	Rnor6.0
Rnor_5.0	20	6,068,935 - 6,069,161	UniSTS	Rnor5.0
RGSC_v3.4	20	4,790,419 - 4,790,645	UniSTS	RGSC3.4
Celera	20	6,257,373 - 6,257,599	UniSTS
RH 3.4 Map	20	64.6	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH139868

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,656,365 - 4,656,556 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	3,989,375 - 3,989,565	NCBI	Rnor6.0
Rnor_5.0	20	6,068,923 - 6,069,113	UniSTS	Rnor5.0
RGSC_v3.4	20	4,790,467 - 4,790,657	UniSTS	RGSC3.4
Celera	20	6,257,421 - 6,257,611	UniSTS
RH 3.4 Map	20	60.7	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	1	28	12	19	12					7	10
Low	1	26	29	29		29	8	11	33	29	29	1	8
Below cutoff		14							39	6	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC092567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC107946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC222892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC222893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC222894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC222895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC222896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000000528 ⟹ ENSRNOP00000000528

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,652,159 - 4,655,283 (-)	Ensembl
Rnor_6.0 Ensembl	20	3,990,820 - 3,993,769 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000082047 ⟹ ENSRNOP00000073470

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,652,972 - 4,653,435 (-)	Ensembl
Rnor_6.0 Ensembl	20	3,992,496 - 3,992,959 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000083291

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	3,990,613 - 3,993,769 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000089996

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	3,990,853 - 3,993,769 (+)	Ensembl

RefSeq Acc Id:

NM_080767 ⟹ NP_542945

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	4,652,159 - 4,655,122 (-)	NCBI
Rnor_6.0	20	3,990,809 - 3,993,772 (+)	NCBI
Rnor_5.0	20	7,275,040 - 7,276,378 (-)	NCBI
RGSC_v3.4	20	4,786,260 - 4,789,223 (-)	RGD
Celera	20	6,253,214 - 6,256,177 (-)	RGD

Sequence:

show sequence

GCTTTCACTTCCTTGTCCGAGAGTCGACGGATCTCCGGGGCTAAGTCGTCATGGCGTTACTGGA
TCTGTGCGGCGCTCCTCGGGGGCAGCGGCCCGAGTGGGCTGCCGTGGATGCAGGAAGCGGGCTT
CGCTCGGACCCGGGACACTACAGTTTCTCCGTGCAAGCTCCGGAGCTCGCGCTTCCCCGGGGAA
TGCAGCCCACTGAATTCCTAAGGTCCTTTGGTGATGACCAGGAAAGGAAGGTTCAGATTGAAAT
GGCGCACGGCACAACCACGCTGGCCTTCAAGTTCCAGCATGGAGTCATCGTGGCGGTGGACTCC
AGGGCCTCCGCAGGAAGTTACATTGCTACCATAAGGGTGAACAAGGTGATCGAGATTAACCCTT
ACCTGCTTGGAACCATGTCTGGTTGTGCAGCCGACTGTCAGTACTGGGAGAGGCTGTTGGCCAA
GGAATGCAGGCTATACTATCTGCGGAATGGGGAACGCATCTCCGTGTCTGCAGCCTCCAAGCTA
CTTTCCAACATGATGCTGCAGTACCGGGGTATGGGCCTCTCCATGGGCAGCATGATCTGCGGCT
GGGACAAGAAGGGACCGGGACTTTATTACGTAGATGACAATGGGACTCGGCTCTCGGGACAGAT
GTTCTCCACAGGCAGCGGGAACACCTATGCCTACGGGGTGATGGACAGTGGGTACCGGCAGGAT
CTCAGTCCTGAGGAGGCCTACGACCTTGCCCGAAGAGCTATTGTTTATGCTACCCACAGAGACA
GCTATTCTGGAGGAGTTGTCAACATGTACCACATGAAGAAAGACGGTTGGGTGAAAGTGGAGAG
CACTGACGTCAGTGACCTGCTGCACAAGTACCGAGAGGCCACTCTGTGATCACTGCTGGGCAGA
CATCCTCCCGGCCCTGAGGAGCTGGCAGACTCAGGGACCTGGGGCTACTTCAGTCTTAGGAGAA
AGACGGGCCCAACCTGGGCTGGAGACAAAGCTCTGAGGCTATGGAGACATCTTTGTTTACCCTC
TCACTTAGCCAGCCCTCACGGATACCTTCTAAGTACAATAAAAGAAAAACAGTTCTACATGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_542945	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AGV38989	(Get FASTA)	NCBI Sequence Viewer
	AGV38990	(Get FASTA)	NCBI Sequence Viewer
	AGV38991	(Get FASTA)	NCBI Sequence Viewer
	AGV38992	(Get FASTA)	NCBI Sequence Viewer
	AGV38993	(Get FASTA)	NCBI Sequence Viewer
	BAA01572	(Get FASTA)	NCBI Sequence Viewer
	CAE83942	(Get FASTA)	NCBI Sequence Viewer
	EDL96808	(Get FASTA)	NCBI Sequence Viewer
	EDL96809	(Get FASTA)	NCBI Sequence Viewer
	P28064	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_542945 ⟸ NM_080767

- UniProtKB:

Q6MGA4 (UniProtKB/Swiss-Prot), P28064 (UniProtKB/Swiss-Prot), A0A023IMI6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALLDLCGAPRGQRPEWAAVDAGSGLRSDPGHYSFSVQAPELALPRGMQPTEFLRSFGDDQERK
VQIEMAHGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAADCQYWE
RLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNGTR
LSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLARRAIVYATHRDSYSGGVVNMYHMKKDGW
VKVESTDVSDLLHKYREATL

hide sequence

RefSeq Acc Id:

ENSRNOP00000073470 ⟸ ENSRNOT00000082047

RefSeq Acc Id:

ENSRNOP00000000528 ⟸ ENSRNOT00000000528

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28064-F1-model_v2	AlphaFold	P28064	1-276	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701325

Promoter ID:

EPDNEW_R11848

Type:

initiation region

Name:

Psmb8_1

Description:

proteasome subunit beta 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	3,990,820 - 3,990,880	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3426	AgrOrtholog
BioCyc Gene	G2FUF-4554	BioCyc
Ensembl Genes	ENSRNOG00000000456	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000000528	ENTREZGENE
	ENSRNOP00000000528.4	UniProtKB/TrEMBL
	ENSRNOP00000073470.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000528	ENTREZGENE
	ENSRNOT00000000528.7	UniProtKB/TrEMBL
	ENSRNOT00000082047.2	UniProtKB/TrEMBL
Gene3D-CATH	3.60.20.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7387376	IMAGE-MGC_LOAD
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_T1A_subB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_beta8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_bsu_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_sua/b	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_suB-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24968	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:124945	IMAGE-MGC_LOAD
NCBI Gene	24968	ENTREZGENE
PANTHER	PTHR11599:SF53	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Proteasome	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Psmb8	PhenoGen
PRINTS	PROTEASOME	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	PROTEASOME_BETA_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEASOME_BETA_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A023IKI3_RAT	UniProtKB/TrEMBL
	A0A023IM45_RAT	UniProtKB/TrEMBL
	A0A023IMI6	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K5L5_RAT	UniProtKB/TrEMBL
	A0A8L2Q0A4_RAT	UniProtKB/TrEMBL
	P28064	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6MGA4	ENTREZGENE
UniProt Secondary	Q6MGA4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Psmb8	proteasome 20S subunit beta 8	LOC103690099	proteasome subunit beta type-8-like	Data Merged	737654	PROVISIONAL
2019-09-13	Psmb8	proteasome 20S subunit beta 8	Psmb8	proteasome subunit beta 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-08-19	Psmb8	proteasome subunit beta 8	Psmb8	proteasome (prosome, macropain) subunit, beta type, 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103690099	proteasome subunit beta type-8-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2013-04-04	Psmb8	proteasome (prosome, macropain) subunit, beta type, 8	Psmb8	proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Psmb8	proteasome (prosome, macropain) subunit, beta type 8 (large multifunctional peptidase 7)	Psmb8	proteosome (prosome, macropain) subunit, beta type 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Psmb8	proteasome (prosome, macropain) subunit, beta type, 8 (low molecular mass polypeptide 7)			Symbol and Name status set to approved	70586	APPROVED
2001-06-20	Lmp7	Low molecular mass polypeptide 7			Symbol withdrawn, duplicate of Psmb8 (RGD:3246)	67952	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_mapping	found in the major histocompatibility RT1 complex	1300431

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)